0001558370-23-005996.txt : 20230417 0001558370-23-005996.hdr.sgml : 20230417 20230417101538 ACCESSION NUMBER: 0001558370-23-005996 CONFORMED SUBMISSION TYPE: 8-K PUBLIC DOCUMENT COUNT: 37 CONFORMED PERIOD OF REPORT: 20230417 ITEM INFORMATION: Regulation FD Disclosure ITEM INFORMATION: Other Events ITEM INFORMATION: Financial Statements and Exhibits FILED AS OF DATE: 20230417 DATE AS OF CHANGE: 20230417 FILER: COMPANY DATA: COMPANY CONFORMED NAME: Elevation Oncology, Inc. CENTRAL INDEX KEY: 0001783032 STANDARD INDUSTRIAL CLASSIFICATION: BIOLOGICAL PRODUCTS (NO DIAGNOSTIC SUBSTANCES) [2836] IRS NUMBER: 841771427 STATE OF INCORPORATION: DE FISCAL YEAR END: 1231 FILING VALUES: FORM TYPE: 8-K SEC ACT: 1934 Act SEC FILE NUMBER: 001-40523 FILM NUMBER: 23823107 BUSINESS ADDRESS: STREET 1: 888 SEVENTH AVE STREET 2: 12TH FLOOR CITY: NEW YORK STATE: NY ZIP: 10106 BUSINESS PHONE: 212-651-6380 MAIL ADDRESS: STREET 1: 888 SEVENTH AVE STREET 2: 12TH FLOOR CITY: NEW YORK STATE: NY ZIP: 10106 FORMER COMPANY: FORMER CONFORMED NAME: 14ner Oncology, Inc. DATE OF NAME CHANGE: 20190719 8-K 1 elev-20230417x8k.htm 8-K
0001783032false00017830322023-04-172023-04-17

UNITED STATES

SECURITIES AND EXCHANGE COMMISSION

WASHINGTON, DC 20549

FORM 8-K

CURRENT REPORT

Pursuant to Section 13 or 15(d) of the Securities Exchange Act of 1934

Date of Report (Date of earliest event reported): April 17, 2023

Elevation Oncology, Inc.

(Exact name of Registrant as Specified in its Charter)

Delaware

001-40523

84-1771427

(State or Other Jurisdiction

of Incorporation)

(Commission File Number)

(IRS Employer

Identification No.)

888 Seventh Ave., 12th Floor

New York, New York

10106

(Address of Principal Executive Offices)

(Zip Code)

(716) 371-1125

Registrant’s Telephone Number, Including Area Code

Not Applicable

(Former Name or Former Address, if Changed Since Last Report)

Check the appropriate box below if the Form 8-K filing is intended to simultaneously satisfy the filing obligation of the registrant under any of the following provisions (see General Instructions A.2. below):

Written communications pursuant to Rule 425 under the Securities Act (17 CFR 230.425)

Soliciting material pursuant to Rule 14a-12 under the Exchange Act (17 CFR 240.14a-12)

Pre-commencement communications pursuant to Rule 14d-2(b) under the Exchange Act (17 CFR 240.14d-2(b))

Pre-commencement communications pursuant to Rule 13e-4(c) under the Exchange Act (17 CFR 240.13e-4(c))

Securities registered pursuant to Section 12(b) of the Exchange Act:

Title of each class

Trading Symbol(s)

Name of each exchange on which registered

Common stock, par value $0.0001 per share

ELEV

The Nasdaq Stock Market LLC

Indicate by check mark whether the registrant is an emerging growth company as defined in Rule 405 of the Securities Act of 1933 (§ 230.405 of this chapter) or Rule 12b-2 of the Securities Exchange Act of 1934 (§ 240.12b-2 of this chapter).

Emerging growth company

If an emerging growth company, indicate by check mark if the registrant has elected not to use the extended transition period for complying with any new or revised financial accounting standards provided pursuant to Section 13(a) of the Exchange Act.

Item 7.01.Regulation FD Disclosure.

On April 17, 2023, Elevation Oncology, Inc. (the “Company”) issued a press release announcing preclinical proof-of-concept data and a clinical case study for its lead candidate, EO-3021. The Company also hosted an oral presentation as part of the New Drugs on the Horizon special session at the American Association for Cancer Research Annual Meeting 2023 regarding the preclinical proof-of-concept data and clinical case study.

A copy of the press release and corporate presentation presented during the oral presentation are attached as Exhibits 99.1 and 99.2, respectively, to this Current Report on Form 8-K.

The information furnished in this Item 7.01, including Exhibits 99.1 and 99.2, shall not be deemed “filed” for purposes of Section 18 of the Securities Exchange Act of 1934, as amended (the “Exchange Act”), or otherwise subject to the liabilities of that section, nor shall it be deemed incorporated by reference into any other filing under the Exchange Act or the Securities Act of 1933, as amended, except as expressly set forth by specific reference in such a filing.

Item 8.01.Other Events.

On April 17, 2023, the Company presented preclinical proof-of-concept data and a clinical case study for its lead candidate, EO-3021.

The clinical case study is from an ongoing Phase 1 clinical trial being conducted in China by the Company’s partner, CSPC Pharmaceutical Group Limited. The clinical case study involves a patient with metastatic gastric cancer who achieved a confirmed partial response on treatment with EO-3021.

Key findings from the preclinical study include:

EO-3021 is an antibody-drug conjugate (ADC) comprised of a fully human immunoglobulin G1 (IgG1) monoclonal antibody (mAb) that targets Claudin 18.2 and is site-specifically conjugated to the monomethyl auristatin E (MMAE) payload via a cleavable linker with a drug-to-antibody ratio (DAR) of 2.
EO-3021 retains antibody-dependent cell-mediated cytotoxicity (ADCC) and complement dependent cytotoxicity (CDC).
EO-3021 reduction in cell viability requires Claudin 18.2 expression in vitro with no effects seen on Claudin 18.2-negative cells.
EO-3021 demonstrated anti-tumor activity in in vivo xenograft models of pancreatic and gastric cancers expressing varying levels of Claudin 18.2.
oA single dose of EO-3021 demonstrated tumor regression across low, medium, and high Claudin 18.2-expressing models, with a lower minimal efficacious dose in models with medium and high levels of Claudin 18.2 relative to models with low levels of Claudin 18.2.
oEO-3021 outperformed standard of care chemotherapy in gastric and pancreatic cancer in vivo models.

Key findings from the clinical case study include:

Patient was treated with dose level 2, or 1.0 mg/kg EO-3021, intravenously, every three weeks for 12 cycles (treatment ongoing).
The best overall response, as evaluated per RECIST v1.1, was a confirmed partial response (66.7% maximal tumor reduction).
Duration of response was approximately 11 months and ongoing.

Item 9.01. Financial Statements and Exhibits

(d)Exhibits

Exhibit
Number

    

Description

99.1

Press release issued by Elevation Oncology, Inc., dated April 17, 2023.

99.2

Corporate Presentation.

104

Cover Page Interactive Data File (formatted in Inline XBRL and contained in Exhibit 101)

SIGNATURES

Pursuant to the requirements of the Securities Exchange Act of 1934, the registrant has duly caused this report to be signed on its behalf by the undersigned hereunto duly authorized.

Elevation Oncology, Inc.

Date: April 17, 2023

By:

/s/ Joseph J. Ferra, Jr.

Joseph J. Ferra, Jr.

Interim Chief Executive Officer and President, and Chief Financial Officer

EX-99.1 2 elev-20230417xex99d1.htm EX-99.1

Exhibit 99.1

Graphic

Elevation Oncology Presents EO-3021 Preclinical Proof-of-Concept Data and Highlights a Clinical Case Study in Claudin 18.2-Expressing Cancers at AACR 2023

EO-3021 demonstrated anti-tumor activity in preclinical models expressing varying levels of Claudin 18.2

EO-3021 induced a confirmed partial response in a patient with metastatic gastric cancer

Company is on track to initiate a Phase 1 clinical trial in the US in the second half of 2023

NEW YORK, April 17, 2023 -- Elevation Oncology, Inc. (Nasdaq: ELEV), an innovative oncology company focused on the discovery and development of selective cancer therapies to treat patients across a range of solid tumors with significant unmet medical needs, today is presenting preclinical proof-of-concept data and highlighting a clinical case study in Claudin 18.2-expressing cancers for the company’s lead candidate, EO-3021. The data are being featured in an oral presentation as part of the New Drugs on the Horizon special session at the American Association for Cancer Research (AACR) Annual Meeting 2023, being held April 14-19, 2023, in Orlando, Florida.

EO-3021 is a potential best-in-class antibody-drug conjugate (ADC) that has been designed to selectively deliver a cytotoxic payload directly to Claudin 18.2-expressing cancer cells to minimize toxicities and maximize anti-tumor activity. EO-3021 is a fully human monoclonal antibody (mAb) that targets Claudin 18.2 and is site-specifically conjugated to the cytotoxic agent monomethyl auristatin E (MMAE), via a cleavable linker with a drug-to-antibody ratio (DAR) of 2.

“This is the first time that preclinical data are being presented for EO-3021, supporting its potential to effectively target cancer cells expressing Claudin 18.2,” said David Dornan, Ph.D., Chief Scientific Officer of Elevation Oncology. “We are also very encouraged by the results of the clinical case study involving a patient with metastatic gastric cancer who achieved a confirmed partial response on treatment with EO-3021 in an ongoing Phase 1 clinical trial being conducted in China by our partner, CSPC Pharmaceutical Group Limited. We look forward to initiating a Phase 1 clinical trial of EO-3021 in the US in the second half of 2023.”

Key Findings

EO-3021 is an ADC comprised of a fully human immunoglobulin G1 (IgG1) mAb that targets Claudin 18.2 and is site-specifically conjugated to the MMAE payload via a cleavable linker with a DAR of 2.
EO-3021 retains antibody-dependent cell-mediated cytotoxicity (ADCC) and complement dependent cytotoxicity (CDC).
EO-3021 reduction in cell viability requires Claudin 18.2 expression in vitro with no effects seen on Claudin 18.2-negative cells.
EO-3021 demonstrated anti-tumor activity in preclinical xenograft models of pancreatic and gastric cancers expressing varying levels of Claudin 18.2.
oA single dose of EO-3021 demonstrated tumor regression across low, medium, and high Claudin 18.2-expressing models, with a lower minimal efficacious dose in models with medium and high levels of Claudin 18.2 relative to models with low levels of Claudin 18.2.

Graphic

oEO-3021 outperformed standard of care chemotherapy in gastric and pancreatic cancer preclinical xenograft models.
A patient with metastatic gastric cancer in an ongoing Phase 1 clinical trial of SYSA1801 (EO-3021) in China (NCT05009966) conducted by CSPC Pharmaceutical Group Limited (HKEX: 01093) was also highlighted.
oPatient was treated with dose level 2, or 1.0 mg/kg EO-3021, intravenously, every three weeks for 12 cycles (treatment ongoing).
oThe best overall response, as evaluated per RECIST v1.1, was a confirmed partial response (66.7% maximal tumor reduction).
oDuration of response was approximately 11 months and ongoing.

The full presentation can be accessed under the resources and publications page of the Elevation Oncology website following the completion of the live presentation at AACR.

About EO-3021

EO-3021 (also known as SYSA1801) is a differentiated, clinical-stage antibody drug conjugate (ADC) comprised of an immunoglobulin G1 (IgG1) monoclonal antibody (mAb) that targets Claudin 18.2 and is site-specifically conjugated to the monomethyl auristatin E (MMAE) payload via a cleavable linker with a drug-to-antibody ratio (DAR) of 2.  Claudin 18.2 is a specific isoform of Claudin 18 that is only expressed in gastric epithelial cells. During malignant transformation in many solid tumors, the tight junctions may become disrupted, exposing Claudin 18.2 and allowing them to be accessible by Claudin 18.2 targeting agents. An Investigational New Drug application for EO-3021 has been cleared by the U.S. Food and Drug Administration.

About Elevation Oncology, Inc.

Elevation Oncology is an innovative oncology company focused on the discovery and development of selective cancer therapies to treat patients across a range of solid tumors with significant unmet medical needs. We are rethinking drug development by seeking out innovative, selective cancer therapies that can be matched to a patient's unique tumor characteristics. Our lead candidate, EO-3021, is a potential best-in-class antibody drug conjugate (ADC) designed to target Claudin 18.2, a clinically validated molecular target. EO-3021 selectively delivers a cytotoxic payload directly to cancer cells expressing Claudin 18.2. We are working to rapidly advance EO-3021 into the clinic in the US across a range of solid tumor indications, as well as exploring other opportunities through new or existing partnerships and business development opportunities to expand our novel oncology pipeline. For more information, visit www.ElevationOncology.com.

Forward Looking Statements

This press release contains forward-looking statements within the meaning of the "safe harbor" provisions of the Private Securities Litigation Reform Act of 1995, including, but not limited to, anticipated preclinical and clinical development activities, expected timing of announcements of clinical results, potential benefits of Elevation Oncology's product candidates, potential market opportunities for Elevation Oncology's product candidates, and the ability of Elevation Oncology's product candidates to treat their targeted indications. All statements other than statements of historical fact are statements that could be deemed forward-looking statements. These forward-looking statements may be accompanied by such words as "aim," "anticipate," "believe," "could," "estimate," "expect," "forecast," "goal," "intend," "may," "might," "plan," "potential," "possible," "will," "would," and other words and terms of similar meaning.  Although Elevation Oncology believes that the expectations reflected in such forward-looking statements are reasonable, Elevation Oncology cannot guarantee future events, results, actions, levels of activity, performance or achievements, and the timing

2


Graphic

and results of biotechnology development and potential regulatory approval are inherently uncertain. Forward-looking statements are subject to risks and uncertainties that may cause Elevation Oncology's actual activities or results to differ significantly from those expressed in any forward-looking statement, including risks and uncertainties related to Elevation Oncology's ability to advance its product candidates, the timing and results of preclinical studies and clinical trials, approvals and commercialization of product candidates, the receipt and timing of potential regulatory designations, the impact of the COVID-19 pandemic on Elevation Oncology's business, Elevation Oncology's ability to fund development activities and achieve development goals, Elevation Oncology's ability to protect intellectual property, Elevation Oncology's ability to establish and maintain collaborations with third parties, and other risks and uncertainties described under the heading "Risk Factors" in documents Elevation Oncology files from time to time with the Securities and Exchange Commission. These forward-looking statements speak only as of the date of this press release, and Elevation Oncology undertakes no obligation to revise or update any forward-looking statements to reflect events or circumstances after the date hereof.

Elevation Oncology Investor and Media Contact

Candice Masse, 978-879-7273

Senior Director, Corporate Communications & Investor Relations

cmasse@elevationoncology.com

3


EX-99.2 3 elev-20230417xex99d2.htm EX-99.2
Exhibit 99.2

GRAPHIC

EO-3021: An antibody drug conjugate targeting CLDN18.2 expressing cancers David Dornan, PhD Elevation Oncology, Inc. Institution Logo, if desired

GRAPHIC

Disclosure Information David Dornan I have the following relevant financial relationships to disclose: Employee of: Elevation Oncology, Inc. Consultant for: ReviR Therapeutics, Inc., Teon Therapeutics, Inc. Stockholder in: Elevation Oncology, Inc. 2 I will discuss investigational use in my presentation: EO-3021/SYSA1801/CPO102 in the Treatment of CLDN18.2 Positive Advanced Malignant Solid Tumors

GRAPHIC

Claudin 18.2 Expression Profile Confers Selectivity for Therapeutic Intervention 3 • Claudin 18.2 is part of a family of tight junction membrane proteins • Claudin 18.2 expression in normal tissues is restricted to the gastric mucosa with basolateral localization • During malignant transformation, changes in cell polarity may result in exposure of Claudin 18.2 • Claudin 18.2 is overexpressed in several types of cancers including gastric, pancreatic, esophageal, ovarian, and lung • Claudin 18.2 expression has minimal overlap (<20%) with HER2 or PD-L1 expression in gastric cancer • No approved therapies targeting Claudin 18.2 Adenocarcinoma of the Esophagus CLDN18.2 Immunohistochemistry Gastric Cancer Normal Stomach Mucinous Ovarian CLDN18.1 CLDN18.2 Tissue Distribution RT-PCR Turechi et al. (2011) Sahin et al. (2008) Claudin 18.2

GRAPHIC

Estimated Incidence of Claudin 18.2 in Solid Tumors Estimated New Cancer Cases Claudin 18.2 expression per disease type (IHC) Cancer Type US Incidence1 Global Incidence2 Gastric 26,500 1,090,000 77%3 (adenocarcinoma) Esophageal 21,500 604,000 78%3 (adenocarcinoma) Pancreatic 64,000 496,000 59-80%3-5 (PDAC) Ovarian 20,000 314,000 24%3 (mucinous) Lung 238,000 2,207,000 6%6 (adenocarcinoma) 1Siegel RL, et al. CA: A Cancer Journal for Clinicians. 2023; 73:1. 2Sung H. et al. CA: A Cancer Journal for Clinicians. 2020; 71:3. 3Sahin, et al. Clin Cancer Res. 2008 1;14(23):7624-34. 4Wöll et al. Int J Cancer. 2014; 134(3). 5Tanaka, et al. J Histochem Cytochem. 2011; 59(10): 942–952. 6Micke, et al. Int J Cancer. 2014;135(9):2206-14. *Any level of expression (e.g., ≥1% cells with any staining intensity of CLDN18.2) Abbreviations: US, United States; IHC, Immunohistochemistry; PDAC, Pancreatic ductal adenocarcinoma 4

GRAPHIC

Examples of CLDN18.2 Targeted Therapy Modalities Monoclonal mAbs Bispecific mAbs CAR T-cell Antibody Drug Conjugates zolbetuximab FL-301 AMG-910 (CD3) FL-302 (CD137) PT886 (CD47) Q-1802 (PD-L1) TJ033721 (4-1BB) CT041 LCAR-C18S LY011 EO-3021/SYSA1801/CPO102 CMG901 RC118 LM302 SOT102 SKB315 TORL-2-307 JS107 IBI343 5 Not an exhaustive list of all publicly disclosed programs Abbreviations: mAb, monoclonal antibody

GRAPHIC

Mechanism of Action for Antibody Drug Conjugates Modified from Tong et al. (2021) https://doi.org/10.3390/molecules26195847 6

GRAPHIC

EO-3021 Molecular Structure ▪ EO-3021 mAb Heavy Chain EVQLSESGGALVQPGESLRLSCAASGFTFSSYAMTWVRQAPGKGLEWVSSLSGSGRSTYYAASIKGRFTISRDNSKNTLYLQMSSLRAE DTAIYYCAKSLSYYHYYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ SSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPP SRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSL SLSPGK ▪ EO-3021 mAb Light Chain DIQLTQSPSFLSASVGDRVPITCRASQDISNYLAWYQQKPGKAPKLLIYSASTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFASYHCQQVK TYPLTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLS KADYEKHKVYACEVTHQGLSSPVTKSFNRGEC DO NOT POST 7

GRAPHIC

EO-3021 mAb is Specific for CLDN18.2 over CLDN18.1 Cell Binding Activity EO-3021 mAb: • Fully Human mAb • IgG1 Isotype • Kd = 0.6 nM for CLDN18.2 • No binding to CLDN18.1 10 -1 10 0 10 1 10 2 10 3 10 4 10 5 0 5000 10000 15000 20000 25000 HEK293-CLDN18.1 HEK293-CLDN18.2 Test article concentration (ng/ml) Binding activity (MFI) Test Article Concentration (ng/ml) EO-3021 Binding (MFI) CLDN18.2 ECL1 CLDN18.1 ECL1 8 HEK293-CLDN18.2 HEK293-CLDN18.1 Abbreviations: ECL1, Extracellular Loop 1; ECL2, Extracellular Loop 2; IgG1, immunoglobulin G1; TM, Transmembrane

GRAPHIC

EO-3021 is ADCC and CDC Competent: Modest Differences Relative to Unconjugated mAb ADCC CDC EC50 = 113 ng/ml EC50 = 39 ng/ml 10 -1 10 0 10 1 10 2 10 3 10 4 10 5 0 1 2 3 4 5 EO-3021 mAb EO-3021 Test Article Concentration (ng/ml) CDC Activity (OD490) Test Article Concentration (ng/ml) 10 Relative CDC Activity (OD490) -2 10 0 10 2 10 4 10 6 0 1500 3000 4500 6000 7500 9000 Test Article Concentration (ng/ml) ADCC Activity (RLU) EO-3021 mAb EO-3021 EC50 = 168 ng/ml EC50 = 99.7 ng/ml Test Article Concentration (ng/ml) Relative ADCC Activity (RLU) HEK293-CLDN18.2 + Jurkat/FCGR3A-NFAT CHO-K1-CLDN18.2 + human serum complement 9 EO-3021 mAb EO-3021 EO-3021 mAb EO-3021 Abbreviations: ADCC, antibody dependent cellular cytotoxicity; CDC, complement dependent cytotoxicity

GRAPHIC

EO-3021-Mediated Endocytosis and Reduction of Cell Viability is Dependent on CLDN18.2 Expression Endocytosis of Fluorescent Labeled EO-3021 EO-3021 Impact on Cell Viability IC50 = 100 ng/ml HEK293 HEK293-CLDN18.1 HEK293-CLDN18.2 HEK293-CLDN18.1 HEK293-CLDN18.2 HEK293 Cell Viability (RFU) EO-3021 Tx (2 mg/ml) labeled with Zenon pHrodo iFL, 24-hour incubation EO-3021 Tx (varying concentration), 72-hour incubation, resazurin assay Test article (ng/ml) 10

GRAPHIC

EO-3021 EO-3021 mAb 10 -1 10 0 10 1 10 2 10 3 10 4 0 10000 20000 30000 40000 50000 SYSA1801 SYSA1801 mAb Test Article Concentration (ng/ml) Relative Fluorescence Unit (RFU) EO-3021 in vitro Activity More Notable in Cell Lines with Medium or High Levels of CLDN18.2 Expression Pancreatic Cancer BxPC3-18.2 CLDN18.2 High Gastric Cancer NCI-N87-18.2 CLDN18.2 Medium HER2 Amplified Test article (ng/ml) Test article (ng/ml) EC50 = 28 ng/ml Pancreatic Cancer PATU8988S CLDN18.2 Low Cell Viability (RFU) Cell Viability (RFU) Approximately 15% of CLDN18.2 expressing gastric cancers co-express HER27 Test article (ng/ml) EC50 = 132,725 ng/ml Cell Viability (RFU) 10 -5 10 0 10 5 10 10 0 10000 20000 30000 40000 50000 EO-3021 EO-3021 mAb Test Article Concentration (ng/ml) Relative Fluorescence Unit (RFU) EC50 = 7 ng/ml 11 7Schuler MH et al. J Clin Oncol. 2017. 35:15_suppl 4038-4038.

GRAPHIC

EO-3021 Promotes G2/M Cell Cycle Arrest and Activates Caspase 3/7 Cell Cycle Distribution Post-Tx Caspase 3/7 Activity Post-Tx BxPC3-CLDN18.2, 600 ng/ml Tx, 66+3 hours BxPC3-CLDN18.2, 24+3 hours Vehicle EO-3021 mAb EO-3021 mAb EO-3021 G1 Test article (ng/ml) Caspase 3/7 Activity (RLU) Cell Cycle Distribution 12 EO-3021 S G2/M

GRAPHIC

EO-3021 Demonstrates Bystander Effect on CLDN18.2 Negative Cells HEK-293-Luc cells co-cultured with either BxPC3-CLDN18.2 (Ag positive) or BxPC3 (Ag negative) cells and Tx for 96 hours 13 Abbreviations: Ag, antigen 200 1000 5000 0 5×10 5 1×10 6 1.5×10 6 2×10 6 EO-3021 (ng/ml) HEK293-Luc Cell Viability (RLU) HEK293-Luc cells + BxPC3-CLDN18.2 cells HEK293-Luc cells + BxPC3 cells

GRAPHIC

Single Dose of EO-3021 Confers Tumor Regressions in CLDN18.2 High Expressing Xenograft Model BxPC3-CLDN18.2 Pancreatic Xenograft Model CLDN18.2 High Nu/nu mice were administered single dose of Tx, unless otherwise indicated. Dosing initiated on Day 0. 14 0 5 10 15 20 25 30 0 300 600 900 1200 1500 Vehicle EO-3021 2 mg/kg EO-3021 4 mg/kg EO-3021 8 mg/kg EO-3021 mAb 8 mg/kg Gemcitabine 50 mg/kg biw x8 Time (days) Tumor Volume (mm 3 )

GRAPHIC

Single Dose of EO-3021 Confers Tumor Regressions in CLDN18.2 Medium Expressing Xenograft Model NUGC4-CLDN18.2 Gastric Xenograft Model CLDN18.2 Medium, HER2 Amplified Nu/nu mice were administered single dose of Tx, unless otherwise indicated. Dosing initiated on Day 0. 15 0 5 10 15 20 0 250 500 750 1000 1250 1500 EO-3021 mAb 4 mg/kg Vehicle EO-3021 0.5 mg/kg EO-3021 1 mg/kg EO-3021 2 mg/kg EO-3021 4 mg/kg Cisplatin 6 mg/kg qw x3 Time (days) Tumor Volume (mm 3 )

GRAPHIC

Single Dose of EO-3021 Confers Tumor Regressions in CLDN18.2 Low Expressing Xenograft Model Nu/nu mice were administered single dose of Tx, unless otherwise indicated. Dosing initiated on day 0. 16 0 5 10 15 20 25 30 0 100 200 300 400 500 Time (days) EO-3021 20 mg/kg EO-3021 10 mg/kg EO-3021 9 mg/kg qw x3 EO-3021 6 mg/kg qw x3 EO-3021 3 mg/kg qw x3 EO-3021-mAb 9 mg/kg qw x3 Gemcitabine 50 mg/kg qw x3 Vehicle Tumor Volume (mm 3 ) PATU8988S Pancreatic Xenograft Model CLDN18.2 Low

GRAPHIC

Nonclinical Toxicology and PK Summary of EO-3021 ▪ EO-3021 mAb is cross reactive with major toxicology species ▪ NHP PK is dose proportional with t1/2 ~7 days ▪ General toxicology profile across species (cyno and rat) is consistent with either MMAE payload or CLDN18.2 targeting in the stomach ▪ Pharmacology/toxicology integrated data suggest EO-3021 can achieve doses in humans that result in anti-tumor activity EO-3021 mAb Cross Reactivity Test article (ng/ml) EO-3021 Binding (MFI) 17 Mouse CLDN18.2 Cynomolgus CLDN18.2 Human CLDN18.2 Rat CLDN18.2 Abbreviations: MMAE, monomethyl auristatin E; NHP, non-human primates; PK, pharmacokinetics; t½ , half-life

GRAPHIC

B A S E L I N E W E E K 2 4 EO-3021/SYSA1801 Activity in a Patient with Gastric Cancer ● Patient: 47-year-old female with gastric cancer ● Metastases: lymph nodes ● Prior therapy: XELOX (oxaliplatin + capecitabine) with immunotherapy ● EO-3021 treatment: 1.0 mg/kg IV Q3W x 12 cycles (ongoing) ● Target Lesion: Retroperitoneal lymph node ● RECIST v1.1: Best overall response of confirmed partial response (66.7% maximal tumor reduction) ● Duration of response: ~11 months (ongoing) ● Clinical Trial: Phase I (NCT05009966) -100 -80 -60 -40 -20 0 20 40 0 1 2 3 4 5 6 7 8 9 10 11 12 T A R G E T L E S I O N C H A N G E F R O M B A S E L I N E ( % ) T I M E F R O M S T A R T O F T R E A T M E N T ( M O N T H S ) P R P R P R P R ( o n g o i n g ) P R Progressive disease Partial response P R 18 EO-3021 is under investigation in a clinical trial and has not been approved for any indication by a regulatory administration Image courtesy of Peking University Cancer Hospital & Institute

GRAPHIC

EO-3021 Summary ▪ Antibody drug conjugate composed of a fully human IgG1 CLDN18.2 selective mAb conjugated at Q295 with a vcMMAE linker payload to give DAR2 ▪ Promotes cell killing of cell lines expressing CLDN18.2 and a consequential bystander effect on CLDN18.2 negative cells ▪ Robust in vivo activity in xenografts with varying levels of CLDN18.2 • Single dose tumor regressions in models with varying levels of CLDN18.2 with a lower minimal efficacious dose in models with medium and high levels of CLDN18.2 relative to models with low CLDN18.2 ▪ Pharmacology/toxicology integrated data suggest EO-3021 can achieve doses in humans that results in anti-tumor activity ▪ Confirmed PR (66.7% reduction) with 11 months (and ongoing) duration of response in a patient living with metastatic gastric cancer in an ongoing Phase I clinical trial (NCT05009966) ▪ Elevation Oncology sponsored Phase I trial to initiate in US 2H 2023 19

GRAPHIC

Acknowledgements CSPC ▪ Mo Dan ▪ Xiwu Hui ▪ Yancui Wang ▪ Can Yuan ▪ Yang Zhang ▪ Xiaoyan Wang ▪ Charles Wang Elevation Oncology ▪ Thomas O’Hare ▪ Jaya Srivastava ▪ Valerie Jansen ▪ Shawn Leland ▪ Joe Ferra Peking University Cancer Hospital & Institute ▪ Yakun Wang ▪ Jifang Gong ▪ Lin Shen

GRAPHIC 4 elev-20230417xex99d1001.jpg GRAPHIC begin 644 elev-20230417xex99d1001.jpg M_]C_X 02D9)1@ ! @ 0 ! #_VP!# ," @," @,# P,$ P,$!0@%!00$ M!0H'!P8(# H,# L*"PL-#A(0#0X1#@L+$!80$1,4%145# \7&!84&!(4%13_ MVP!# 0,$! 4$!0D%!0D4#0L-%!04%!04%!04%!04%!04%!04%!04%!04%!04 M%!04%!04%!04%!04%!04%!04%!04%!3_P 1" !$ / # 2( A$! Q$!_\0 M'P 04! 0$! 0$ $" P0%!@<("0H+_\0 M1 @$# P($ P4% M! 0 %] 0(# 01!1(A,4$&$U%A!R)Q%#*!D:$((T*QP152T? D,V)R@@D* M%A<8&1HE)B7J#A(6&AXB)BI*3E)66EYB9FJ*CI*6FIZBIJK*SM+6VM[BYNL+#Q,7& MQ\C)RM+3U-76U]C9VN'BX^3EYN?HZ>KQ\O/T]?;W^/GZ_\0 'P$ P$! 0$! M 0$! 0 $" P0%!@<("0H+_\0 M1$ @$"! 0#! <%! 0 0)W $" M Q$$!2$Q!A)!40=A<1,B,H$(%$*1H;'!"2,S4O 58G+1"A8D-.$E\1<8&1HF M)R@I*C4V-S@Y.D-$149'2$E*4U155E=865IC9&5F9VAI:G-T=79W>'EZ@H.$ MA8:'B(F*DI.4E9:7F)F:HJ.DI::GJ*FJLK.TM;:WN+FZPL/$Q<;'R,G*TM/4 MU=;7V-G:XN/DY>;GZ.GJ\O/T]?;W^/GZ_]H # ,! (1 Q$ /P#]4Z*** "B MBHKJZALK:6XN)4A@B4O))(V%50,DDGH*!I-NR):*S?#_ (CTSQ7I4.IZ/?0Z MC839\NXMWW*V.#6E0.490DXR5F@HHHH)"BBB@ HHHH **** "BBB@ HHHH * M*** "BBB@ HHHH **** "BBB@ HHHH ***K:CJ-KI%C/>WMQ':VD"&26:5@J MHHZDDT#2)OVN_&,O@7 MP%+)IO@2TO:0F3L/[S_ / 5 M]V?J>3Y/++9J*8;^PN+CQ7\*-3=1 M,00SP,>-V1\H<=CP&''!Y'V-X1\7Z1X[\/VFMZ'>QW^FW2!XYHS^A'4$=P>1 M7Q;X>U[7?V7M9;X=_%*W7Q#\-]7'EQ7^PR11!NK 'G )^9>HZC/>[/!KG['/ MB>'Q)X9FD\4?"'6G61XHI/,^SANA#=,X^ZW1AP>>:#?-%1:1 MKI='_+479[_J6\<"*DS*H57MW(X _B-?6UW_QZ3?[C?RKXG_9>^%WQ.\2?"W[? MX=^+LGA?2I-4OA%IBZ'#,X)R>>E;P^%N]MC"6Z/J;X:?#&?X,/M14AO$UY%<&#&>(_+BCQG/.<]*XGX<>+]9U3]J/XP:!=ZC//HVE6 MFD/963MF.W:2 M(5';<>37<_"WPGXJ\(Z1>"[ M?QOXF\(:,?"5SJ\G_"-W<<$DLZ7D42[B\;@C;*W;/ Y]?HBOESXP^%O$_B[] MKOPY9^$_%S>"]23P1=ROJ"V*79>(7T ,>QR ,EE.?]G'>E3W"6QZ#X=_9VO? M#^NV&I/\7OB3JR6DRS&QU'5;:2WG"G.R15ME)4]" 1QWJM\=_%FL_#CQY\-O M$D6I3P^%I]2.C:Q:;OW)^T#$,I'3(D &>P8T_P %_"?XJ:%XHT^_USXR2^(= M)@2#D#M75?'CX=CXJ?"/Q-X;08O+JT9K-P<%+E/G MB8'L=ZKS3NN97=Q6TT.J\3^(K3PGX;U/6[YPEGI]M)=2L3CY44L>?PKSW]F* MZ\2:Q\']*UWQ5?SWVK:Y)+JFV&5RT,*C^$+'L&/7->.>,/BC)\ MOC)#::?XK\6:SX%\>:KJ?C#4Y;TW6G>&;FXMVLQ\ENB2!<,HC&>.,L:ZW]C# MQ:ML/&OP]:PU328M!U%KO2K+6K)[2Y73[@EXP8GY"JV]1ZXK2<+1M;8F,M?4 MR?VAOA)K_P ,/A!XP\8Z1\9?B5)J.F6K74%O>S#ZUZ# M\,_@;J%@?#OB.Z^+'Q$UAQ%%=R:;J.J6\EI,2@)1T%N&*\]-P/O4_P"V9_R: M[\1O^P6W_H:UZ9X&_P"1+T#_ *\(/_1:U+D^1?UV'9\=]KS-MBB![#JQ/95/4X%<-\:O^3G?V>_^N^N_P#I"M1_M/SV^E>/ M?@5J^IX71;7Q@(9Y7^Y'-+:S);LWI^\QR>E"2?+?M^K"]KD6C?L^^/\ QE:K MJOQ#^+WBJQUJX7>VE^"[I--L++//EK\C-)MZ;F/-4CK_ (\_9L\9:'9>*?$L MWCWX;ZY>)IT.KZE$J:EI-RYQ$LSH LT;MQN*@@D=J^DJ\(_;5N8?^%$7VGC# M:IJ>H6-GIJ;L,;IKA"FWN2,&B,G*7*]F#5E='0?M5^)M4\'?LZ>/M;T2^ETW M5;'2Y)K:[@;#Q.",,#ZUS_[-WQDUS7T/@7XAI':?$+3;2.Z$Z<0ZQ9L!LNX> M!GKAU'W3Z9P+'[8JLG[)?Q&5_OC1'#?7Y:C^*7PQO?&7PN\*^(_#+"U\>>%[ M.'4-%NAP9&$2^9;/ZQRJ-I![X/:B-N2SZO\ R!WYKHL77B[6$_;-L/# U&<: M _@.?46T_=^Z-R-0CC$N/[VPE<^AKVNODWX8?$BR^+'[7?A?Q+91M;_:OAE< M"XM9.'MIUU2)9(F'8JP(KZRJ:BLTAQ=RKJFJ6>B:=+_$O[:/C.?PQX5:;1_AKIT@_M#4W!4W//?ZX^5/3DU]FZEIMK MK%A<6-];QW5G<(8Y8)5W*ZG@@BOC#QU^R_\ $'X?>*;S3?A9J<\'A+Q2WDWD M/FX^Q#J=QZ[<9 8%YX.$ZLJDU"NE^[E/X(_S/_$EK&^E_,9XN\:O MJ,UM\#/@5:A($S'JFM0'C'21O,';^\_V>IMK;2?V<-!B\"^!(O[9\>:G MM2]U%$W2!SV'OZ+T'4U-91:/^S[H4?P_^'D(U?QQJ!"7^HHNYQ)CN?;)PO1> M2>,NN_$75$.T,=YB+=3Z@9[]6Z=*^8S#,.;FHT)\L8_'/M MY+O)_AZGU,YPG&-&E!RA)WC%_%6E_P _*CZ06Z3*%MK,6L6D_P +?C)9D_:, M"TU.9@2C'[K>9VYZ,/H:X/3M4UC]D[Q!+X$\>PMXD^%.LEDMKQX]ZQ*W7CL1 M_$H^JUZ1I?B&R^.MA)X.\_:LM-?M]+TK4/A MA\7[1KG2UB/V34"I=@H'R%&Z_P"Z>W0USX',5ATHU9!_&^C_$7PQ9:_H5VMYIUVFY'7JI[JP[,#P17S/\ LD>%=9%K MX@T%Y)-:^&$]&MM)T>RAT_3K9= MD5O N%0?Y[U]/0KT\3!5*3NGU_X<^5XHJTG4]A5]^O"RYUIS1MISKI-;/\2_ M(@D1D/1@0:^6G]KVLZW$2RN7,;%#AL$ MXS7TC174I..A\$U+/ MA%X_T+XQ:[X]^'>L:'$WB&RMK74]/UVWD9=\ *QR1NAS]TX(->[T4*33NA6/ M*/!<'QH3Q):'Q5=>#Y-"RWVA=,BN!<'Y3C:6..N.O:J7Q9^%/B[5/B3X?^(' M@/6=.T_Q!IVGSZ3<6FKP-);75K*ZR8RA!5@Z Y[XKV2BCG:=T%M+'COAVW^. MJZ[8'6[SP2^CB9?M:V4-R)C%GYMA8XW8Z9KV*BBDW<:5CYZ^&O[+T_@3]H'Q M'XUEU2*Z\-2R75WHFD!3NL+B[\HW;9Z89HS@#H&KTKXX>"=7^(_POUSPQHM] M#IUWJL:VKW,X)"0LP$N,A:?I-D@C MM+&W2VB4#HJ*%'\JX36?A;>2?';0/'^EW4%O%'IL^EZM;2 [KB,D/$RXXW*P M(Y[$UZ7123:'8X+X\?#V[^*_P@\4^$;&YBL[O5K,V\<\X)1#N!R<<]JZWP]I MSZ/H&FV$C!Y+6VCA9EZ$JH!(_*M"BE=VL%M;GFGQ ^&6H>+/B_\ "_Q7;7%O M%8^%9-1>ZBD)\R7[1;K$FS QP02B_%;P5J?A?7[ M\5!P YBR)#_M<9JWX4^!WBCQ)XXT[QE\5/$-IKE_I3&32M#TJ%HM/L)",&3Y MCNE?!(#-C'I7N=%5SL7*C@?CU\/+OXL_!SQ;X/L+F*SO-8L7M8IYP2B,2.3C MG'%=?H&GOI.A:=8R,'DMK:.%F7H2J@$C\JOT5%W:P[:W/ _!7[,I\"?M3:]\ M3M.OXET/5M%ELFTH@[H;F2>*5W3L%8QL2/5J]\HHIRDY;@DEL%(RAE(/0C'! MQ2T5(SY<\<> O$'P(\8R^+_"$/\ :.G7@:*2*:/S7@+GH>^,XP1]#6MX.\&P M^ H9/'_Q E.H^*+H^9:VDQW-&QZ8!_B'Y*/>OHQE##! (]#7"ZA\+8=;\+]*7S%DW[?, .57 M/4\XP>H-;G@G0Y/CQX%AM?'&G,US82 0:M"P5Y@.O/J0,'MWZUVOB[X+Z1XI MUZVU'<;,;O\ 2HH1@3@=/H>Q/I7>65C;Z;:16MK"D%O$H5(T& H':N?+\LS& M6*F\?RN"5FTOXO:36T;???R)Q.<4(86%/"-\R=XWWI]XI[M/MM8BTC2+/0-, MMM.T^W2TLK=!'%#&,*H'^>O>KE%%?,%E^A(XK:$^1F75.Y\7:K=^"=<^/_C^'XV^)=2TB_L-1A7PMITNIW-E:"QV+ MMF@$3*KNSE@^<]A7??MBZE+:)\-+34]6U/1/AC>ZL\?BC4M+FDB=8A"3;I)( MGS+$\G#'/I[5]&7>E65_)')=6<%Q)$=R/+$K%3Z@D<=:GF@BN8C%+&DL9ZHZ M@@_@:/::I]A\NC1\R?LGZA:CXB_$#2O!>K:AK?PHLX[7^R9[RXEN8HKLAO/B M@EE)9HP G,Q*0(P> O M4\<5].6MI!90K#;PQP1+P$B4*H_ 4TZ=:-<>>;6$SYSYIC&[\^M#FFW=;@HM M6/D[]HZ[T*]_:'TS2?BKKVI:#\,!X>-QIWV>\GL[2YU+SF$@EDB()=8PI52> M_'4BNU_95UKQ-J/P&U>X>\U#5TM[Z_B\-WNK[C M^W=A;:A'Y=U;Q7* YVRH&'ZU*B+$@1%"*HP%48 I.=X\M@Y=;GYT? ;X@Z5; M_%SX;G5AJOB+XD:Q>26^M7%[KUTMQIUSMD\Q'L_]7Y*CA>W(]*]R_;/TCQ%H M=]X1U_PAX@FT'4O$M_#X(O"&8Q^5>ML6=5! $D9!(8TTZW2VC>XD,DCA1C<['EF)R23U)-;%%%<^YH%%%% !1110 4444 %%%% M !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 3%%%% !1110 4444 %%%% '__V0$! end GRAPHIC 5 elev-20230417xex99d1002.jpg GRAPHIC begin 644 elev-20230417xex99d1002.jpg M_]C_X 02D9)1@ ! @ 0 ! #_VP!# ," @," @,# P,$ P,$!0@%!00$ M!0H'!P8(# H,# L*"PL-#A(0#0X1#@L+$!80$1,4%145# \7&!84&!(4%13_ MVP!# 0,$! 4$!0D%!0D4#0L-%!04%!04%!04%!04%!04%!04%!04%!04%!04 M%!04%!04%!04%!04%!04%!04%!04%!3_P 1" !% / # 2( A$! Q$!_\0 M'P 04! 0$! 0$ $" P0%!@<("0H+_\0 M1 @$# P($ P4% M! 0 %] 0(# 01!1(A,4$&$U%A!R)Q%#*!D:$((T*QP152T? D,V)R@@D* M%A<8&1HE)B7J#A(6&AXB)BI*3E)66EYB9FJ*CI*6FIZBIJK*SM+6VM[BYNL+#Q,7& MQ\C)RM+3U-76U]C9VN'BX^3EYN?HZ>KQ\O/T]?;W^/GZ_\0 'P$ P$! 0$! M 0$! 0 $" P0%!@<("0H+_\0 M1$ @$"! 0#! <%! 0 0)W $" M Q$$!2$Q!A)!40=A<1,B,H$(%$*1H;'!"2,S4O 58G+1"A8D-.$E\1<8&1HF M)R@I*C4V-S@Y.D-$149'2$E*4U155E=865IC9&5F9VAI:G-T=79W>'EZ@H.$ MA8:'B(F*DI.4E9:7F)F:HJ.DI::GJ*FJLK.TM;:WN+FZPL/$Q<;'R,G*TM/4 MU=;7V-G:XN/DY>;GZ.GJ\O/T]?;W^/GZ_]H # ,! (1 Q$ /P#]4Z*** "B MBH[BXBM())YY%BAC4L[NFQ:AI=Y#?V4N=D\#A ME;\15Z@1SA5 ZDGL*^-_B9\4_$7[4OC.7X=_#EY+;PK V-6UP9"R+G MD _W?0=6^E,^)7Q*\1_M7^,Y?A[\.Y)+3PC;N!JNM@$+(H///]WT7^+Z5G>, MO&%MX'MK;X'? ^U-YKEP?*U36(.6#=')<=_[S=%' IGZEDV32R^49U(IXEKF M2E\-&/\ S\J>?\L0T^7Q1^Q%XJ@22>;Q'\,-2< SKR;=SU/' /Z&OLSPQXGT MSQCH=IJ^D7<=[872!XY8SD$'L?0^U?$OA3Q7K'P(U&3X5?&2V&K>#=479:ZD M^9(X]W4ACS@$\CJ.M7K2\\0?L6^+H;FWEF\1?"/69 \@Z_%[Q)I7,8M;2.$QQJDK* ,KGH*^LM5_Y!=Y_P!<7_\ 037Q+^S% MX/\ C3JOPM2X\(^/M$T70VU"\\BRN](\^2/]^^:WI_"W>QA+='U5\,/ MAYK'@*._75O&VK>,3; M2-+@LVL[8XVQ%U);'UKM/A/HOCK0]&NHO'GB*Q\1ZBTVZ&XL++[,J1X^Z5R< MG/>O+OA#_P G:?&7_KVT_P#]!-):\U^W^0^Q]$U\Z?%\^*?&'[2?AGP/H_C3 M4_"&E3>&;K59GTQ49Y)8[B.-<[@>,.?RKZ+KY3^.&D>,]:_:]\(0>!M>LO#N MLCP=>N]U?VGVE&B^UQ!D"9'.2IS[&E3W">QZ+X?^ _BO1M;LKZY^,'B?5(() M [V=Q'"(Y@/X6PN<&F?''QIK?PW^(?PWUN._>/PG?7[:-JML?]6'F'[B0^^\ M;?QJ'P5X*^.>G>*+"X\2?$/0M5T2-\W-G;:-Y,DJXZ!]QQ75?M"_#YOB=\'O M$NA0@_V@UL;BQ=?O)QW*!GWJK^\KNXK::':^(=UD0?$OXHR_&;]FKX=^'M.D*:U\1[NVT2X1&U1 MMINF6N%'0)'&O^ J7'EC9[C3N[GS?^U#\:O&7A[QC8Z/X (E?P M[;CQ!XA4+NWV@;'D^S,-S?A7T9X4\26?C+PQIFMZ?*);/4+9+B)U]&7/]:^0 MO@/\-[ M:;2O%W@&,WB1^&-2%.%SCFNX^%7PD\6B'PUXE MU'XL>(]6BD@ANYM-N(X1#+N0$H2%SCG]*T?VQ?\ DVGQ]_V#G_F*]"^&O_). M_#'_ &#+;_T4M2Y/D'9"U\<_!&[U$A=(C\6HDK/]P3-!((,_\#Z&A13=0N;^ MRATX X8W1N$V8]^#1&7,^5K1B:LKHW_VK?%VJ^!/V\L77C[5$ M(E\VV?U5U!&/7%$4G"S[@[WNC5O_ !QK<7[7^E^%%OW&@2^%Y;Y[+C:9A,%# M_7%>W5\E> OB#8?%+]K;P=XFTX%(+[P/,SPM]Z&07 #QL.Q5@17UK4U%:R\A MQ=[D-Y>0:?:RW-S*D%O$I=Y)#A5 ZDFOC3XD?$?Q)^UEXRD^'_P_DDLO!ML^ M-4UL A95!YY_N^@[_2OL/7-$LO$FD7>EZC MS8W<;131-T92,$5\/^*/@Q\4 M?@3XEO\ PY\-9IKGPSXJ?RHY%7+6A[[F_AP,_-Z5F??\*QPCJ5)RE%8A+]WS M_ N\O.45JD]#3\9^,8O!-I:_ [X'6OVG7+C]UJ>L0\LA/#DN.A]6_A' KH]& MT31/V4?"ZZ#H"IX@^)NL*!=7P7>R,W8#J%!/"]2>34FB:/HW[+GAD:%H"KK_ M ,2M7 6YNP-[J[?J ">!WZFM?3]'T[X"Z2_B_P 6S?VSX[U$%H+9VW,CGT]_ M5NW05\UF&8-\U##RM;XY](KR[R?1'U,ZE.4%2IISIS=TG\>(G_-+M371;6*$ M6JV7Q3TBX^&?Q=M&M-:/-EJ,RA9 Y^Z=W0,/7H>E<'X9\2ZA^S[K%Q\)OBU; MC6OA]J>8[#5)E+1QH3P<]E_53R.*])@U?2OVD]%?3-5ACT+QU8@M;R %=_< M9YQ[=JRTU?2_&GA^_P#AG\7(1;75JC?9-4E&&0J.&#>O\ZPP&8JDHTZT^:G+ MX9O_ -)EV:_$=-\BG0JTFHWO.G'>#Z5:+[=TCD+>Y\1?L3>,8[JUDF\2_!_6 MY0Z.AWFU+="". P'X.!ZU]F^%_%.E^--"M-9T:\BO].ND$D4\1R"/Z'U%?*W M[+6D:QK.F^(/ .M;/%OP[57BANKE"IB&?E5<]0>H'537U#X)\$:-\._#=IH. M@V:V.FVH(2)3DDGDDGN3W-?2T:]/$0]I2=UW/EN*9474]G6UQ$;7FM%.-M') M;J:V??[C9GA6X@DB;.UU*G'H1BOF/X>^#?C?\#-*N_"WAWP]X4\4Z#'>SW-E M?W.IRVDWER.7V.FQOF&<9!Q7U!173&7+H? -7.%^&&K_ !"U6._/CSP]H^@N MC+]E&DZ@UT)!SNW95=N.*\S\2_#SXF> _C1X@\;^ -/T#Q%9>(K6&*\L=6NY M+66"2+(#*X5@5(/3%?0U%"E9MV"USR7P1XD^,U_XFM(/%/@OPUI6AL&\^[L- M8>>9./EVH8P#D^]9/QC^'7CH?%?PQ\2/A^FDZEJ>FZ=<:/>:1K$SP1SV\KK( M&210=K!E'4=*]PHHY[.Z06TL>,>'_%7QUN=;LHM8\">%;/2WD N;BVUR222- M.Y53&,GVS7L]%%)N_0:5CYG^%/[,FM>"?VBM<\4:A=V]QX*L3>7'ABR1B9+2 M>]9&NLCH -K!1_M&O6/CSX6\0>./A9K?A[PT\,6I:G&MJ99Y"BQQ,P$C CN% MSCWKT"BJ'+7PEX9TK1;-%2VT^VCMHP!CA5 S^.,UYYK/P MOU6U_:+T+Q_HOV==/N-)FTG787?:[J&#V\@'\15MR_1J]9HJ5)K4;5SSS]H/ MP)J7Q,^#?BGPQI!B&I:E:-! 9VVIN/J>U=7X.TJ;0O"6BZ=<[?M%I90P2;#D M;E0*0!QYL05-J]^ M173_ !9^%^D?&'P+J/A?6?,CM[H!HKF [9;:93NCEC/9E8 BNPHI\ST\@LCY MYTW4/VB?A[:1Z/+X<\-_$V"W C@UL:L=,N)$' ,\;(X+^I4X-2>'O@_X[^)G MCS2?%_Q;N],MK/1)/M&C^$M$9I+>"?&/.GE8 RN!T 4=:^@J*KG[(7*>:_M M)_#[5/BK\!_''A#13"-5UC3)+2V-P^R/>V,;CV%=KX5TV71_"^CZ?<;3/:V< M,$FTY&Y4"G'MD5JT5%]+#MU/FSP)^S'J7P__ &L=8\?Z?I&2,C&1U%.HJ1GR9XQT#6/V?\ MXC3>+(K,>(=.O=X2>Y!9XG;H">QST/<5M^#/![%_#&3WE+JTNB[GWM'/EB:?)7M"2C:4U\4H MK:,>S?5]CS/QUH.E_$_2V\9>&)UT3Q1IG[R2/<$+@=,^_O5S0_#]M^TAX2A_ MX2&PETS7=/98VU")1B5>^#WS^E==XL^!=OJVNPW6F3C3K.8@7<"< K_LBO2M M$T2S\/Z;#8V,*PV\0P% Z^Y]ZY\OP&85L3../A%0M:36U1]))?9\_,G$YQ1H MX:FL)-N:=X-[TUUBW]I/HNQ!X6\+Z=X.T6WTO2[=;>UA7 "CECW)/)=>^)][X*\1>%+JXBT/08 M;A8HT6)-T):,C,WFL /QK[MKD=?^$G@OQ3KD6LZOX7TO4=5BVE+NXME>0;3D M+;S1K*Y>6+Y&@GD\O=QVY8\ M>]1Q 2/&O MW5+=2!34X\KC87*[IW/ER'5?^%F_&[QW:>,?B)?^#%\/:C';Z3HMK>+:+)#A M2)CN_P!9O)Q79?M9>+M6T>[^&WAZ#Q!/X3\.>(=6>TUCQ# P5[>-8MT<>\\) MYC?+N]J];\4?"3P9XUU:WU/7?#.FZIJ%OCR[FYMU:1<'(Y]C6SXC\*Z/XOTB M32M;TVVU33I,;K6ZC#H<=.#1SJZ=A\KLT> ?LU>*=0B^*_CWP39^)KCQIX/T M>WMI[+5KF03/%,Y(>W,HX; /XU;_9[^*D=_X^^)>B:]XDA>^A\0O;Z?875P MHE$>T$*B$Y(Z]*]N\*>"M!\"Z:;#P_I%IH]F6WF&SB$:D^IQU-9DGPC\%R^* MAXF;PQIA\0"3S1J7V=?.WXQNW=*?VE(? OB#QK=^ M O!]MX=&JVLUI<"V;4;HRLC*93_SS4 [1ZUTG[,WQ&\2^(_@OXGO;V];Q-+H ME_?6>E:NR8.IPQ9\N0XZY/&1UQ7L?C'X<^&/B%#!%XET&PUN. EHA>PB382, M'&>E:VD:-8:!ID&G:;9PV-C H2*WMT"(B^@ H]\=^ M M3\1>*=?UKQ%XDFD2>S@O8TL[*;+9MWM_O#:!U->M?MAZSXX^'FH>&=?\&Z MS]G_ .$CN$\'RV5PW[J*XNVVP72#^^A#?I7M]G\'O!&G^)SXCMO"NE0:Z7,A MOX[91+N/4[L=?>M_7/#>E>)H[2/5;"WU!+2YCO;=;A PBGC.4D7/1E/0U3J1 MYE)(2B[6N0^#]!D\+>%M*TB6^GU.:SMDADO;EMTD[@?,['U)R?QK8HHKGW- MHHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "B ABB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH __9 end GRAPHIC 6 elev-20230417xex99d2g001.jpg GRAPHIC begin 644 elev-20230417xex99d2g001.jpg M_]C_X 02D9)1@ ! 0 0 ! #_VP!# ," @," @,# P,$ P,$!0@%!00$ M!0H'!P8(# H,# L*"PL-#A(0#0X1#@L+$!80$1,4%145# \7&!84&!(4%13_ MVP!# 0,$! 4$!0D%!0D4#0L-%!04%!04%!04%!04%!04%!04%!04%!04%!04 M%!04%!04%!04%!04%!04%!04%!04%!3_P 1" +M!34# 2( A$! Q$!_\0 M'P 04! 0$! 0$ $" P0%!@<("0H+_\0 M1 @$# P($ P4% M! 0 %] 0(# 01!1(A,4$&$U%A!R)Q%#*!D:$((T*QP152T? D,V)R@@D* M%A<8&1HE)B7J#A(6&AXB)BI*3E)66EYB9FJ*CI*6FIZBIJK*SM+6VM[BYNL+#Q,7& MQ\C)RM+3U-76U]C9VN'BX^3EYN?HZ>KQ\O/T]?;W^/GZ_\0 'P$ P$! 0$! M 0$! 0 $" P0%!@<("0H+_\0 M1$ @$"! 0#! <%! 0 0)W $" M Q$$!2$Q!A)!40=A<1,B,H$(%$*1H;'!"2,S4O 58G+1"A8D-.$E\1<8&1HF M)R@I*C4V-S@Y.D-$149'2$E*4U155E=865IC9&5F9VAI:G-T=79W>'EZ@H.$ MA8:'B(F*DI.4E9:7F)F:HJ.DI::GJ*FJLK.TM;:WN+FZPL/$Q<;'R,G*TM/4 MU=;7V-G:XN/DY>;GZ.GJ\O/T]?;W^/GZ_]H # ,! (1 Q$ /P#VM-/CA3IN M/:O/_&=Q'<72VL6"8R6=A_>]*TM9\1&WL(S$I&#+)]X_3TKF(H"YR26). M22>M?JLI]&?F6#PLHOGGN5DMG[N IS[5.NFGC*D?6IN6IG$_V,>R M_I0-&;^[7=II@/44_P#LE2/NU%RO:'!?V2P_AIR::X(&*[K^QE/53^-*FAJ7 M&$_&CF12J',6FG% /EQ[UH):L.U=*NB8 XI?[)=3PM/F1$IW.?:P$D>,<^M4 MA;&-BI[5V(TTKC@@5FW=AB<\&HDTT).YEQP \%14Z60;VJVMH15B.VQVI70- M%#^S<]\TO]F$'@5L1PD$>U7(X%8#(J7*Q#T,!+%E[5;AM^?2MV.Q1ATJ=-+R M,XX]J7.0T9MO%C'>ME(HU$1B=G)7Y]RXP?2DBTXJ>F*MPVC UFYD.*9;M <@ MUM6BEAS@CT-9MM"4P#6Y:$>4!Y8!_O>M8SD0T6(;<-RG(].]78EQC^516R^E M:$: \-S[CK7,Y#C%7%B7(YJS%'BD2# XY'M5F%.!ZUR3DCNIQ0BPY[4K6^X= M*MQ1XJP(1Z5RNHT=:IIF*]CN[5&;''\-= +?--^S+DYJO:LAT$S)M+;$A!^Z MPQBK<=OMX(YJREOALCUJVT()W =>:B534TA25K%,0?)TI?(]JO+",#BG>54. M9O[-&H9D#MG''04U"CI6 MUY ':JTT(]*WC4['-*BC$E@VYJC-!G/I6Y/!FJ$_AZVM!KR[S'91GOQN/ MI7;+IT%A!Y5O$D:#H%&*Z.YC%M EK"NRWA&U0._O65/%P>N:SIU7-Z['S^,D MYOE6QQVL(S!N37&ZC8%V;Y=P/;%>DW^G,$RRD9Z5S]SIAR>.M=JJ&=&-CRC4 MM#,=P<+A6Y&:S9=(('*\UZAK&C;0N1TK*ETE0R-C(;G_ !K521ZG,VCSU]+" MCH*K2:;VVUZ->:=&\!^4$CIQ6)/8^@YK5:F4Y.YR$FEB.T+E<%VVCZ#D_P Q M6=)IN3PN37<:M8"*18!UA7:W^]U;]3C\*RXK8+*-PJD8N1R-SHCJ"VVLN>T5 M3@BO0)K9@6+?=%P+YC5<=R5*YR\MJ<\56>V/-;\L:\U0E &>*T*N9+6V. MM1FVW'@9)K0E/^<59TKRA.6DZ#H332(_P"%,=1FH)% S@4TK,7*5&7DU#MJRT?M43Q[>E+E0.J-5:>XF.]-;K3SC%-91GI6#1Z--VU&$<4F/<4\@8Z4WCTJ&CI4Q, M>]&/>B@GB@U4FT&/<4*N\XINXT]&QS32NR)-J-R98P!3AQCM48D![4N\5W02 M.!\SW+^H16L+1+;2M-\@+DCHWI58=^,U&K59@48'O74G=['+)NG&US+U*S&W M>@^HK,9V"D=JZV2$.N, CI7/RZ8_FRA>0IKR<7A^27-'J>I@\;&47&H]B?7M M"M-*TK1KF#4X[VXO83+- @YMSGA36**>4VD@TP@ UY4WS.Y[%).,;2=QC4_*-U-"<5IV,JI"$QSZU<()Z, M4IM+0HO;2(N2N?7':F!<5K1J6)S5-H,.V!WK65)15T*-2^C*P4'K4GE@"G^3 MZBMOPQX/O_%-SY=NGEPJ1YD[CY5']3[5FTHJ[-4^;1(Q;:SDNI4BAB:65SA4 M09)KT/PW\')KC9/J\IMDZ^1'@N?J>U=_X9\(Z?X5@"VT>^E=WH/PLUO5H/M-Q"=/M1SON%(8CV7_ !Q766?P\T.RCB\R!KZXSDM/ MR ?9>G\Z^>Q69X>AHY7?D>[A\LQ%9.6QENVVPQ22D]HU+?RK5;_ M +J)[4,DI_;FWZ:'D&WTM9KM M&PP%S'C\]U?8ER)+WP<8K2)A( %)46[\C>/2N:6\T6X25>2L963CU^4FN7NH+BRD*7,,D#C MM(NT_D>:^N=9UO[7KT]TS;CC8,'BLN[@@U$$74*3Q-_#*H8?D:UAG$_MQ1A/ M)8?8F?+".&48ZU%J&DVFJP&*]MHKF,]I%SCZ&OH74O@_XI7K^6:]BACZ%9I1=F>'6P% M>DVG&Z74\)UGX/QN6GTB;8W:WF.5/T;M^-<7O M?(6V28Y!S@]JDU/1;'Q!9_9[Z!94_A/1E^A[5]!0K.'Q;'A5Z"EMHSP&,[A5 M@E &>:=@4)7>FA,DI)U.6W7T MJ;&>U*JBNN%&,F<52NT0FVR*3[,5[59SV%.6(N>M=2PD6<%3,)1=HE3RZ/*J MX;E4J+DQ3KJ,&R6.^C M$:AP0>YJO?7YN!Y<8Q'G)/K2WEOY9&150QFMZW.ERQ.7"JE/]X]R,JQ[*J)NR95D7,]16K?:;+83M#-'L<'H:J-%[ M5R2I-;HZ54N42IQ494FKK1#FH6CYK%Q:-8R3*^P4C19%3&+KQ3UBXJ>7N7S( MI&+&13?*JZT))IT5H7//3VHY+BQ*?PTSR/:MHQ9&*JS6^&) K.5 M*Q4:B;,_R**N^5[45ER&UT?9\%RK$$&M&"7!%<]%<&7&\[CV)ZC\:T(),8YJ M7(XO9'26TH./6M&#!QFN?MI#Q@UL69<@8)R<5G*:6H.%C9@4$BK\4(-8\.I0 MQ,0]P@([&KT6O6B=;B.O+EF>#3:=6/WHQ=2FG;F1KQ6X.*O16XK%C\2Z>/O7 M,?YU;A\5Z8#_ ,?2"L7F>#_Y_1_\"0O:T_YD;EO %=2>@.>*U-0G.ISB9HTC M8*%VQC /OCUKG8O%VD#DWL:^U6D\9:*!_P A"+]?\*AYE@_^?T?_ )#56E_ M,C42U''%3K9#KBLV/QIH??48@?H:L+XWT$+/'&!5-/'/AWC.IQ _1O\ "IT\<^&SP=7@'X-_A4_VEA/^ M?J^]![>E_,C3@LU8=,FIET\EONX%9)\=^&UZ:O"?P;_"G#X@^'A_S&(?R;_" ME_:6$_Y^K[T'MJ7\R-.:Q55ZOO0?'OAHG)U:'\F_PI5\>^&<//#&!_Q-X ?HW^%. M7QWX7[ZQ!^3?X5G_ &EA/^?J^]!]8I_S(I_V6Z]B*ECLV7J":L'QWX6_Z#$' MY-_A2#QUX4SDZQ!QTX;_ I_VGA/^?J^]"]O2_F1;ETN6R$7FKC>-RX/:IH( MN:HGQYX6<8.MPD>AW?X4G_"=^%4Z:U!^3?X5+S'"?\_5]Z%[:D_M(W(8%(Y6 MK\%BK'@5S47Q#\+ @]K2_ MF1TD6G@]JNQ6..U8^B^/_#FLZA#8V6KP3W+N48;? ME;UI$AP>*MPQ8[,@BG*HJ35114V#%2QCF!3N)1LP ^6D ([5, M(CC%(Z<47[EV[$!7DL?3 J,(6.*LLGR@'O32NWFE@Z5 MI2KCI522,DDUO!]SCG'HC.E7;GBL^X0GM6V\.>U5Y;4GM79&9Q2IO='/-;(Z MMN/S#I6=-9E\CFNEFL2><0:@?2\L25Z\ULJRV,^5HXN33BP(QQG-5)-()KN7TW;_#562Q(_AKHA M51'+W.(?2".PK5\-:;Y$\DN/G"X&.M:\MES]TU)I\0A>0$#D5K*K>-D836EB M*2#/454GMMJDCM6O=3>9)NVA/9>E4Y71B<9S2IR:6IYLJ2DS$E@EOF2$ME0< MX]*KWOA]8XBZ,7(Z@BNBM+%BWF 8'K2W<+E2B+GCG%;>U:=D"H-'G>I:=NB' M&.>]9XT*2XMY5$9W)\ZGVZ'^GY5WSZ>KMRN2.Q%)#8>5,K%3@<$>HZ'^==,: MKL-JQYA<>'YU5BT9V YS6='I %RLC+^[B!E?W51G'X\#\:]A;2A"9$(XXP3W M';],5S7B+0H['39Y(5)-RPCQZ 5!Z^IK"FTUYE+*GR XWL<#/UKT8/HS)Q=SF;F=R,$ MG'O6+:L2C%5W&1 MFJL'-<@8'!%56!'%6\YJM)]^BQ5RI(#S51U)%;.GZ:VIW:PKT'S,?:M^328K M=0J1* ..15*#>J,9UHP?*WJ>>OP:C*YS75ZQH>4\R) ".2!W%8"VYVY-2XM% MJ:EJC/=-M0=#6E- 1SCBJK1C/-"3#F2-6P\(+>^%;[6S?0Q&U8)]C9L2RY[J M/0=ZYA@<^E7)'8$% M6*6HTMUX-$2/,<(A8^U:EGH9?+SGCKM!Q6C&@B&R&/;Z #FK5'K+1'G5LUA% M\E%(P*1D&3@GZ"NBTOX>0 MN6>\NY"BDJ1%@'I[_6O,J9E@=C3;->-@/U- M/&G6A!'E@?F*[_Q!X%MK"(&WCFRR[E,K9S^( KAM5M9+$J(UVX!+ ]C7+_;V M"C4]FT_N.F?#N:^S]I*:M_B_X!7;1[>3[I=#['-0RZ!(!F*0-[,,58LI9)5) MD<)@?F:MI<,%^88%>E1S; UGR\UO70\R> S;"KF2YE]YS\MM-;-^]C*@=^HJ MU"XV#Z5LK*CC (-02:9')EHOW;#MV->TN5^]!W1Q?7W?V=>/*_ZZ$=N-R8] M>*PM1NFAN[A4.5)Q5Z^U$:;$8V'[TCCTKGS(9&UK8^DO89L%(%!JQ$$W?./EI-H).WI2Y4"E M=VL1"/I5F%2IH1,U8C3'45M3B3.?*M!V\XXJ)AW[FI\#I6UX1\)3>*M26$92 MU3#32CLOH#ZFMYOE7,S"#!YO%-SYLNZ'3XS^\EQRQ_NK7L]E80:5 M:QVUK&L,*# 11@?7ZU9L[.*UMHQ#!$H547L*ZKP'\/;SQW>RG/V72K9? M,NKM^ BCK@]":\#%XB*CSR=DCZ7"X>7-RQ5V4/!G@?5/'FI/;6"1QPPKYES> M7#;(;=.[.W].I[5Z4+;P;\/EC709&\2ZW"5:2_NXC'#G_8'7Z=SZUSWB+7!# M!-HNA-]GTJ!]J)$3B4C/SLW\3<9KC;C5+6) 4D=E1=Q>5OE^OTKYBO6EB>MH M]CUXVH2O'5]SHO&/Q4\3W.H3I!<(L&\_+;D+DCJO(.:Y+6_BMJ5A D]Q M6/F+R!1^)SBO-?%/Q4@LW>#2V^U39.Z9_N#W _B_#\Z\?\8:V=>;?K#M?S)_ MJY&&UD]MO3'TKSI4J:^%%O$UI;R9]/1_MCV6FSVD.HB'4;8D*6L\J8^V23P? MP%=YIWQ\T_6Y[6]T5(V",#,LI.0,]>V17YV37JO.I>5\(<9*[LCWKLOA9K<> MA^*;.8S,EF9,G9VZ@Y]?I7+/#4YQ?+HSTL+FE2C)*I[T?,_:'PAX@CO_ S# M?+Y2P,@C8<$>O0UY[J6L37MZ[2.S')'-> XR4N61]]0H4:B]O'5/8[2Q^)=] MO GM(9,G^$E2:ZFT\;VA^2ZCDMLXPV-R@_45Y-9W026)F7(![UOW6I*;MCV6/4K>>P\NVF2=6P=Z'./\*Q-8N3:PK*;AXE#8 3DFO)A MJ;6SH]O*\:OS?$U(Y;>UU53([9"21C!)QU(_PK6FUS69XF8494J,IP M9=\7:!I&IP>>=]O?E=PE1 Y]&']:\_FM9]/EV3+C=RK=F'M7HJZ?<:S;K-# MB6-^C*^15-_#\]W!);26[2*G=?YBOIL)C70?*]8GY_6IN>KW.)5DGC:.1%DC M8$,K#((/7->5^// +:.7U#3E+6).9(AR8<^GM7KVJZ%>:(5DFA=;:5B$E8<$ MCL?>H$*RH590RL,$$=17V6&KI6G!W1X=>@IIQEN?.:N"*E3)[5U/C[P4?#UW M]KM$/]G3-P/^>;>GT]#7*QG'-?24E[2/,CY:N_8RY9$H3-*(^:F>*TITW:[1YV)JRE).$K6W'1023/M12Q]J22)XF*NI! M'8UM^&-0CT^Y=YHPP/K3-99;^_+QIA6/&*[(4E'5'ESQ5:=1JWN]S)@A,A!" MDU<2W9.JXK6M; QJ %_&M.WT_?\ >7-=&D497NS$MK(R=15TV :'85X'2M2+ M2W678.U7_P"S&V9XSW%19LGZW3HZ')MIJ-\I'XUER::TM[#[1!9><<>?<-M1>.YHMRZL'CX5=.IYBVG/G)/%7-(003E7 MZ., ^]==?^'UM+J:!MLIBH'YU=XVNC6G-SZE.YTL20O M(1]WI65;V'VS 7Y3[=JZ42RP0"&6/?QU'6LZ-WLI7,YG;YE^ZOJ:Q)(C&WS<-UQW%>Q>%==T"/PSJ-OKEI]IU5@?L$V/EMCZL. MXSC'7!YKS*[TMR[G:=Q^;).YVQQ4FM58Y&W9XI!C*GMVKJ]+UK*!93@^IKN.N[&XTJ[>WN%*,O3W]ZZ':2U,HUHSE9;ECQ=;K=6L=P " MZ':6'<&N2,>WK72#:HQ[FMS3_@M(=K:CJ 0]XX$R M?S/^%>77=)=3VZ$:TM%$\E>$9S43Q9QP:]]MOA-H-LN9(9K@^LDI'Z#%3#X= M^'5!']F1''J6/]:\>I6AT1Z].A4ZM'SLT>#R*F@M@U>_O\.?#CY_XE<0_P!U MF'\C21_![0]0!$*7%LW7]W*2!^!S2I5*;E[XZU*I&#<7J>%"T0BI%MU5<5[' MJ/P!N(5W".'G\#/FZ ME3%4_CC]QS[0[:;LJU*AC^]3=HHEAK.Z+ABTU:6C*^RC94^S/2C8163H-'2L M1'H0!,D#!)/0"FSV[;6QL[_7Z5<,.IQ=S&IB MW2:MJSWOEIZO\S\_JO\ >2]0HI,UK>%_"NJ^,]4&GZ/: M->W?EM+L4@84=22>G8?C6$8N348J[9,(3J-1@KLRJ*[G5_@AXUT/3;F_O-%> M*TMT,DD@E1MJCJ< \UP@-74HU*3M.+1=2C5HM*I%KU'449IN3G%9&(ZC%=KH M/P8\9>)-*M]1T_1I+BSN%W12>8B[AG&<%L]JPO%G@[6? ^H1V6M6365Q)&)4 M5F!!7.,Y!/<']*Z)8>M"//*+2[G3+#UH0524'R][&/1C-&:0FN.=1@662TMK+=T2XG&X?7&:Z:6&K M5OX<&SKHX3$8C6E!L\HHKT;Q%^S]XW\.0-/+I7VR!!EGLG$I _W>#^0KSIT> M)V212CJ<%6&"#Z8J:M"K0=JD6B*N'K4':K%KU$HJ:QLYM3OH+.V3S+B=UCC3 M.,L3@#->@#]GGX@$<: Y_P"VT?\ \513H5:J;IQ;MV04L/6K:THM^B/.:*]$ M;]GOQ^H).@2<<\31_P#Q5QRW>F:AK=S<07,.<.C1NY5LJ3U!P M<'J*[3_@I?\ '/\ X7'^TGJ&FV$XN-"\+*='M5C.4:96)G<8ZDOE<^B+7)?M M+?LDZO\ L]_#CX5^)KU)3_PE&F--?*X_X]KL-O$1]/W4D?U*OZ5R2DV[GI4X MJ,;,_?#PWK5EXIT+3=8TV=;G3]0MH[NWE0Y#QNH92/J"*UTC(7IFOAC_ ()+ M?'7_ (6/\"[CP5J-P'UGPC-Y,2LV6>R?F(_\!;>OT"U]U@;1BA:D,OC G0?W'P3['(["OP-U"![OQ%=0QJ7DDNG15'X:UU#3+I2@F3.V2"13Z]O0@$5GU?O'\"/C;X=_:"^&^D>,O#5RL]C>1@21;LR6TP'SPN.S*?TP>A%?SD?$[C MXF>+?^PO=_\ HYZ;8)6/W$_X*2^-/$7@#]CW5M<\-Z]J?A_6$NK!$U#2[R2W MN%#2J& D0AN1P>>>]?EG^SY_P4 ^+'PF^*.E:[X@\;>)O&N@*WE:AHVLZM/= MQS0MPQ02NP60=588Y !X)%?IK_P58X_8>UD?]/VF_P#HY:_$#0?#6J>(UU)M M,L9KX:=:-?70@0L8H%95:0@=@77)[ YZ"I&C^F;X?>/="^)O@O2?%'AV_34= M&U.%9[>XC[@]B.Q!R".Q!KPO_@HYXLUOP-^QWXZUOPYK%]H&L6KZ?Y.H:9A-?FS_P $V_VUF_9^\9IX*\57A'P_UR< 22-\NFW+ M$ 39[(>C_@W8U^AO_!3ZZCN_V%?B#-"ZRPR'3'21#E64ZC;$$'N".]5DR:;>R/8ZMK-S68)&X4$_2N"_X)+< M_ME:)_V"K_\ ]%4O_!6KY?VR=9'_ %";#_T51N^._V/O ^N M>(]8O]?U>Y>_$VH:G=//^6FI?\ IPN:^IY(@*T4M+&$HWN?B;_P41^/GQ-\#?M>^.=$\/?$7Q7H M.D6PL##I^F:U?%?Q1KF@^/_%/A[0KF^D^P:;INLW%M##;AL1@(CA02 MH!..I)K]*_\ @J9\=!\*_P!GV3PU8W AUOQ>[6"*K#>MJH#3M[ @JG_ Z_-/ M]F?]D_5?VA/ WQ.\06BR@>&M*,MBJ# N+S(<1>_[I)./5EJIR[NKV9I9[B%RSQ2.S("-(U#><*N\_NG/\ NOMY[ FO MW,V\9!SGG-=%&;:2.+$TU&=[:'YA?\%4_BUXX^&WQ5\'67A;QEK_ (:M;C16 MEF@TC4YK5)'\]QN98V )P,9KVS_@EWXW\1?$;]GW7-2\4:]J?B74(O$UQ;I= MZO>274JQ"UM6"!G).T%F.,XRQKYH_P""QP(^,?@7/7^P6_\ 2B2OH+_@C]'O M_9G\1=_^*LN?_2.SI1D_;,NI!?54DC[6^S(N25"^]95[!\Y(& >16]-'U%4I MX P/7Z5ZD)'DRA8P9 JQD$'_ !K+;$4WRG*_2MVYMF&>*RYK7)Z5UP:N<4X) M%24;B34)%69H#"H.<@U J[N]=BDF&_\ KU(+0LH((>,]&4?S]*9;+%(VTH2>V#FM2RM' M6<-AHCTRV!0YN"NF/)Q]F93G\N:XG5;)[:I?',VRT0_\ /0Y;\A6G;_#'38"#-BMD=D'MIUM(NP_N?63&<5@.NYB =P!ZC^=?2KS1[-HA3 M/KMXK/ETFPN4Q)9P.?\ :C4_TH6.3Z#_ +,>ZD?.Q0'.#FH'3)-?0-]\.M)N MH]\FFHHQ]Z/*']*Y;4OA)8S9-I=36S?W9/G%:PQM.6^AE/+JK^%IG!>"\)JY MC;@2ILS78:CH;0_O#R.N166G@35]!NC*(EO(Q_';G)'OCK4>J>*);:W>'2%Y&+FJ MQ4BG)\ST.NG35.%KW9!< >60*@-F&0'!Y[CM5IT)ZCK3"C $ G!I)%J5D9+P MY-5Y(<=JU'AYJ!X"Y 498G&*KE'SV5V9L=H\\BI&,L:V[334LUR,/+W8_P!* MN6M@MC"1QYAY8UZ!\/\ X:'Q"CZA?JPM$&Y(@"2X_O-_L_SKCQ>(HX"DZM7^ MF88>GB,WKK#89:?A;NSE_#_@Z]UY?.4&"TS@RO\ Q?[H[UZ/HOA/1]&F@"1K M+(T0Q(XSDE1G+=L'I7=:?I<.G:GLNK!FMEC9 JI\I&W(8?A7+:QN51;HRV<$ M0.UR=V0PW#\NGX5^0YMQ#4K-\\K1Z)?J?O\ PWP73C94HQZ@X[>M? M$2S*O)]9U^3PSJ)L/$&F2O(% 0JP:.5/X9%/=3CK6E+'5ZTE[65_,UQ. M3X2,.2G31Y0OQ%,$O^DV3 >L;=/P-=-IOC72]758X;D)(PY24;6^GO7-^.[F M'6;Y9[6U%M PP(>Z_4UR#Z3YRF2$J5&,KW'X5[5/&2ZZGP&+R6G&=J6ESVR. M3 8+A@1CUJK=7_D2"/>1N[5YC:^-KGPM;%Y7-Q:1]87Y;\#VKHM#\1VOBF,W M=M("?XHV/S(??9-3BN2I&\NZZ'2S0QW\920!JP+ MJT?3WVMRA^ZWK_\ 7K2@D:%B'<;>U7)42]A,;@,IK[RC6AC('8/#.D16D7+ ;I9.[L>I-<;\(_#0VRZS,F&R8X,_\ CS?T MKTP1-,Z1QJ7=V"JH'4UP8IW?*MD>I@:;2YWNR?1-$FUR_2W3*(.7DQ]U?\]* M][U/4=-\+_":VTRRS;"\D,,YC/S; "3SZD]ZY31?#G_"+Z>D,J8N9%#RGU;' M2LCXC7\5OX<$4HLW8X?QCXC MM]+B=I]1M[*UBRV0V!M'0>^.E?.GC+Q]=^)+AX+.]2'3@>(F09?W8YKU'QU^ MS[\1/'$L316J5CQ2\U%K*-C'OAKX;CT[1 M;:.%%/+#DGWKGJ8I6O$VIX"5_?/S_P# ?[%FJWWS>(Y9+*4]%CZ?C6WX\_90 MC\'>'7U?1Q-+):)YDFR3E@._L17VCKBHLS@_PYP0.<"N6U.2'^R+U)6(BFB9 M"K#L1Z5P4L1.4[MGIU,'2A"R1\M_"#XBRZSJ%CH.JXFGMXVECGVX;R\J"AQQ MU.?KGUKN_$Z6O]M.MCCR^G'K7BOA6^@\,>,[E"$9'D>W+DX8 M@?TKUB YF$ M@.\J>3Z\UKBJ?OJ:ZGKY'6;P\J+^RSH+338WTV1W&)4X K,NG:.4J#P*T//: M:UPIQ([?*,]:U+'X>:GJMN)SY=NF?O3MM!KC7N[GT4JD8*[9RZ'+AOSR*KW4 M1EEW[%3=@QPIG!'7GN/>ENK3P]!*D>9ED(P@W MX!!'7I2E)''+&4NNIA:-K-QX;>.6(+*C8$D)Z-7J.AW]GK=HMW;*,'AAC!4^ MAKSTQ>'Y;IP+V4NPRJ'LI..^*MZ''?Z+?&YLHY9X,X<;00Z_@:(5;=3EJ_5J M_P "LST2_P!&L]9TR:QN80\,G4'@J?[P]#7@_B3P[<^$M9DLKD[D^]%+V=.Q M_P 1ZU]%>'9+>^ECD=\Q,"<^A]#[T_XG?#2+Q#\/S=@@:@DADMF[_P"[]#C\ MZ^CRS'2PM11GK%GS68X&->DW!6DCYIGL+;6K&:TN5WQ2H5(]/0UX3X@\/3>' M]8GLIOF"'*/V9>Q%>[6*NDI1@5=205/4'O65\2/"0UK1/ML:;KNS&[@%0BE@1]X5T&F:)(Q)*;C_='6OJ(R2LC\^JNYK'. ME,D>2#DD\>U>HV_A^:]M@R1X*_)@]>>G]:L6^B6\.J"W$8,:J(]Q' /1OISH<%&![Y%+'8G/0YKVCQMX7AM=(\]PBR*<+M_B%<1IF MDK=,^_HH[=ZKF15.I"M#VBV.=@L"SXV].3BKBVNY@ .16\]BML[)CGKGVIJ: M<3\RQ0JREH<)+HN0 %Z> MM+:^$Q>2E2,.1\I%=?+IV 6 Z5-#IG^AF8Y4AMJ>YQG^58\S9W*IRQT9YIJ' MAR73)FB=L*XL A(QDUHF[:FD<2INQ MR:6(29,@8S72Z5I?S* NXM@!0*A:PR0?*"/0?U->MQ+%8H!'@ ! MB,<]=;1/SJ)SUEU[?(Y5P$4 851T & *FTO0M1\03^1IMC<7TO]V",N M1]<=*KV[ZC')O$^I1O'>>, M[PE^#B]DS^'S5Y,\UQ*VDNEEN!'$N<11Q_)'& @^,+[098(!H\IFC\H&0;NK#WKSV61+C>C(I4\%<9%<>TS:;"<$W%W*'B?X46&LK) M-8XL+DC.Q1^[8_3M]17E&K>%KW0KHV][;M')V;J&'J#WKZ&T[5;?4(0T,BN# MZ'I4^H:+::]9FUO(5EC;IZJ?4>]?;8;,'%+6\3YO&9?"J[Q5I'S)!IZFXB$F M5C9@&/MWJ_XFL;&UEB6P?<"I+@= >U=;XN\$77A>ZR09K.0XCFP>/9O0UR=U M:LP(VU]%"I&JKH^/JTYT)V>C,(?*0?2M$7XFA1'P"@(& ,\U1FA>)SN4@4S' MI4M.#T1V0G&K#WWJ2RRA&Z]>:*K[<]2#17.W.^D3LC3I66I]66=MTXK:L[;D MTGBI_#!&W8:SI?BZ#5+6!UN8X)GLKA2,C< -P]Q@U\)?$?PC) MX&\::GI$@.R&4M"2/O1'E#^7\J]._9>\>R:?XZN],OIBT>M9<%S_ ,MUR<_4 M@L/?BNO_ &MO _VG3K'Q1;QDR6Y%M>/*0 VEN6'&\X+D?0$#_ ($:^8_M2^"1X@\%QZU;QY MN]*?>Y[F$_>_([3^=<+^UGXV-UKFF>'K:3:MB/M,^T_\M&QL'M@ G_@5>V_# M'Q+#\3?AE:S72K*T\#6=VIYRX7:V?KU_&ON)5J6-E5P'9?EO]Q]_*O2QTZN7 MOHM/U^X^#\UJ^%?#-YXQ\166D6";KFY<*#V4=V/L *L>.O"TW@OQ;J>CS@[K M:8JC'^)#RI_$$5[;^R!X?BN-4UW6'4&2"-+:-C_#N.YOSVK7Q.$PCK8I8>?= MW^1\'A,(ZV+6'GWU^1[1X*\!Z!\(O#3%#%%Y:;[K4)@ SGN2?3T%>>^(OVN= M!L+MX-*TRYU.-3C[0S")6^@.3^@K"_:Z\7W$,VE^&H'*6\L9NK@+T?YL(I]N M"?R]*^=M)TR?6M4M-/M@K75W,D$88X!=V"C)[QV%RLND7TIPB7."CGT##O['%>3?M07O@ M^YUB%=)1&U]#_I4MJ (\>C^K?TZUC+^RWX[X(MK/U!^U"E;]EKQZ[EC;V;,> M23= D^YK&O6S#$T/8U:+;[V_X)E7KYCBQY_X#/_ !6V@=_].@Z_ M[XK[K\?^*SX&\(:AKGV?[4+1%8PAMN[+!>N/>OF?PM^S3XVTCQ+I5]:MH^G*C7MU&JQAVV@D.IY/T!KMRBA7 MPN'JJ<6F]M#OR:AB,-AJJE%J72Z\CQN+]L:)Y!YWAN3R^^RY!;\,@5[%HNL> M'_C)X+6X2V%YIUSNCDAN$&48=01V(SU%?,5O^RQXXF D^%?@I=-ENA.XD>XGGQM7<<= >@ 'X9K?+ZF.JS<<7'W+=3;+*F859. M.-C[ENI\5_$#PP?!GC/5]&R6CM9RL;-U*'E2??!%8%=A\8/$=OXJ^)&N:A:, M'M7GV1..C*H"Y'L<9KCZ^&Q"BJTU#:[L? XE05>:I[7=CN?@C_R5#0AW\UO_ M $!J^SXXS7Q?\$CM^*&A'TE;_P! :OLU)2,5^A<-+_9)^I]9DEO8OU)U4KFO M'_VN/C3%\ O@!XJ\6^:$U&.V-KIT9/+74GR1_D3N^@->M^:C^VZ@L9!#74JC8#[I'CC_IH:^IG[JN?54ES,^._@5>^ M$;GXV^'-1^)&JM9>&(]0%[J=RT$EPTH5O,*E45F;>P"G@_>-?HU^VO\ MB_L MY?M%?L]:]X4TWQE(^OP!+S1PVC7D:BYC/";C#A0ZEE)SCFOE7]G_ /X)G?$; M]H3X:6'C;2];T'1--OI)%MX-5>=99$4[?, 2-AM)!QSVKTE?^"+WQ5)_Y'3P M=_W\N_\ XQ7/J=CY;[GAG_!/WX\GX!_M+>'=2N9S%H>KL-'U,%L((IG4*Y'3 MY7"-GL :_H'BPR \'/.17\X/[27[-WBC]ECXC+X4\3SVMS=/;1WEO>Z>7,$\ M;$C*%E4Y#*001U%?M;_P3^^._P#POK]FGPWJ5U<";7M)7^R=4RV6\V(85S_O MQ[&^I-$6-K5,_!6T_P"1\A_["0_]&U^L?_!4;]B#_A/-'N?B[X)T[=XCL(\Z MW90*,WL"X F4 4>J\_DY:?\ (^0_]A)?_1M?T_M$LR%6 92,%2,@ MCTJ;%L_ O]@G]L6__96^)D<&I333^ ]9E2'5K($L("2 +I%_OH.N/O+D=ACY MW^(-_;ZIX\\1WEK();:XU*YFBD7HZM*Q!_$$5]J_\%-?V(?^%)^*)?B+X-L< M>!M8N,75K AVZ;=-DD>T;XR.P.1Z5\%D8-(9^Z?_ 5:_P"3']9_Z_M-_P#1 MRU\"?\$B-.MM8_:HU"QO;:*]L[GPO?136\R!TD0R0 JP/!!'&/>OOO\ X*M? M\F/ZS_U_:;_Z.6O@_P#X(Y?\G=7'_8MWO_HR"@#E/^"@W[&-U^R_\1#JFB6\ MLOP\UN4OIT[?,;64@LULY[8P2N>JCU!J[IO[: MWA^]D)9IH([ZW=[=SZHBDJ?[H(["OVG^,GPA\/?'+X>:SX.\3VBW>EZE"8R2 M/G@?'R2H>SJ<$'V]*_GJ_:8_9Z\0_LS?%/4_!^NQF2.-C+87ZIB.\MB3LD7\ ML$=B"* /<_\ @DM_R>7HG_8*O_\ T33_ /@K?&R_MDZLQ4A6TBP*DCK^[Q4? M_!)3_D\O1?\ L%7_ /Z*KV?_ (+._!^^M?&GA/XE6L#R:7=6?]D7D@!(BF1V M>,GT#*Q _P!SWH)ZGUU_P2TFC?\ 8@\ JK@LDVI*P!Z'^T+@X/X$?G7U:ZYY MSQ7XO?\ !.S_ (*"Z1^SAHEWX#\=P73^%;BZ-W9ZA9IYC64CX$@=.I0X4Y'( M.>#FOM?Q[_P5>^!/ACPY<7>B:M?>*]3"'R=.L[*2$NV. 7D554>IY^E6B'$_ M-C_@I^ZR?MO_ !%*,'4#3AE3GD:=; C\Z_5W_@GS"T?[&?PO#J5;^SI&PPQP M;B4@_E7X?^-/%'B3]I+XV7^L26QN_$GBK4QY=K "?GD8*D:^P&U1["OV=^-W MCB/]BK]AFSLK>X5=;TS1+;0=/;=R]ZT80NN?[IWR=/X::WN*>J2/S#_X*,?' M8?&O]I;7%LKCSO#WAW&DZ> WRDI_KG'^])NY] M?6G[%7[7O[.O[.WP!T;PS MJ/C!X=?N]U]JZKHUX^+B0#*%EB(;8JJF02.#@XK\_/V=?V>/$W[3_P 1AX3\ M.3VMK=_9Y+NXOM09Q#"B]W*JQY) '!Y-?4Q_X(U_%+_H<_!__?RZ_P#C%"YK MW2%/DMRR9\G?M W/@]OC5XGOOAUJAU'PG<7IO-.N!!);M&K@.4V.JLI1BP'' M0 BOVW_8L^,Z_'S]GCPSXBEE$FK6T?\ 9NIC//VF( ,Q_P!X%7_X%7Y;_'?_ M ()I?$;X!?#;4?&VI:UH.MZ9I[)]IATMYVEC1F"[\/&HV@D9.>]=Y_P26^.9 M\$?%W4_A]J%SY>E>)XC+:AFP%O8AD >[H&'U5:N+<):D58J=.ZZ&E_P6639\ M9? @_P"H W_I1)7T'_P1X3=^S%XC/_4W77_I'95\]_\ !94[OC-X#Q_T &' M_P"GB2E_X)^?MR_#G]F;X+ZQX6\7C53J=WK\VI1FQM!*GE/;V\8R=PYS$WZ4 MUI4U)<>:BDC]9I(O;FJ[P9KXW?\ X*T?! ]!XA_\%P_^+KU#]G[]M'X?_M+> M(-3TCPB-3^UZ=:B[F^W6PB786"C!W')R17;&HKV3/,G2E:[1[AY4:2JSQB4# M^$GK6/<6&YF.,9["M.XNEY((P:S9K@N3M-=D$SSJB,Z:P9O<>]0'3 !RX7]: MLREB?6J4\C+Z_G7="YYTFD20VL22?-N;\A4DX11\L<>[U(W?H:R);IEZ\?C5 M=[_'5C6Z@Y$<[2-9C.V LAC'HGRC]*FM$E5QR&]CV]S6"NHDN%5B2> !6FNH M*+<(KAF/WB.^.U:2@S+VMMV=#;:\T$BHI^4 A:YGQ#K']LP>4C[)F!\ MM@>I_NG^E1SS8>,E@#DX'U&*\[GU8(N&;(;I@]Z*.&BIZ2C#U/^ MU_.K5K;V^CMOC4R38P9&Z_3VKT_:^S]3*&'E5?DXN9DMXE'+N< ?B:\@\4_&Z M)6>'28_.(X^T2<+]0/\ &O+Q6/C3UJRMY'N87 2E[M*-_,]-O52./=NVCU)Q M7-WNM65N2)+A,^@.:\1U/QKJFK,6N;R64GL#A1] *SA=SRY/S,3ZU\M6SNHK MJC&WFSZ6AE$?^7DK^A[)=^+]-B)_?Y'H!61=>.[ $E%=_KQ7EDVH06_-Q=11 M8[,XS^51KKFFL>+DN/58V(_E7CU,WQ;_ .7AZT,T^H4);P.MMOBU#+$8[FQDC!&/W;!@/P.*+;Q/I]^X\N8*3T5QMJ'3O"EE> M+^YFAF'^RP)K9A\#PIC<@';D5UT,^Q-)^][R.6>48=_![HBR@D;<'Z50UGPU MIVO0D7EJKMCB4##C\:Z*W\/BT7"2;1TQ4%]I-Q!&QB/G=RO6XY*'_ %BC^OX5Q13#$'Y2#@@] M17T&+EE8J<@BN<\4>"K3Q&C31XMK['$JCAO]X=_KUK[:AC=N?[SX[%Y6FG*C MN>/F$GI36M7(SMR/45:U'3KO1KU[6\B,XJ,ON7K7N0:DKH^9G%P? M+)%&:+ /'-26%GM/GNOS'[HHV&>=5[$\UK6]I)=RP6MNIDGE81HH[DG %;*T M4YRV1Y6,J2DXT:>\C<\">$!XBU'[1:W4(/Z^U>YZ<[+;L("(( M0ZP%U4*A7.-Q].OX5A:1X'U71FTVUL)(I-(,82=N$DAF+L MW^@D>F76LZC>:QN T]O&N2(1(1*J;VSU/3'Z$<5#<^)8F ML_[/GW2V\>2'>',L?]T;O3IG_P"O7Y?7DJTKJ5V?T=0P<**C&@_<6UC!\0^! M]6L-'CU&.21-/N2#F)PR.P_A8+R&_ UYW>ZS);6[1SR?9D)+(GE 1[@?O#/' M3CCK7ID/C:]TG4I#I36XMY) !YT65# #D YP*H^/-2\,ZJ9=1TQHM)UO]V)8 M+I=^GWDK\<;K>Z. \*^-3IDS6TC+-ITL?DW MMI)DPLAXR0>^/Y_2H/B!\/M$UGPX7TGQ#:O#!"7@TV_NP9[9,GB"3C='D#Y& MSCU!IOCCP>^D^+-3TZ2/^SG8QO$Z(SVS%XU8[6] Q90?85G>$-/T;PQKD&HO M!!=*^ZWG:]W%(B<$JH_O@]/ZUM3O!GDUYQ:]I \1T_1_/OVMY;B)HW!1OM.0 M 0,@$]1W'MQ5)/"VI0W+W-G##+ TFW?'*#R.H.>WIQS7TWXP^"VA^.H3=^%K M$VNJR8E7[,=COGH6C9N3[KS7"P?![Q;:6\DEYH]S"L(+2W"6\C187^(D X^E M=\:RBK'AU\-SZR/GOQ'HW]HEK62,VSALNKC:4/;CN*YBVLKWP[.UQ8W)2>/D M(JG$@]#[5])7_A'Q1XD7,^G+J,-LH(N+-5PRGD#*@ECCMR:IVJ6=L[VDVAPP MB/&^%=)O)(X;&,1^9" MH5R>GJ?K7U67YLZ5K%B&W@]: M[?6-$?0M2EM24]ZY75K;[/=AU'RR^G][O7ZQ!1KTXU8;,_*\'5G MA*T\)6TL)$N14H3UJ>PL3,!O/X5U&GZ2CE4$8*GN171"BK:G36QJINR.45.! M@#\JM66F2ZE>6UM$,R3R!%'IDXKJ=:\-VUA#]H21?, YA&:WOA-H,FK:[-=N MF([./S%XZL>/_0=QKHGR4J;9ST)SQ%:*3/0]*TJ/2M.M[2$8CA0(..OJ?QZU MZ#\-_"-QJNI#4$MS+%:D%?\ ?X(_2N:BL2Y"'C/4C]:]I\$_#7Q2D,$$.JI9 M6S_O3#&5WACSC'X_I7YQG>+6&P_*OBEI\C]0RNBZE=2TM'N[#-?>:XOE>XMV MAP,8*\5XG\=M5?9IVFV[=95DF<&-?M]0ODO+R?4$BC9HHY M 6(["O$O$_@S7 GVS5M.G@@\W=)*R\?-P.>U?G45IS13/T"K?^%=*N !O>!&9LM8OPZL)M-\$:7#<,KJN/KDUX\E.4FTCKISC&*YB[LFG 4K@?3-.E MTLRQA78''.:Q[7QSI-[+LMM5M;CDX$G0@" M35=6N?+3>>RH 7;CT%>41^-=9UR\FN+'QGINM6;,&>U$+("OHN[#5,::3YMC M.3?&'PI+X6U.35(\M;W,_FJ0>%8<[3^617JVAW<=UI4-S%+'*TT22/&A MRT9=0P##L2#GZ5E_&6$>(/!0MT4[TN8B\(Y.-P# D#/>NV^"'PY@UN2_>.<0 MV+/&SO,I!)Q@8S_G KMLQQ?9\00 GH?7O[=ORKAFFGJ:5ZOMIWOH>DZMJ-K% MJLI:3S'P$+%OXCT[XX':HKWQ0PN(D6*-T!.YB, #&,#\>?QKD[?1-0L;*>1" MEW/G>&D3)!('(/I7(WMIK&C:B\TS2319#N&R5+=>.,#KV%9JI)Z"Y5:[.^F% MMJ=W]I$GV9E)0Y/!P,_7DUL^"M3U'2]4C-W>+;Z0Y(1"F\D=?F]^HP/2O)XK M\WFH".XBN+:W/'FJX#$9YP,<_GFNAO\ Q5%::4UDLKR*QY8J00!P,?0?SJ*D MG+3J8J-W<^I_#&I:=+J4(@O$>VO&QN'0.?7TKO?$ETPT46P?VZ7T:%#!)( OX5TX:4I-0EN%2:HKFOH>5^.-'%AK?VV*/;%<\L .C_ /UZ3P_I9UF1HV*K M"!ER>X/:O9/$OPKU!_#6KI+'%>3[?-A:-P/+* GCUSR/QKRCPN2D;JN V02* M_4=ZWX&A\/ZM0/Z4W2]+ MLXG'FW2-QC" M_*NT^)GA:6_M;+453)5C"W. ,%,'&6/I MZ5]W0J\\$[GY)7IRI5I1M4=$OI[FY"GH0R =E&#TJT]NV MI0%9"7=/N'N1_=/MWITJ*A5E4;>IT2Q%X1@M+?B<)>P7%UM$T[S*.FYB<5%: M6+6H+J?K762Z2VX@H%.<8S4[^"[QH!*^V.)N@)Y/X5W\QG[6%M=CAQ;O #CO5I-)>(C(^7L:]V\;^"]'\/Q:>NGWL%Y& M\.YRHXWG!R2/RQ[5P-[IPF; "MZ;>E1AZ\:\>:)\]F,ZF&J^SFCF\G6( M X)Y/MW_ *UUWA;P[;7=S*SKMD'"J!UIVF6$NG6<\\B;&;]VA[8ZL?UQ^-2: M?KM>BZKXFM_%4TLDDL5E)(*5X/0K$X?$81\E:-FSS"ZST S6)=6VYV.WOZ5W&H6*A"4 MA$8/0 DG\ZI:9X6N=7OH[:%?GD;&3V'/< MGZFN(\<>(AHT7V>%@;N4' Z[!_>^M?*8S&QLYR>B/TO+<,XI0CN]Q^M^*GB) M@27,OH.@^M8L-WOY)Y-5O MNQ>WN:_/\3BYXF3OMT/O*%"&'C[JUZL]&U;Q5I^@Q@W4X5R.(U&YS^':N'U; MXI7UT2MBBVD?9CR_^%>9)/>7LS2SOOE')H&U:W:<[E60,8V.-X'.,^N169;Z!/<=/,DQ_'&!SL"-G\F-> -XU MUJ)(!;7ES;B!B=JR'!!.2,=.23^5?3-]\.;C4X4CO-/5QGY3-(JD?CFO=_A9 M^R9X5U#X5VE[J&D0G4[NYEFW_>(C#;0-WH=I/XFO/JIX>/,SOIJ.)DHJ5CX; M\,_%G7+HA-0L#J,.Y]"/RKTC0M5T[Q%$9K2XW '#1]&4^X_K7O'Q M ^%WAGPGH^JC3K.*%;:%WDG S@ =*^']7UX:/J,'Q/!%;7;"'4=H( X60=\>_M776VHM#>1RHQ5T)(<5[V$ MQL\)--?#V/#KX>&(5NI[KJT5OX@A>*Z@1XG7:R^OO]?>O$/%W@]_#E^T1S); MR9,,I')'H?<5Z9X9\0C5+8YXF0X=<_K6KKVB1>(M)>UF4!V&Z-^Z-V-?HV!Q MBTE%Z,^&QV#92RQMCZ45MS(X_>6EST M^UNN.!^=:]G=L".!7.V18\5LVQ( K\WYF?LW)8Z6ROSTX_&M:#4FC(X'/%(FEW?YGY?63]K)+N_S/>OV3O!8U/Q'>>(;B/=!8)Y4!/>5@7 ![L]_U/L<7; M+LLC07Q3W]'N>M>'?V7/$UC,+2WCACAT_9&H1=T+$X P.=U>N_ /XUWO MQ'O-1TW5U@6_A431>0"H9.C<$GD''YBNK 8C )^PI7][1HZ\NQ&7)O#4+^]O M<^3]4T&\TKQ!<:/-$QOH9S;F,=6?../KV^M?=/@?0+7X8_#:TMIV6-;*U,US M)_MX+.?SS^5,AH'@ M,:3"Y6[U63RR >1$.7/X\#\:G"X3^S8UL14\[>A.$PG]EJOB:G2]O0\'\.^# M]4^/WC?7[V"\AM9F8W3&XR1L+8"C'H,#\*^B?@=\+-=^%ZZA:WVH6UYI]T5D M1( V5D'!//J/Y"OECX=?$O5OAG?75WI*6[RW,8C?[0A8 YX ([UWT?[67C M2HTEOI[1@C_P"1ZY^U[X:N5U;1]>5& M:T>$VDC#HC EAGZ@G_OFO"/#>K?V!XBTO5/+\W[#=Q7/EYQNV,&Q^.*^[;*_ M\._&/P@57R]0TJ[7;)$3\R'T..58&O$/$/['ETUV[Z)KD MV.5BOD;<@S_>7 M.?RK/,,NK5:WUO"ZIZF68Y96JU_KF#]Y/7YHL#]L=,+9DB./O+WV_6G5J9K0H^VG)+RZE5JF;X>A[>I)+RZGH MFA?M:_VWK=AI_P#PCWE?:ITAW_:<[=S 9QCWKV+X@>+1X)\'ZCK@MS=?9$#> M27V[LL!U_P"!5\*> ^/&V@?]?\'_ *&*^R_V@?\ DC_B+WA3/_?Q*[,MQM?$ M8:K4J2NUMIY';EF/Q&(PU6I4E=QVT\C@O"G[65EK>O65A>Z1_9UO<2",W7G[ M@A/0G@<9XKNOCQHFK^(/AQ?)H=W-!<1#S9(83@W$0!W)^(_/&*^&02.>G/6O MLG]G'XFCQMX772;UPVJZ8@1BQR98NBM[X^Z?I[USY=F,LN:6O7?VC?A0![D MU\:_!3GXGZ%V_>M_Z U?8Z*>A.?K7Z'PQ_NDO\1]3DO\!^I/M(!VNN_'RYY& M>W2OS(\=_P#!)7QY\2OB!K/BO6OB?I$UYJUZ]Y<$6,Q8;FSM!+=AP/H*_34' M %?"_B/_ (*]?#3PKXDU71;CP=XKEN-.NY;.22)+;8S1N4)&9@<9'>OJ:BBO MB/JZ3E]E'VW\/_"&F_#OP7H?AG28!!IND645E F/X44*"?4GJ3W)-=(C$] / MRKS[X)?&+P]\>?AQI/C/PS,\FF7Z9\N7 E@D'#Q2 $@,IX(!/;L:] C/.:RT MZ%ZWU/EK]NG]B1?VO-'\-OIFL6OA[Q#H\[A;ZZ@,BR6SCYHR%P<[@K#\?6L/ M]A/]B;QG^R!KWB4W_C33?$.@:Y#$)+*VM98VCGC)V2 LQ'W7<'C)^7TIWQ[_ M ."H7PR^ ?Q+U'P7>:/KGB+4-."BZN-(6 PQ2D9,1+R*=R\9XP,X[&O9/V6? MVH_#_P"U=X%O_%'AW2M3TFSL[UK%X=4$8D9PBMD;&88PP[UGIT.E-I:H^!8? M^"+_ (M@\0)J1^).BLBW0N/+&GS9QOW8^]7ZQQ$X.>*^#O'?_!7WX9^ /''B M'PQ>>#O%=Q=Z+J-QILTT"6WEN\,K1LRYF!P2I(R <5A_\/K/A5_T(_C'_OBT M_P#CU25JS[U\:^#-&^('A+5O#NO6$6I:1J=N]O=6TR[E=&&#^(Z@]00,5^6_ MB'_@B;KDVMW\FB?$C38-(,SFTBOK&1ITBS\JNRD L!P2!SBO55_X+6_"I?\ MF1_&/_?%I_\ 'J^FO@3^U[X:^/OP6U_XE:-HVK:?I.CFZ$UI?+$)W\B+S&V[ M7*\@X&2.:-"M4._:\_9ZU#]I;X!7OP^L-7M]%N[FXM91>W<32(OE.&(VJ0>< M5\]_L3_\$V_$7[*'QFD\;:CXSTS7[9]+GT_[):6DD3@R-&P;+$C V=/>LG_A M]?\ "K_H1_&/_?%I_P#'J3_A]A\*O^A(\8_]\6G_ ,>I:!=GZ(*3L.>OO7SW M^V/^R1H/[67PY&C7DD>E>(K!_.TK6/*W-;L<;D;N8V Y (Z ]17SG_P^P^%7 M_0C^,?\ OBT_^/5Z5\5_^"FG@+X3^"?AUXFU+POXCN[3QOICZI916JP>9!&K M*"LNZ0#=\P^Z2*>@:GG?['/_ 31\0_LP?&^P\=ZAXTTO6[:VM+BU-G:VDL; ML9$VALL2..M?;WQ#^'OA[XI^#]1\,>)],@U;1M0C\N>VG7(/HP/4,.H8<@U\ M+'_@M3\*\_\ (D>,/^^+7_X]2?\ #ZGX5_\ 0D>,/^^+7_X]331#YF>;_%C_ M ((OW;:K+<_#CQK NGN12_9-_P"">'@;]F"^ M3Q!)<2>*_&17:NIW<02.U!ZB"/G:2."Q).">E9_[=/['GC#]K>Z\-6>E^,-/ M\/>'](C>1K2YMI)#/<,<>8=K8P$ &,\MZU['^S/^TGH7[4OPWE\9>'M,U'2 MK".^EL#!J802ET5&+?(S#'SCOV->"_&S_@J3\/O@?\4?$'@75O"GB6^U'1IE M@FN+);:;XQ\+7)FT MZ]4[H9,":WD!PT4B@G:P/]",@BNS8\FMX61R5'=Z[G/^.?"%AX\\(:SX,=-\0Z+\2])M[O3+V.\M':PF# M*4?DWDME++ EML=HW*DKF4' M!([BOM:ROA?V%M=HK*D\2RJK=0&&<'\ZM*-1W;U%>=*.VC/C?]M;]A/7OVKO M&'AK7;+Q3IV@MI>F?89HKBUDD\QS(SEEP>!\V*^<7_X(V>+$&?\ A8^C'_MP ME_\ BJ_0CXX_M,?#W]GK2A=>,M=BM+B52T&G0#S;J?']V,]?&OB7_@ MLEX:M;MDT7X:ZGJ5N&(66\U..U++ZX6.2B4:-[R9=.=9Q2@M#SH_\$=?%8/_ M "4;1O\ P E_^*KZ%_8P_8AUG]E3QEX@UG4_$]CKD>IV"V:Q6ML\3(1('W$L M>1Q7/^!/^"MWPW\2W\5KXC\.ZQX4#X'VK:]6"/!JMLAGNB.]9UQ=D&IIV)S6;.&S77%'$TR*ZNLC MI65?O!WO4%@L^H7\-O"Q(+ D]E'K74)#%I=JL$ VJO4]V/]1^:D\X$K;(\\UUM MC-9W=NL<855 P%%?(9CF7U=D>Q\L^--)\0Z[?NU_,WE M!OW<29"+^'K[US[>"UM(C+Y>>5F>/^&,+A4^E?#UJ]6;YIN[/JX4805H*R.5OKR"'*:?:FX?\ Y[3 MJGX#K6=+I6HZDP^TWC*I_@B.U?TI$NVC;:V5(XP:T(+O* YKBG*3W9JG8AM? M!]I!@D*QZYQS6K!H=G"OW!GZ"HUN@1UJ07.X]:R9LK[EM;:WCX"#(J3?&H^5 M%'T%4UD+=ZG ]2*G(;60\;@,H3]>HKKD"S1+(C!D(R&4Y!KY MVN=>=6Q'$S8/9:V_#OB_6M,=3;P/+">6A<':?\*WCIN8\S;T/7=4T6#4$+'] MW-VD7^OK7)7=M/IUQY9:[H=GXFLS!UNEP>J.!PZ^HKWO7M$O/"]VL5RI\J3F.7LWM]:YWQ+H5OXITQK M>;"RCYHINZ-_A7ZI@<;%Q4HN\6?GN8YUN%V3HQ##W]:]^^!^G6UOX->5Y%BN;F MX9U(<9_NKD>V/UKOSO%>PP#?)M+7(+35M39O.N;*2/R3=>?C+HQ& N"GLKK*#C.0!@8ZD\Y!Z#%7K2SLWD6V>(F*ZD!6\9MKQ<8"GU)(P.G)]Z_ MFW-*W-7Y.B_,_LG(*,]3W]U91Z[NL&;4K MEW(,;R$;< C=R.<@D#'IFN;\1S^)[%IYK:/=(R 1!PIG$0& <@?,./>O&C*T MKR5SZVE3DK MQX->87/GW4CH3Y\43?O".><\%O3\0.:[JX\1ZGJ%E(MY M[IUS&\5S#-\ZJX MQM89X/0\C!!K9&IZ9J%M$L<_V$O 8'#6XD94QC9N/+=0>N:Z%"+?-'1]>IU3 MG6I)JIJNAY?KGC+48[6-9]1NE,6!$?..T8Q@ ?0477Q-\&^.[:;3?%VGG2=4 M+Y74;&,^5N('S-_$IR,^,_A+KG@^_N(XX[:6&.,W$EY<@A43[JET.<>F>175".UV>?5DI+0R;; MX@^)_@?J]M8/-:^(M!;$]NUQ^]66'/)ADSE?IDX/:O9$^.6E16BZYX8TU#$R M?Z5';RB.3)Y(=2,'\:\'T33]7ATEK2^\(R:]HC2LBW5H3+Y+'[Q3&<9[CCIV M-0-X(\0>!O$"G2=&U?5;&Z.WR(;17C*$<*^XC!YX/X>HKM5*$MSQJ]:5*-TM M/O/5M)^+'P^\=^(!"UE=:9KM[,BHL,30L),X5U:)B,C^]@<$@UU/B_P[X>U@ MO!J[2_VPB[Q-)$JM,@.!F5#AFY]![XKRC1]-O=)GCN(/#MWI-PP(C%[;,DEN M#UV[@2 <'')]C7T-X+O-'A\$Z=:S7<9OM[HXN4!7RMY.\DCC ?K[#VK"!Z=HGAN+5X89[*[1(9MDL0_=/G/<=1767VGI+JEREO9S M6408+'"004[$<\^G/N:Z/Q-XW?5Q+>B>2=+<)"BH29U/\9R>.E:83$)5(N3,LVPBJX6<5NE=?+7\3@_&^C2 MR6,E[',)4LV #=V4\''L#7$BS2\ ##[IW"O<_%%E;2OJ0MHBT%S:F!<#&U^_ M';FO%=/;9*,\X-?O7#5?VF&E1?V3^1N+*'U;&0Q,5I)+[T:-AX?=$614)7VK MJM&TY3#LP5-6/#]S#>6RJBY(':N@M5M[9U *%VR XSTKZ%5)7L>%BZ7-'FB MSC]:LU;$OO7L?PB\&Q67AX7=N#<_:)2Q91U4<8(ZCO7G5F\% M[=?:+FYCQN"JBH6P,?A7T?\ #J>QTZRTL11.R&,'>P" \YQS6&/JRC2LCIR M6BX3M)E6V\&26VLVTE;\FCA"ERS8\M2-I-?EF98B52JHRTL?JF!IVIN2U MNSQSQKK!TOQU&TUP\-L&ZM8ZKHUW";A=8M;PI:,L17BWASXLZOH]K'+J$$5Q& MB[_)$0CWC/3('ZUY//4JTYTJ;/>I1IT:E.M76C?X'U] E\?A[:D7B6EY;PM: M/=/PJ/&?+W8/L,\^M?-_B#PIJ.MWUU:>'-)TS4%ASY^O:_\ OUD;TB0L >_S M'(&.E?2GP^U"U\0^#9'CR8+IEO$)'5) &ZGN#G/O6G+X#TV^/[Z.15;GF5B/ MRSBO"_>A\>^!/!GBO2O$5K;SZA8WCEV\Q+'3T5%R3MVE0 MH ZYKWKQ[X9CN_!L5RD06:!@LFT9_$9KT./POIVB-LM%2"->6?/S.?J?Y"F MWU@LOAN^WK\I7.UN,'/-0X-SNSIC&RM$^T E6SSZ57NVL]P4+O8^:/B[I46BWB/"@09!/&,G.<\ M?2O2#64FDDNK.F M@G*7-T1WMK\-M"O=.$4EE$V.",<$5@>(?V?O#>HVS)#:M;RX.'B;C/;BO3K& M'R(<$@'^]ZU:5DDR,@X&!-0\+W,J2M+/;.=P/(([$?2OO7Q) 3"I)R<9X%>;^,/"ECK.F3-+&2=C$ M,5Q\U>?6=F=%*$6C\_=0U5EUB&'YT$,O". 5!]/:O8_V8-;ETSQQJ=L)]]K* MXN85(^ZPR"@'?Y2?RKA/&FD6@URYL7:1)G)#2+_ 1RK ?SI/AA?W&G_$?0?, MN2'%PMN"%"KALKGCV-=$92NFCS:JBU*+/T?34[..!&$V=Z9*KU7V-> WEB=( M\17T46542L4)[J3D?I6O=:-XPLIE.G>(87S]U&B&?I69-9:[#J6SQ"4:^F = M)4X##H/Y&OOLKJ.-3E?5'YOF<+T^8V3/+BD?'T4_UKH-.T&1X=X0],=*V_"^@&2& M]8)A1"5'OEE'\LUZI\/=%TU&5=75VBVG:57!SVYKU*V*C3BVM3Y^E3J5IQBG M:_4\>7PN8[L2M%\JKG&.XX/Z@U?.G"74;>WG!"*0IX[]3^O%?0&A_"]]:BN9 MXSY<$;;T5EY]\^N<"O/O$'A>2QO&A$(EN5?&5&%R/0=_K6=#'TJLW%/5&.8X M/$T:?,U[K.!UKPFT7F%%+8^8<=NE9@M8]-@8QD>?T##MZUZ='N_=QSCS&^Z[ MJ,@]CCZ5B:KX6:*5XS"%PQ&[/I7?3Q',N2IN?,>QG2?/3>AEZ==&>P*L-T;* MJ;<>W^&*ET[266[(*EH>S'C ^M.DTB6TDC@Z>6N6Q_>;G^6*TM"MU2\$DPS' M;J9GSW"]!^)P/QJG-1IMHN2G.K9ZG<^(?AS!9^$[/4#<0OD>6T(8;LYR?QSC M/T%>7-H;W%]%;JFSK8Y M;\*\VC4JT*4N>5WK8].O"CC*D5AXF:9I0>Y):=APHQQ7G6N^ M%)].D+V\DOE]00YRM>RZS/#?Q&X\S,@&$0G@FN.EA^V65U*S+NB8#&>I-<&$ MQ]2_-49ZN/RV":5"-K?B>:0W.H6,RG[3BS-_C7LOPVUN:R9-0FDF>5 - MD,DI.1_>;G@?SKSV6WC@D$AP6!_BYYJQX:UGR=0FA=B5G/S,>IYYKU,6HXF@ MU'4\C"8FIAZT?::,]_\ %'Q*;6]-N+);93\H)$H!#C:"1C\S^!KQW65MKG.V M,HH& $.5_(_T-:-QJ_GW#RQ_(2P(QV(Z?RK.O$7?N3Y$;D#T]17BX&$,-I'8 M]G,\16QGO3U:&6^A:%_8%V9G=M15E\A1RA'?/';-7/AWX56))K]D,K.6\8Z*='LVFFCV"7&W+=#UV_J?RKS76_AX M;C[9>W%CY1E"@.9S(\>!R0-PZXSRN!FM_P")'CC5+OX@>!K&%HX8I7DF'F)O M5G"E!D8.0,GC%;'B7Q#XWM]*O_-6ZDL886+&&S$*,FWG&44]Z^#Q6(E4DJ51 M['ZOA:"HKVE)?$>)_%#QIX<73-$L(9?^)C>1M$UQ<1MYJ^4NTJ3\V,\XZ#IT MKQ70_BSX7\"SQ:C_ &%?7EU% =MQ%&RFU.'RQ(P'.</Q!'92M#<+E4J2C"%1+=VM]QZ9/\7-,UV\$]AIUO=SR1>=/->PDGS3 MDL 2W3/K3K?XJ:E!*5BM+&W17V/(L"(%P!^?)'2O%(-2/AZ=OM]A)'$Y8K;/ M%RC9!^]GOSQ]*ZS3->2]CEF6.&-8UMW"[I.OX'G\>*]>CA:-2'+:S\S@ MK2J4:BG'6".Q'QB\47LNW[6UFN63;$@:0G'!"@_=S61'\0_%=S- ESJ32M+N M!)C"UE=F4JM24_=?NL[70YM;\0ZS9:38"ZU*\G5 MO+B64^F"><#')( -?JS'HT/A+P+8Z59 R1Z?9+;K(3N)VK@DGN^_;'TWPG?: MQI=GX^N?$.E1RE8XKBV2Z:6)ADXEA&/E/&3C(QZ&OE,\DY.,(*R/I,II*#E. M7P]!.V%ADN!*,]\8_E M7S>7.5.\*BL?19JH5E&K1U2WT9R%M<217"M%(8W5@RD'!4]:]V^'/C7_ (2K M3S#<$+J5MCS0/XQV8?UKQ#3=!OM3G\JWB:63< 0@. 37MOP\_9^UE]0>73O$ M5A_PDEDH:;0WCD7S%89V><0%W8[<@$CD5ZU2O2I-<\K'B4,)7Q";I0;1Z'HN MM2Z-J<5RI)0$>8G]Y<\BO=;*>&YMXYXF\R.10RGMBOGF(.VY9%:.1"4>.089 M2.H([$'@CVKTGX9ZX[VLM@[DF$[DYZJ>OY&OH\IQ+C/V3V>Q\[F>'O'VBW6Y M>^)/AM2UOJT*?>(CFVCO_"?Z5AZ3HRW2,Q'W"&/TZ?SKUS^SX==TJXLY&"F6 M,A2W0-U'TYKF_"^AFWN4CNT,08F)AZ \$^_KGU%?IV!Q"=/EET/QS.83I5E. M&TBG;V BA7*<'I@45ZGI7@8(LHO(V@7(V;P>3CYL?CBBNGZS3[GD2VE658YAE&(.0",C M//\ *J\W^ND_WC2P>291Y[2+'CK& 3^IK^:\0VL3-K^9_F?EU1M5Y-.VK/4= M<_:9\8:]H]WILPL8(;F)HF>WB97"D8.#N/->4>^:T0-+ _UUX3_UR3_XJDVZ M7_SUO/\ OVG_ ,52JUJV(=ZLKFE:M6Q33JSNT4*VO!OC#4/ FOV^L:6R)=PA ME D&58$8((R,BJFW2_\ GK>?]^T_^*HVZ5_SUO/^_:?_ !5904H24XNS1E!2 MIR4XR2:\SU-O^>.E_C;O_\ %UP'Q ^(^K_$C5(+[5VBWPQ>5'' A5%& M22<$GDYZ_2L?;I?_ #UO/^_:?_%4;=*_YZWG_?M/_BJZJN)Q-:/)4J-HZZN* MQ5:/)4JW7J4!03Q5_;I?_/6\_P"_:?\ Q5&W2_\ GK>?]^T_^*KBY#A]F^Z. MZ\%_M ^*? V@PZ18"SFM(&8H;F)G903G&0PXY-<9XN\4W7C+7[G5[R&WANKD M@R+;*50G &[!)]*@VZ7_ ,];S_OVG_Q5&W2O^>MY_P!^T_\ BJZ9UJU2"ISG M>*Z'54K5ZL%2G.\5TN7/"GC;6_!%]]KT6_ELY#]Y%.4?_>4\&O7]+_:^\06L M 2^T:QO' _UD;-%GZCYOZ5XIMTK_ )ZWG_?M/_BJ-NE_\];S_OVG_P 56U#% MXG#*U*=D:T,7BL,K4JEEZGKOB+]K'Q5JT#PZ?;6>DJW!D0&20?0DX_2O'-4U M6\UN^EO-0NI;RZE.7EF8LS?G4VW2_P#GK>?]^T_^*HVZ5_SUO/\ OVG_ ,54 M5\17Q/\ %GO-&OXK!;.Z4*YBB8,,,",'=CL*\_VZ5_SUO/^_:?_ !5&W2_^>MY_ MW[3_ .*K.G5K48N%.5DR:5:M1@Z=.=D]]2AG'3K6UX.\8:EX%UR+5M*D$=R@ M*E7!*.IZA@#TZ?E53;I?_/6\_P"_:?\ Q5&W2O\ GK>?]^D_^*K**E"2G%V: M,(*4)*<96:\SN_&'[0'B/QWH<^DZK9Z9):RX.4A8,I'0J=_!KS:KVW2O^>MY M_P!^T_\ BJI2J@F;RBQCSQO SCWJZ]:K6ES59796(K5:\E.M*[.X^"(S\4-" M_P"NK?\ H#5]EK7QI\$/^2HZ%_UU;_T!J^RE.:_0^&?]TE_B/JLF_P!W?J. MR:_FS^+YQ\6_&WMKE]_Z4/7]*%O$92V& P,\FOYO/B,BR_'3Q.DBAT;Q'=!E M/0C[4W%?2U7?0^OPRLF?5'_!+W]JL_!OXGGP)K]X(O"7BB94C>1L+:WQPL;\ M\!7'RGWVGL:_2C]M3]IFU_9C^">H:Y%*C^)=04V>BVQ/WYR.7(_NH#N/X#O7 MY,?MV?LLS_LW?$NUU#1HG7P?KL8O=-F7.+:0G+P9]5."/]DCT->;?%GXY>/? MVFM:\(V>O7$NL7^F6<6D:?;0K\TCG"[L=Y'.W)[X%9WY=&='*I-21Y?JVJW> MN:G=ZC?W#W5]=S////*Y))-?L?_ ,$9SC]G'Q)_V,,G_HF.O@K] ML[]F>W_9D\&?"+1YU5_$VJ6%Y?ZS,"3^_+0@1#VC'RCU.3WK[R_X(U,!^SEX MD'_4PR?^B8JE:,+-4''O>2U^C_ (>_X(O>!]:T M/3[]_B+K\;W-O',46T@(4LH; _.OS=_:,D,7[1WQ/D7JOBO5&&?^OR6OHW3? M^"M_QWTG3[6RMU\+^3;Q)"F[3')VJ !G][Z"I3*L^A]1_P##D[P)G_DH_B'_ M ,!(*^AOAY^S-I?[*?[+/Q$\(:1K5WKEI-I^I7WVB]C1) SVK KA>,?*/UK\ MWO\ A[_\?.Z^%O\ P5O_ /':_6#7/$%UXJ_99U36K[9]MU'P?-=3>6NU=[V3 M,V!V&3TJM&0[]3^?WX%_#RU^+/QC\&^#;V[EL;77M4@T^2Z@ 9XED<*64'@D M9[U^GG_#D[P+G_DH_B'_ ,!(*_*KX=>.]3^&'CG0?%NB^3_:VBWD=]:_:$WQ M^8C!EW+D9&0.,U]=G_@K]\?#_#X6_P#!6_\ \=I*RW+=^A]-'_@B=X$'_-1_ M$7_@);UZ+\9?^"8NC?&#P/\ #+PPWCR^TFV\#Z5)I<$XT])GND9E;>WSJ%/R M]!ZU\E_"3_@JM\;_ !M\5/!GAW41X:%AJVM66GW'DZ:ROY4LZ(VT^8<'#'!Y MYQ7['!@#3T(DVC\@?VE/^"4NC? +X(>*_'UO\0[W6IM$MTF6QDTM(EE+2I'@ ML)21]_/0]*^3_P!D;]GVV_::^-FF^ [K69=!AO+:XN#?00"=E\N,N!L+*#G& M.M?M#_P46<']BOXHCO\ 88/_ $JAK\MO^"4?'[9GAW_L':A_Z3M0K%)NUSZ> M/_!$[P^G7XJ:D?\ N#1__'J\E_X+&6']D_$WX8V ?S1:^&! '(QNVS.N;1T'[!7[7MW^S1\2Q:ZK.[^!M;=8=3@49 M^SMT2X1?5<\^JY[@5^Y6GZE;:OI]M?64\=U9W,:S0SPL&21&&58$<$$$'(ZU M^'G[2_[(,_P_^#GP]^*_AF"2;PUKFD6C:K"OS?8;MHE^?_2GXKZ"M*;Y6E(SK04H\T3X0_:* M_P"2]?$,_P#4>O/_ $UL(8;&U?.)[IT C0 MX(.,\G'. :_#K]HC_DO?Q"_[#]Y_Z.>OOW_@K9XCN(?A+\*-#0XM;B1[R4>K M1P(B_EYC?G1!N*DT%2/.X19\$^=X^_:J^,2(SW'B/Q=X@N=JAV^5?;T2-5'T M %?H+X%_X) >$(]"@;QKXSURZUED!D30C#!!&V!P#+&[-@YY^7/' KS_ /X( M[^$;#4O''Q#\27$4F^!OP?\0^ M-H-.CU:72D1Q922&,2[I%7[P!(X8GI6U&G!QYYF%>K-3]G3T/SN^.O\ P2EU M_P )6ZZA\-=8E\56^]5DTW40D-TH) W*PPK@9.>%./6ON;]D[]GBQ_9O^%=I MX>CF^V:O<-]JU.[YVR3E0"J ]$4 ?B>I-?&C_\ !8?5R,_\*RLL>IU9_P#X MU7N'['O[>M]^U%\2M3\*7/A"WT!+32)=2%S%>M.6*S0Q[=I1?^>N>09B@.1[MV_*NSG4 M8\S%#]Y+E0_1-)&D689Q_I$F&<^GM3OL\E].47[HY9O05HW[XW=L=ZRYM;M[ M"%D$PWMRQ [U\YF&,]C!OJSZS 8;VDDNB,/Q'";8,$."/2L33_&S:9="PB?S M;LCKU$8]?K2>-/%"65H9%.^:0XC0GJ?6N+\$Z7<3ZD]RQ+N[;F<\DFO@:TW* M2;W/M*,5'Y'N.E0M>V^^?,C/R6/4U3UKP;!?PL-@.1W%6M)CN(K=4+$9K0>" M6*(NS96LDNC6YT.<5]H^;_B%\*%B+SV^(Y!SQ7DKQ7-A<>2\,CD'JHZU]IWV MGVNI'RY@"3QP@ZUA4H34E%JUR'7HII.6I\KVMA MJ%S_ *JTD/X5M6GA#69P#]GV ]VKNM3^('AS1I9%:^MH=A.9*L8]JTH/AO@?OKHGZ5S^F?&F M+Q'+''IEM-<&0 []I "D]:Z/Q!XPFTW3%>.W+N2!S]0#7-.K"F[-GI4L%4J* MZ18B\#:;;M\[LY]S5M-#TBV'^J4D=VQ7@'BOXU>(K%[V*.W6-ECFQ>1752IRKZP..NXX9VF?=,YT>W&3%"N.^!7;^'[30 M9]+@N!AMR\[ ,=Z_,)_B;XEU-I!-_@3:7FKWWG7EM= MSV\N^0Y&&ROZ-7;3PLD_>.:->$]$CN9-0L[5UDL2MLT9_P!8QP/Q]JZ?1?%% MMJ\9"R*9U^\J<@^XKS'XIZ?9:7>WEOINOV,$]3H:7+<]6\0Z)_;]@UC):7$HD&4=8S\A[$&O#M;TJ]\,:I M-87\;131_P!X8W*>C#V-?7%M\4]-U&SAEL]/DD##! 7[K5YG\;](F\=:9'?V MVFM%>V*,0P'S/'U*^^.OYU[^5XE86HJ;?NL\#'T'7CSI:H^7?'6C_;[3[="O M^D1#Y@O\2=_Q%>N_#W2ELO!OAV0Q[ ;>.;/][?\ -QZ]1UK@#(",,.#VKV71 M],$7A_2S&C2VYLXF1"?N#;T&.:^LS^3EAJYJW9V*F>XME,L%Y*5P7P=X0_,0> M,9ZXQ[=J_ L0_P![43[G]8X."6$IJ+TY5^7_ 3&U/2KB[O?-Q%!MWEB]NQ\G4[*Y:WG0Y!7+KVSGKGG%> MB/-#.SKMS4ZD?9UUZ/\ X)X*WAZ31%GL9=2GOCOR)KI0K/CU*A58 M^^!GTJA/JMSH4C-&()T(PRRH&7.,#'Y5WGQ6\.:SH=Q#J4MH\EA2!WQSTJ*/XVZKX7BCAUMKK5FC!B%RDZNLT? M4!E=26]>3]0*Y#1/&\GA^XD$4LWV6;[WE.5:,_WU/KVQW]JT_$FG6NMZ3Y]N MTVHQW(62-6BQ) ^/F&1UQZ'DCITKJA%0LTSEK>Y+78ZG0?&7@V[EFN-.U0:! M/!]RP1R?>#,AR@88XP<=17T%X4TS^V=,CP((]Z^!?[.DTNZN+2ZLFF,B [",,0.=P_.O6OAM\3YO#D-VR"1[NXB2.) MY4R@"CA2N,;L_P 76M)KG7-?4\GGY:J2T\SZ+\1^#EU*X2*SU!9YX 2DCH?, MD8 $HP.&) );'3TKC5T2?3K!9(K962.50'9"N$';/<'T-==H>L6OB7P[;WLZ M)=,+4R?;%.UXG.-V0#D;"T@4VKSQ(&V*P&0HZ=@!GIN%=1K?AF]DT33+W3X9%LII?,M[ M95W[%:3"CG.<$#OQFF77BO5;C1]3TF\MWO;>6;=-,0L;QGY588SS]T=*P3M) M7%/WH^[KNF<5<:8RZGYE^7)[X)S7A=[8'3M:^HM4TN,7D&GZ;%,MO)\R1N0P9AC&,]J^=/$8<^,-8295$Z7548QJK=JZZSTT_VO9[>8VE1 M2WOHJR:33-%M+>/B00(CN/H.*\LU73A:ZC.B@!EE<# YX)KUQ8 M&:RM"!@^6A]N@KBQ^L8GJ9363J3OT/2?@(MI/>ZM<7U]'8E((T5Y<\Y=CCK[ M5Z;J-GH";P=;27(.4A0EC7SQI"SSF>)9"DDTD>['0@%NOYUUNE"\@U1T>1U M4$%#[U^6YC0A/$R;/U;+L14CAH\K//OC)JWAVZN[VSMX]3EVR?ZIH?+5B.,\ M\FO"-6\.:GXCG6VTJRFGDQB*TB0NYY]J^H+[X=2^-/$MQ)<:A,MF+@1?.-S% MCR0G;CC.?45ZAX.\&Z+X92Z2PM]D<"\S2-N>9Q_$[=QZ+T'I3H8107,E9,WQ M&,YK:\BU/Q)#A'T_I7BYOA'AVJL%ON?09-C/K$?9U'JB]HOCF;Q+XBO;]&5K&T;9 M;QMDJ[@_,V!V[#Z&GZ]\:YTL+JVFTAXKD@A %_=R?F>/6N-'PZ\6:786O_"# M>)8+!(65GM[FS29+F/CC<061MHQQQGG%>BV%II.NPI_;&H:C93%#F)K2-MKX M(!R%/=1^!%>%"$YJ\7J?6J3=Y6NEV/#(KGQ'=7_]H:]>)'IR@F.W+[(D';Z] M:R/#6H3>*M8NY=$F$^D0N\=U<(K+$6 )PA/WB,9)' Z$Y->K^.-'\*P1QK:: M?GDSY[^(&J_9-$O)96! 7KWS7EMAHNI^+]/EO#<,$@PJJ_.X M_P!T=ACBI_C!KYU.^@TJU?>GFAI67OSG;_6O1OA1HD=[X3N8)AM5;L[\<';L M![?2MHWI863CNSR&HXG&QC/HF4?V?_#DWBG[7?7MPRQ6;[(HP25'OCU-?5.F MZWIWP\T-;C6_$(T*TS\B1HK2R,!EC]UB<#DX' ZUY3^SQX82%K^PM1B-KMYF M+?,0IQ@'UXQ7T=/\);+59!"L,D9Z'^M87YIWZ'H0I. MG3.4\,_%BW\6ZC(FA^(X=>LT4AXI(_*N(S[8"Y&.Q7OUKT>?7_\ A']#&H7; M/&&(9HV/*KT'^?>N&T3]G_3_ K=2W%L/L:/(\J1PR'<&?DMG )Z#KGI72_$ MBYFB\&6]B'^:;$9=ASDG&:=2FW)RB]ATZC4;2,6Z^*"7=T(_LEU>)(,I]E5? ME'ON89/L*BU?QMIMYIDL+Q7&GW14B..\C";CCH""03^M>9>-?A->ZUIK-;Z[ M/%>LZ26MQ/*8@ %(V$I@GDC^(=.G>LCP[X/\2VFF-I/B&_EUG34:'RKIW#S* MZ_>W$=5)P03DCH2>*FI37)=N[)C4ES\O+H?,_P 6+Q9O&]RZ.V#\K@GKC/'' MUH^$<4EYXTTV9H_DMYQ+E_4'/^%;?[16C1:=KVF/9QA)GC,CXS\V& (-=9^S MCX0N=7U1[IYEMRN"JR+GN$^(5C'::M9 M%!Y3/&Q*$Y[]1[5]AA(N-9?,^)QCYJ+^1M>'8(9[<2,<2=]M<[9V CU.XR5" M^8T9/3G=_A6MX7E:!XV))0G!'K5EC;SF<1+OO>IU)0DT?/5Z$*T+ MVU1V7AS3-,BC4AF^SLT?F%AT.V50 09=Y.!&!ZGL,5I%N3YKGBU7",?9([K3XY;2T8R,R_(2>?0?XU5N[&6Y#O!,TOF'=)(#D$]U7_9_G45M/') M%) ,L[KMDNAA689X '3;^IK3TBW^RQL8)!<1C[\: G'U_P 16K:IMR2U/,2E M62IS=T8#>&94+R,F<#@XZGM5:^TW[1#;R,OR*N)6]XQS^8V_G7K6LW.F2>&X MXK?:7&3L YSW^M>=W.R>SO+<2?O;G)C5O]CEOS'''I4T<7.I[S6S#$Y=2I+E MB[W7XG!75L&E=W7YY&W9],UH:=H#ZA8/%$ );ER3D@?NX^3^9/\ X[2:C%AD M);"E%Y/3TKFM:\:@7C1V1'D6Z"%9>S8ZX'N2QKV'.I62C3/ CA:.'O*NM'H) M?K'ISL965.?XCC JMJ?C:R@VQJ2Z[ !M' Q[UP_B77$WO<7ETJ[N2TC;XE M, 8UA)(Z9;)_"LFX^(LA,BK$IXW, YZ^E>4>+O&$^E_9D@MT5)T+$E\DXQW' MU]JYY?&UUM;]U%\PQU/^-<T'QXLI_>0,. M_#"G6GB>V,P<2-&^W1E4@DF3;_.MB'74R=+^6S_+4]^T/63J.U/\ 63'IL.=W MTKI;I);1-UQ&8U91MW]"W,DGG$A G)( R3D_ETJ'QQJ# M6WAO4;C=AA"P]\D8'\Z\W$U;RZ/XJ%U8Q7.MZG=O'),T-C:0QQHH4@;R^=JYQQ['% M<)XIO3I_AOX-Z@ &,)<[3WPZ''Z5+XS^-]W#JUY:Z?H6@V28"-*++?(W&>68 M\\DU^>U%4J2YHJ[/TV(OM,:O+%%G.-9^AQU)2J4_9+L:UO<0>*+B;28%N[F29<0%H40S_+UYY3! YR>!69 MIW@:9%FNI;QX6B4-%<6Q^1V7((W8&,$'CBN1G2Y9LIT MR%XSU!QQZXJS=>/-8M=1DC;S8H#B/9YS^5C)#?*>#NY&/RKV74E)JVAA" MC*'[JG-;7>]_EZES49+FX%W*K"UN"$:5X>#,P/!'.=WJ_*#@KCAL'A0*[WP9^SK\4- M;^S1S^%=7LIY8Y)F?48?LL(C'&UI& Y)&W@G/%=-.HJ%5.K);=_\S>?LJU# M]Q"[VM8]G_9Y^&_AN\\(ZKXQ\5*=8OKT3Z-IVF;TD,<)38\X&#AR&*KZ7CG/);DX/2OS_/(UH8AU>=2B]58^SR5X>IA?9V<9IV9A>--1TBR MUA+/1K..ULH5"1A0!BO _P!I;3$U7PW X9%>)S)AN?3_ #],UZ1KOF64[S74 MF78\<8_"O"?B=>SZ]/+;RS%'MS.NX*/]YL"NB\'V=A9>.&@N)5:& M5_-6 @NN6'4<87G/0UQOAPO;L$FC,4R_+)&PPRMW!]\YKH]83R[ZSD600O)% MMW]U&>WO@]:_6*3Y_=3W1^*XV"C:HU=P9]1&WT>>UMRX5OESV]O\!17@4FLS MO';@7CX6( _4T5RQRZ=OB953/**DTZ/]?<><^4 >0_A*$QS,_\ O&F$]^M/E.97^M:/A>ULKWQ#81:C<);6!E#3R2' M" Y8?4CBOYHQ$>;$S7]Y_F?EM2//7E'S_4Z#Q)X!BT/P?IVIQW#RZB"G]HVI M Q;B5=\.._*]<]ZS].^'/B#5;*&ZMK(21SH7A'G('F R"$4G+$$'@#^==;#X M]T/Q1J>OP7>FC2TUR!U:[ENRZ1N@W0G:5P,%0O'0''2J=AX@L8-=^'2#%(LI63&=C!2<-CG!YZTNL>!]9T*T%S>6RQQ[UC<), MCM$S#(5U!RI//7'2MOP]XEL]*M+Z2=TF"ZU:W:PD\RHIDWD>O4?I6WXMUJS@ ML]8>PDT VVI3(Q>UEE:YF7?O!9&8A".ISCN!4^PH2BYP-=A'XHL)/C5?ZK+?(VGE;I4N&;*;3;2(@!]"< 5 MFWUK9>+] \/O'K5AIK:;9FTN;:\D*,A$CN)%&/FW!AP.U]O^"8.F^!M8UC3S=V=NDZ;6=8EGC\U@N=Q5,[FQ@]!4ND_ M#W7-:L+>]M;56M;DLMO))/&GG,#C:H9@2V<\#FN[\"7^AZ1-X;O(KG0K6WB0 MM?378_TP39884'D C;C'&.MG61@?\ "P?#7_"8?9UTH_V<8#HWVTW;;?LVW9O\O;C_ &_K[UG1ITKS MYVK;+_,RH4J/-/VC5ME_F>?Z3X,U;6M/^VVMNAMRS*C23)&92HRP0,06(!'3 M.*6+P5J\NB_VIY$8MMAE&Z=%=D!P7"$[BN0><5V/A=--DTW^R]MWVEWJ6MC)]@E21DOK>7DI"5Q M\R;CSD$ $X(JUAJ?*KO6W=;Z%QPM)Q5WK;NM]/Z7Z'-6GP_UV]TM;^&RW1/& M9DC\U!+)&,Y=8\[BON!BH='\%:OKMC]KM+=#;ES'&\LJ1^:X&2J;B-Q]A7>V MU]IDWBW1O%W]MVD%G:6T/G63.1<(\<84Q*G\08CJ.,,<]*Q;F*Q\8^&- 6+6 M;#2Y=.26&XM;V7R]H:1G$BTT=;>VF6ZO6E0/+*@CD*L!\O3;CON/TK1TGX;:E<^*='TJ] M$<,.HRA([F"9)$89^;:P)4D>FZ#=6WA&TU*XM)DMDO@Z7)81+(QS%Y MF,':2!_6M5?$&GV$G@?[7>:2DEGK$EQ=)I:CRH(R8<,=O!Z$DCT[U4K? M;KZ?YFE/#4)>\WVTOZ?YG"7GA1M*M]<6ZBEDN+$1E);>>-HD#2!".M>DZ;XBT^'Q=\/+A[V-;>PLX8[ARW$)$LA(;TX8? MG7G,S*UQ*5Y!8D<>YKGK0I0_A][?@CDQ%.E!?NWKM^6OX_@=M\$FQ\4-#_ZZ MM_Z U?9"N">M?&GP8;;\2]$/?S6_] -?8"S<]:_0^%U?"3]3Z7)?]W?J7=]? MSB_$$_\ %^/$O_8R7/\ Z5-7]&22U_/AX\^&OBZX^.'B*>+PMK4D#^(KEUD7 M3YBI4W+$$';C&.]?2UEM8^LPKT=S]O/C_P# ?1_VC?@A=^#]5"1RS6Z3V-Z5 MRUIW."!U4D5\5_P#!-S]AS5?"7Q#UKQ]\0M+-K=>'KR73]'LYEX>Y M0LLMQ@CE5P A[DD_PBOTETGY=.M%;*D0ID$=/E%7,CK^M6XJ33,HU9).*/RK M_P""U#EO&GPO''&GWO/_ &TBKV[_ ((W'_C'7Q%S_P S#)_Z)CKR3_@L3X3U MSQ-XP^&CZ1HVH:JL-A>+(UE:R3!"9(\!MH.,X/7TKV7_ ()':'JGAG]GSQ#; MZKIUWI=R^O2.([R!HF*^5&,@, <>]<]O?9V7_=H_*W]H4*_[2/Q+# %3XLU, M$'N/MDM?M_X4_8O^!5[X6T:XG^%WAR2:6SA=W:T&68H"2>?4U^+_ .T'\-O& M%W\?/B3=VOA;6YH)?$VI2131:?,RNINI"&4A>00<@BDC\7_M P11Q1:C\0DC M10JHIO0% Z "LUH:M/[3^(F?]^]K])?V%K_QKK?[% M_P 3E\8OK=[K4G]I1PC6?-:X9#9@*%$GS8R3C'>K3OT,G%K6Y^8G[*_A_3/% MG[1_PUT76+*'4=*O]>M+>ZM)UW)-&T@#*P[@BOW+;]B;X"Y(_P"%5>&__ 0? MXU^">E^ /B#H6I6VH:=X;\1V5];.)8+FWL)TDB<'(96"Y!'J*[?_ (33]H7/ M_(3^(G_?=[4+0VDK[,_;_2?V//@CH.JV>I:=\-- L[^RF2XMKF&VVO%(C!E= M3G@@@'\*]G\T5_.R/&G[0F?^0G\1/^^[VOVT_8UOM8N_V8/AW+X@DO9=:;30 M;I]1W^>S[V^_N^;/3K5I7,97CJV87_!123/[&'Q0_P"O&#_TJAK\O?\ @E(< M?ME^'?\ L'7_ /Z3M7ZA_M^6%UK7[('Q*L[&VFO;R6RA$=O;QEY'/VF(\*.3 MP":_-C_@E]X$\2Z!^U]H%YJ7A[5=.M%T^_5I[JRDBC!,#8!9E YIR5I:%0DG M$_:V4;<^G:OR%_X+0'_B\G@'_L O_P"E+U^O3'*X)QZ>U?DY_P %A/!FO^)/ MB[X&ETG1-1U2*+0W1Y+.UDE56^T.<$J#@XYIR^$SA\1[U_P2,.?V4[K_ +&. M\_\ 14%?G)_P4#/_ !F-\3?^O^+_ -)XJ_2C_@E-H6I>'?V7KJTU73[K3+H^ M(+M_(O(6B?:8X,':P!QP?RK\]?V\?A_XHU?]K?XD7ECX;U>\M);Z,QSV]C*\ M;C[/$,A@N#R*/OV2_ OAW7K./4-(U+PS;6]U;2@$2 M(T*@]>XZ@]B,U^.'[6W[-FN?LE?&*73(9KF3199#>Z%K"G:9(@V5&X8Q(AP# MC'(!'!%?LW^S&LVF_L_?#RVN8I+:>'0[1)(I5*NC"(9!!Y!K,_:E^ &A?M,? M#"]\-:FJ0ZC'NGTS42N7M+@#Y6[94]&'<'V&-Y47-)K(5.33V/P&UO7+ MWQ+K5[JNI3FYU"]F:XGG?J[L268_4FOUE_X*??#&X\9_LS>%_$UC"T\_AF6& M6X5.HMI8@C-^#"/\,GM7YE>+/@1X^\%^)=2T/4/">K_;+"=H)##92R(Q'=6" MX((P01V(K]]HM*M-?\%0:5J=JEU976GK;W%O,,AT:,!E(-11@Y*43?$5%%PD MC\>_^"=/[16F_ 7XQ7-MK\ZV?AWQ' ME=73\+;R*=T4C'LH)92>V_-?KG\0O M!/AKXU^ KSP[K8_M+P[JL:-)]EN"@E3(=2KH<]AT-?EG^U%_P3>\8?#C4[W6 M/AW93^*_"DCF1;. ;KRQ7KM*]9 .<,N3CJ.Y^==&^+/Q;^$,!TFP\2^*/"L, M;%/L:W$UNJG/("G&.G2G3J.BN2:)J4HUVJD):GV[^VS^Q9\(/@I\ ]:\3>&= M+N+#7H9[>.V>?4I9 P:558!&8AOE)^E>7?\ !)'Y?VC_ !%G_H5;C_TKLZ^? M[7PI\8_VB=:@7['XF\9WF<++=F61(\]R[_*HXZY'2OT:_80_8MU/]G75;[QC MXHU%)/$FHV#:>-+M<-%:Q-)'(=S_ ,3[HE'' ]35TXNK54H1LD*M)4J#C.5V M?9DKBJAJK(17O15F?)2>A [9J)6 R*)7V]*JO-M!QUKIBKHY)L M=< 'D5E7;;58G%6)K@[36-?7/R]:Z(1.*>YEW\H).?7M5V"W6QL53 #$[F/J M36?:#[5J4:-]P'F,TJ[M:)Z&"A:]0J+:?V@) P C7J:YS6= B M!9UZ*,G%=4BF"T57RF1N-,>)H)]0U1[@Y,2_)&IZ!?_ *]=Q\+X%E@V%6![%IM\GVKR\_, MG4-VK?U*-K_09FMQEPI.!7BUQXWLK"^GOI[T0K(Q8*1TKT[P)XKM=0@.V<21 MRKZ]!S'*+4Q(RG!^=E7^1-=W8_##3K77;C5X'(FG;>W/6N$_:OTE%^ M"VMB(%B6BW8]-X_KBJS&K0Q.(IRI;(ZH8*M&:E/9'Y8:G+<:E>""2621Y6+, M6)/'4Y]JI6&E#5M9T^S1"[W$P4@$ D9['Z"M_4;55O'4(RESY6X'GYAG_#BM MSP]X/TZ\\9Z?:W$HAA:+!P^#O$?)YS_$#V[UY5=DZEH]I=V+F4 X (_ YKYSDU74? <^GZ9X,_$WC+29K5=(CMYHW:.2.YOS'."#C)41$ M 9ZU?(GB/PZVCZA) 6+[7*YXY]Z^LM3T'Q^FFS17>HW,UD1@16<%N9!]7.TG M\%KY^^):6=E(L:L]Q?>:4=9 4:,J1N#9[UZN E.G+EO='A9K0IU(>T4;-=SS MNWC_ 'GRGD?J*^W_ /@G[/#JFE^*M%G>0!)(KF-0V!W#J24+29\I1BY/E6Y^AR^$=,AY:( M,>^XYJ5-,TRU3:L40 ['%>(3_%K4+F;:LN ?2JMWXXU&4?Z]^?2N=UUT1Z"P M\[V;/HS0=&2TNI>$KK[3X(TR:)V\^WCV[5QSM.W%>:^-0)'5]P)Y%=C\(=4672;VQD9=T M4F\!CSM(/]1^M?I,ZGUS+XU.UC\NH06"S25/HSJ=-U.1-/"3,YA65LRPQG]T M>Q! /!YR:TYXSJ5PJWGS2!G3SD)W-'M^5UP>,'/7D^G-9FDP6RZM/;N(_GA9 M%#R'#+WP0,=CU/:M.'4YK=6BNHBPD^[,IXV$8 .!_"W(/O7XKF4?9XF:MOJ? MU#E%98C TY06J5G^15\67 O7%Q=PR*3$&6,QA@K >O(.W_&N:'B"*^G%I?2 M0PW<=N1;RNNW@D_(W&..O'TJ]K^JF;1(8;N&2UA">5%(J%BF&."3G."#C&.H M]*\POU U* ?:XK7496/D6US$7AGA'5EE'W64\E6YP<] <>;34F_=9]#&T*24 MUHOF6?$%Q++']@U22YED#LF?-)5,@X92,8XK74K4Z7>(JK+J< M,6Y" "!G:2 3_D5TT%W+JFJ3Z='[;:JO[RSN 4)4]@><8^N*WK?XH:,4 MF@\3:>GABYBQ^^MXY7@?U5X_F9/]Y21[5WD/AW3/%O\ 9M[IVHJ8;R)&BS$H MM7)7(PXP5)7!YX//'6MO9MQYH[').:E[G-J8DWBCPIXXE,=_*?/5UQ _RR0, MW&T@#(4'N/4&MGX??"87.H2+?:-IUW;MN6'4DU'8H4GY(_@; M!I>K?:[J FYCD3,\;%2B\'<3_$!Z'K6Y\-?#US#P+C> < M]^V:LZQX?@L[U1%)"KSR;H$=3E5Z#Y@?[P)Z^QJ_97-_>V2";4(UU"-E0(X7 MY@!D-G@9 _,@TMQ>W-EPK?R*Y0,"4ECR<[@P7TYQR.N:X8^XSU8JHI\ MU[VZ%6SU2\TK0);-)5F5YED;]=C8V$^F3C5XA;WL4<@^T>85?;@8VYZ9P1S[UG3ZU=76B M26H/EYN]RPI;LA"''"D@9Y YIT8NM5C#JV<.,Q$6SS^=?1?Q&N#X>T/5[V M2V\HRQ&.(LQ#!V( (X]37@VE6']H+M0?Z2H^[_ST'^/\Z_H/A:FX1J5I+3;[ MC^...\0JDZ&'AJ[7];_\,:.@::TY$@!8.E6.EEWWD87H /0=Z^D==.Y\A.E.$8\O];'/ M>(=",?B&]1%!+32'G_>_^O7I%I8F;2[-E''DKV]!3-3T(3^,;D,#L^_@%K>?'R#*>I SQ7#C,3'DB=N58:M*O4ET.#M[=[>X8<[FQ@CJ.: M[;X?Z9?ZSJYC,L;6D:CSINZ ] /5O2LF?3BMW!"$8W$S!54=0#T'U->P:/X: M/@S3=.M60">YD,MP1T#D8"_@./SKXO%P]I7YNY^H8&IR8;E>Z,+Q$D6B>/-+ MMXU6.T2U>503C=(?XB?4]?PJEKFKG2_#^HNS;3(P''H3R!6K\7-.DN+2PU"W M&Z> 8XZE3U_2O*]FK$2MSZFAHGB M6U;3)H!(OS2L'SSCIQ^6*^DD9VEOJ17YXVOC;4O@Y>W,,R/<: )R)4C_P!9:L3Q(H[CL1^(KZ?^ M&/[56DW^DQ0WVH@Q8Q'3?M0ZI#X3\ 1Z?;LOVN8@8Z')Z=*Z[Q7^TWX?TRTE:" M^C_V?+?@)IVBE=,Z*LY5&FV>:V M%F^H^);*-,RE')8GG+;2>?QKVWX1ZI:6WBZ\\.WK",:I&DD _O&,_./J5)_* ML'P-X26P:W:2/?<[%D88YRQY_$#^=8.N:M>^%?'UM?VT,;S0;H3'*N00<9P> MJD@CDPQBEV/K[X):=%IS7$T0"+<3'&!C [?I_(5[Y=^ M++;PWI9GN0K,J\'&37@OPOD&I>'XI(6VET1P5/3*@_UK>\23W&E0PW.H&XO< M-\L5K"9'P.2P4=3@?A7SD:E2+LC[6T91O)'>0>-IM257O'BLFN#F&W;@[/4^ M]87Q;U&V%MID<5RC,"#[<$=:Y:#XU^ O$L*VKW4BS(-I66UDCDC_ 8!OTK@ MO& \/ZMJ*_9_% N7 ^6,2[2H]!D#\J['[2,;-$NDW[SBTCVWP3=67B/2Y(VV M,(I#&Z8!&?;-+X@MK'PY92-:J$#\F/ /L .!7D_@[QI:^% ;<2%D8[22>>> MC?G_ #J'X@_$);J%8X9=TKD[0#G'K7+[2[LQ*DK*M/^R3'[/@9BE;(<'VQV]N?I7AWC_2SHWB5;.6>25XX MQEG(89)/0^E>J6<]Y<1@2%HH0/\ 5@]?J?Z5X[XNOEU/QE?LK+Y<3^2OT7C^ M>:]_ UX8C$-0Z+<^5QU">'PZ3T&3S4^IQQZ; H@#+&C!V2,?-*?]KV]JTM*=# NT*<\8)XJMJ^I M16RLIC@5AVFB)'\ZRPW/.?*%)V,5S_#- N1D_ MWA_A61JBIILT=[,RA+8!0R,'U)F4S 0*20-Q/U8FHI4I3D^79;G?5E"E%.:U>Q7\3:PU_*\@ AMXP M2B=E]":^?_'OQ)&EW+6.EQ^=*HYF(^1/7'J:O^-OBI8:Y9O9=O4P-8\0273/) MV(/#A<]3P<9Y%?2=QX, M\,7EM)I-IX?T^&R\UXF6XB78GEMS&2>><#G.?F!Z\5^9UL;)24GWZG[#_9U+ M M49QNTMEHDCYZ\;^*VU;PGIFH:,+*,S1J[12_.ZLW49&,?,,<]'A5C#5]SL="^(%^;X0 MSV4%TC$*0BGM?1'A_1;;4+9(OLTFQX0T\CZ/J">'6DTV[U!U:Z3 M:-IC\L*VSN#D*"<<\G/->A@:ZH4W5KZ^I%;)*%>D^2+3OT-*+59;&=#;R94, MS ]5/8=O3@UU>F>*(YK;#@+*OS(G9V'?_P"M7S+X?U_4=)C'D,TD*\^0YRI' MI[5ZQX,\5P7,GVB- I5"LL,A^9?\?K79E>=U*%96E:/9ZGYCQ+P;2Q5%RG#W MNDUT_P 1],?"#4II]&OII)"[/< ?-S_"/\:UOB5J!7P9?IM7+!1COC<*X'X+ M:['-8W\4A\DF8,BELDY7_P"M76^.D;4_#UVB,9'"CY<') -?7XJO3QU.=:CL MS\OR_ ULIE#"XG==>YB^.92OPO\ A5*1@I(PZ?[0_P *\R\7>)=/L=A3^+M$LK?6)UN[:>:76X;N&(AS,(DR696 " '.,%L\ M=.]<1JVM:7JOBK7;FZC+Z7J88@P >?"^XLI7.1CG!'-!I8;F]5 M9[O?B2. 9>9^..(U<].N*\UBDZ8XKZK_ ])T[Q7XL\1ZM<+"=/TY+6VW< MX>=SN8>^V-A_P,UE7QU6G2E*YV4<.L15A%K4^K/AQX(\"?##^VI= \-V-O'H ML:V\.I2%IKHRR @@R.2>$'.,?>'2K2:U<^&_A]J5_=SS13Z]<%H+>4E5A@3Y M5.T]-Y+/]&7-07/Q9\(:"L%KIT)N].CN&GNRQWM/*PY8_D!] !VKGKCXI:'\ M2?%<;:Y!G1V1D:"5CC;@Y'XU\!6Q$ZSO.5WMJ?H&'PBI.\866_W;?CN>26_A MRWUWPAJWC;6K*UN;>TFD3PU,LDBR;3C?*V"N0) 2G4 DGO3_ (5?'K3?^$4N MK_<-.CEEDM[JRG;Y8KD 9=3_ '&Y//()/-=)^T#XZLKCPE)9>'K6.#3;6 ): M6\$>%4 !415'0=!CZ>M?"6E:O>^$YM7T75HY(YA*_FI(-I#GDY'KR.*[L+3E MB(/7W8Z'-C:\<*XW2YI:L^B?B-\3TUO4H$LY%%HN[YFPI9@#D=\9QQ7GE_?1 M7DZS0DLZMO8L1C&.1GUY_'%< +F75&WQ!VC!W$H21CZXX-=G>?#[QEH7AB37 M)O!^L6FC%!(=1N+.00^@?<5P%.>">#75#"QC\+//ECY27O(ZKPIJS:=/'+:Q MQ+(XRS%3N8?S/Y'ZUZ9;:ME8I"I#%>0PP?K7SGX?GU*?4$)#"/C>2> /05Z] MI7B59YA"S8" #GTKSL71UT/:R[$MKE>AZUX8FL=0U.Q@O8H9E+G'F(#C*GGF MOW]T8[GCYP^$FCS>//BOIFG1 MAO[.M%:\U!L\+"O 3/J[$+]"3VK[HTRRGORWD#RX5P"V.![ ?2NO+:$H1Y[Z M'DYS7C*2@MSY@U18U\:ZT$(7_3Y\*?\ KHU0^,IVB;2L_*W[P8/?[M+JJ>=X MQUEUR%-]-@MZ;S5/QAJ9AETN": 75N!(S*QP1]WH1R.AK]GP%[P]#\)SA1]E M43TU-_3W>[MHW0@X0 @G&.M%5M+M[6]M5>QU*")/XHKN3RW3V]&'N**^E4HI M6:9\/[-O6Z^\\M@K1M^!UJ;3M"2XL(YC<+&6(^9NB@GO23P+:7D;AC]:Z+X;3+#X_T M#'/F\B0++R 2P M&?J,Y'TK^:ZT5/%2B^LG^9^72@IXAQ?5_J9.LZ%>>';XV=_%Y$ZJ&*!P2 <\ M9!(['BJ.*]*O+FQ6U\1>(WT2PGN8=06QB@9&,*9\QFE9-WS,< K]AH.@ MK=W&K7&D1R6LOAEM5_LX,P6.83K'E3G(4X)QZ$@5I]5(Y]+&I1:/=M9E?,\P)U7&=P'4C'<"H-/GMM4\76DMQ;PVMI M-=Q[X(05C12PRH]JTOB!?:G'X_UII))XKF*XDBC",1LB!.U5QT7;M_"N>$(. MFZCN_0YH4HE[G*_C3CD]R/QKU7P=X;T^XM])TC5H-($VHVCS(HC MF-X059HW\P?*IX!V],#!ZU7TE-)TRQ\%02:%8WLFKRO%=S7 9G*>>8QMP<*< M'KUXK?ZE))-RM_2_S.F.!ERIN5K_ / _S/,"H]3BE/)SG_/^17HFH6.G^!]$ M^VII5KJTMSJ=U:*UZ&=8(X=F%P#]YM_4\X7BKV@Z7HUOX:L=7FM=&B_M"]F$ ML6IR2D1PH5'E1X!(/).\\\BDL))RY.;4(X*4I^S'/#_A'6+ZSTZWUA_[;DL[&ZG9BJP^ M4""1D;L=L]^:Q/A1''-XIF2:00Q-I]VKRE=VQ3 ^6QU..>*ET.6I&$GN9+"V MJPIR=[]C"UGPEK/AZ*.74]/N;..0X5Y%PI/ID<9K+7@'&1[&O3YM%L=)\&VN MGVNJR:Q:>(;Z)%N4A,45KY;X8%220Y#>W%6/&.E>&[.WUVR9M&M9+%PMB+)Y M#=,RR!620L,-E=Q]B.*WG@G=N+T1T3P+U<'96O\ K^1Y03GOQZ'I2 8[_K7J M6IZ#IGB233!H]KIHT.6\@MVN;8.EW;;SC9,&/S$X/S05Z=IESJUT8+2-II@CRE01G:JEF/X!2:?I6DW>N78M;.)IYV!;:#V Y MKT#X>^(+36/&]M*VAV%H(;"_:2.S#1I.OV64@$;CCC(R,'FLW4]1C?PCINO: M?9V^C:B+R6T=[$,BR)L5AE23R,D9[U/L(NGSQE??YI6_S(6'A[/GYK[_ #2M M_F<.\3P2-&X*NA((/4'OFD Q3F=I79W)9V)))/)-)7$_(\[3H=E\'CCXCZ,> M_F-_Z :^MT?/>OD;X0G'Q%T?_KHW_H#5]8QR5^H\*J^$GZGV.3?P7ZF@LG'Z M5,LPQR<_7FL]93@TX3<5]GR(]]^II),&/J<5()..WXUFI,.QYJ:.7^)B=H[4 MG 7,7T?9\QZ]LT&3)R3^=5O.!YSGV]*#*!WK#DUV'SK8L!\#KQ[&E\S_ &C^ M=5?-4\9'YTH8'H?I3A*> 235/S0M3?0N>8#WR*&<2)C<-XZ ]Q7D' M[1_[17A_]FOX<7'BC6U>[G=_L^G:;"<27MP02L8.#@<9)QP/? KYL\/C]L[X MVZ7#XHM?$7ASX4Z;=XN++1KBS2:?RB,J)-\4A7(/\6#[#I6;23L;QO)7;/N= MV"Y&,55N'RAR3BOC?X'_ +5OQ&\-?'./X*_'33;*+Q)?)YFD:_IV$AON"0I4 M#!W $ @ @@@C/->]_M!_'3P_^SO\.KWQ9XD=VAC(AM;.$CS;N9L[8T'OC)/8 M9/;G6#BT8SA)2Y5U.\-*3Q5I&H^'OA;H=XH MFL=+O;<3W#Q9.TN6C9OF',' S2^"_VK?B%\'OB?I_P]^/VEV5JVJ-MTSQ M7IWRVL[$[5#@#&">">-N1E<H_"N.^(W MQ%T;X7^"]4\4:]="VTK3X3+(X&YF[!5'=B< #WKY)\.?$?\ :7_:;@F\0>"9 M-(^%_@R9V73I]2A6>XN4!X?YD;@^NT#KC/6NB34&M-3.--S3=]#[ADF/K5"Y ML[6Z;=-;0RL.[QJ37Q;8_M&?%_\ 9R^)6@>&?CO2BWL_$VFHL7E2 M9 )95500"RY4JIP<@G&*^B/CI7]LWG)\ _ M^/5R/P7_ &B/CUXV^/X\$ZF_AO4]*TJ7_B>WND6Y:&!!D%1+G[^1C !YSZ&F MJL4TN5KY$RH2:;4D[>9][NX89!JN]PP]ZH+J!3Y7Z?RIZRBX.(_F;T[UWJ-C MQIH?)=*>.AJI+("?ZU%/DL<]:IR7#*.&Q71%'+)6"ZD]\5B:A-PW0>]6KK44 M4?O#M]QS7.:M?^:"$8;?YUU01RM&AH+^;/=2@Y" +GW/_P"JM"VB.HZI;6HY M\V55/TSS^E9?AI?+TJ1^[R']./Z5J^'I"NN1R _,BLP]NU>;BYVC.78^@P5. M_)'N;/C'3%CA?RQM^U/6WBC0&*$!!D9YZFO=-0ZFDCG,>7))7CO7Y_7MNS[^A&ZLC86PN-/MT6X &\?+Q6;=:2DDN7 8 MYZ@5H>";R;Q/;ZA&T_GS1JK0QR202?,RG''-92@^7G1 MML['(>(O 2ZP2,$LW ]*O^#-%O?"TBVPE92O19 :[FQV3*,C)'I6AXQA0>&I M[ZPTZYO[S3PKS-!R40]=PST^@XK+VK6C-HP5KEVTUK5([<$E2,>E>6?'/Q%? M:IX%US3+F/,4ULYRO7*C*0,.QX(JZO@WQ1\5[5_[*T:=M M/?Y9+ZYQ% JG@MN;[V!G@9IKFNF@;C9J1^;GB']S)KBRN;_3[GS]+O;>8/%/GD$%L@$ \,.U=&*BZ]/L9X&I]7K:['8>&O#D,FO7D@N[.WDF&1!Y C:-58 M\;L8.1SCZ>E:ZZ%#-K[7$=S%LD'E.]B2L@88^9L@J>.^">!SQ2^,?#VH:1&Y METPRAQM+6WA!::7&0@( 4 !20H]1U-?5OQ@^*5C\-?!WVC4ILW$HV06D1Q),WH/0#N M>@KYH^'/QFT#PIHGB?7=<\-VWBCQ9JL]2UN M+<&%4!PJDYW9VC/3O7MUOA4>I\KATN?G>QX];ZC?!@RP$'Z5I17.L70 5-H^ ME>\>*?VN1R/Q KSC4+J#1"P:V:7:<<5Y4I\C MM(]ZE@ZM:#JPU1R#Z;K,V=TFT?6NL^&NEWT5[=VDUP=LJ>8 3T(Z_H:9:Z\+ MV+='I[J?<5?\/:O>V_B&Q:.SVJ7V'(QU!%;T^:Z//J.FM+NYOZ]X?:&RD M4&@:Q!*PS#,#')[ ]_P.*V_$"7]QI]P&5478>IK@;.\:6*$\*1\I MP>A%?H603]M2J8:3Z'YKQ%#V%>GC(+J>WZG;PBX!#E\QDA4 7TZ?Y[FH+F23 M5]'MVTPLS(6\]7(Q V#M.>X(''T/>L:UU*/5= MFW?Z=:D$LG5@/NG_/>M30 M==TZUL=1M-3VQV][&HEN4Y:!T)VD1CDCOV[U\AG66S=1M*TH_D?JW"F<0A34 M9.\96^3V_+\3$U3Q1K5I-IT5W:6[VRR[2ZQ%MS'EB2#W^GO6-?Q#7=C?Y7.#R 2PC8A)()/F*LIZ%O3&,,.HKXN\O@:O;J?K\JD)KW% MHR[K]K=VNLDPW4$"K&;B)'N&>.8C^X,!@#CH!=UI-)C.UP>5?/<':P/UQS$-K8ZR BL)G$;>:),G@8VD ]1@D8K!^('BZ MS\,:==KI$S2-9*1.F\Q#&,D 8.0<8SVXKH@I/1'!4J1C'FET.V^)/[.^C?%* MQO+Z#5)(9(\^9)#(4"GJ48,,$?YR:X3P-H6M>!?#NL:-;W@6:RC,VAW#72L+ MI"<2088 -U#A<\$_*<\5;^&?Q!O=>\+1W=II\^I6,@>-[*2Y$RI@$['P %K1@<9B8(QR<\H<8[''-;N,HKD/ M+;HU6JT7;2QL>%KWQ3%X7MH?&8L_%.E%,1ZGI7F1ZA:GL)D8#;@<9P.G->H> M!++29K!K[3=:FU&.T!^6Z7$_"DA24P"7'B*TN(C#I%Q;RZTXW3V.H9@ M5T*\-%<(61\CTSGO7H/A'2]:\+2VVJ(T5I'(@,]E/A_M ;[RK*,J>.W!R.@K M"I;XI;G=0U2C3=SU&&SLK_3\7%E>-YN#',)CWT1-M# M !&I!@9?-E5>#D8Y[0E$/0[L'G-1WJVNH[X M19QK=J=Y,8R,^Y'7WK&UOQ+:Z%H]QJ]U%$B0*R209.9'(^4KZ9/'YU]+E&!J M2DI26K>B/@N*,THTX^Q@[BK(TKHIN;AG^]N/"C], M_B*Y'PM82R7$91<@,#T.01Z&LR6\N]>U2[U"Y#&YG?>>.@[ >PX%>A^"M)^U ML@D4@]L5^[T:7]GX2-%;O<_D6K5EG6;3Q,K\J=UZ=#VGP%X1AO+))BNV<\D^ M_K_+\JZQ?"LD+G[/N"OG+@O7]$T(7,0=5 MV,P^=/1O4>U?.2K2I2=V?>2PM/$4U%*S1R>H^$CYM[>&3:YMXE"YY.5 ./RJ M'PW--!97"763"CYBCSU/^ KT[4M$^TV\:,-N0,MCL!7G^OF+3[R-UC("$1@ M\*IZGWYYJ(U_;1Y9"^J+"SYUI_P3 NXI%G:^\S;-&PE0?Q,P.1BO8-8U>'5_ M#-M>P#((6<-GOW'\Z\HO+*:;>3$YSTD -;G@ZXN4TR:P)221&W)"[?*RGJ,] MN>_O7+65[/L>GA):VZ'0:W=FXTL12QET$9..N#[^W6O+)+.&+S$6-)+2;YT9 M,$$5ZI9W=O<[XUC:*X08DMI7^91[>H]Z\U\8Z!<>'9Y9+1/^)7,YE>&,%]G' M)7TQUQWK:A*VAV5(Z(X;QWX9GO\ 2S=V>/MUF=\!<8$@'_+-C]#C/O7F=MJD M5U;!8RWV>4;D!^\NM7NK#3RLC,+FWD *G.%5+*R'H>/Q'X&OI6+QSH=W:&2 M;4+8P,N-R2!L^_'-\\@'/MSD_2LG2+[1[^[>"&\=[.%?.G?=MC5!S@ENN2,<=J^:G MEU?//QQO6G\;_ &6&Z9;= M8E\V-#CYR3C=Z\8KK9?B;XA\;ZE)HG@2R$=I&I$FIS#YFSP64'[H]#@D]<#& M:M>'_P!E^YN)S/JNH7%S,Y\R64?+DGKUR3]2:[ZV)HX>*A?8\ZGA,1B)N=M^ MY[=^RYXOAOO"=M!Y@;R%^RMST>/C^1%?2&F3Q7KK(VQPPVC(SC/7\Z^7O OA M&#P7NTO3AY,"#S,KV?N\:WFAWL8N&$UN2 Z-U7W!KY"=1*JVMKGW=& M$O9*,GJD>H:]\&=%\1P,/LJ*S9.UHUD09] 02/P(KP_XA?LSZ4$ 4P1OG#>2 MLF<>V6P*]NM/C3I=DFQIPCXRRR#&/QKS+XE?&JUD65H)$@'1$[D^I(S^E?>/A_4(X[: M*&/ C10JCT %>EB,3=^QIZ01X5+#+E56IK.7X&OKNH1:+HU[>N0JP1EQZ$XX M'XG%?/>E$23F:9C)*Q+''3)Y-=[\9O$RR6MKHL# M*PFF /\(^Z/Q.3^ KC- M&M=NW.37V628;V=!U9+XOR/A,]Q*J5U2AKR_F6_$FMS6.CPP1MY;7$JJ$3C( M')S71^#-3BCMC*76/:1&K?PL^,G\ *\^UZX-YKZVT/[QH0(N#_$>2!^>*W"4 MMVAMHV/EVR[?D_B<\L?Z5]?&A&I%11^?5<;*E4E.]TM#WK3-7$&FAV)^0J=P MY#*?0]ZN+?6NMSVT,D9G21E0/DEXF/8@=5KSOP9KTLDTUFT(>!K2V*+$JRIB)E4$%@,KS]?YUC7E_="*,F1SR01GH:V)1/)J4MTJG; MN#-!(OW3ZC_&EUS38HXWD&5CCGN=&28*>89D\15UA3V7GV.4\5>)1X>LV6)4>[G!6-6&=N?XO\ "N>\(>); MW1[MYY;L39;SG%TVY6.,'@GJ1@<5S.JZG+K>M/=S$A&;"K_=45=CL9-3NEM+ M-0S-DC/TYK\IJ8J?/>#/ZBR? QP\-87D^GJ>P^$/$=OIGBO1M=GS<(MSN8*J M9CC8%954N"N"K=P>#ZU]$7?Q3^'\MQ+$E_%),$!1_(D+ ;P0LGJ1G.?R:OG3 MP3X$WVEK8W4PD:ZA.U\8>,!\Y'X8'OGVKLO&'PZTC1?#2S_ZB[6/9&%=CYC' M^]ZG ^GL*]AY=+%8?VU3U/2Q.!P]6K&#;4MOD:7Q&\2Z9XO;3!HT\]WI%I"S M3R0,JMYK'#%(VR0,*G49R6ZC&/.+7X'VOC.ZF:TU"*-_O&5U9'4G^\N, \>O MOCI72> -,6PTEHB(A<3 O%#(W(_WFP._%:GA=KW3M2DN-/A0L!ONK2%P9)'' M\*[L #I[UU8>G0C2C&JDUV\STXX2%.BJ5/2U_/\ 0Y[7M/UCP1X:N],DTR:X M-HI(6$"57+' =L#IU)R!]T9KQ33(M1\3ZB]FC+$9<,1)A449X// ])) X_P#U^9^-/@EJ6IZ41X/.GW3" M=K:]\LB*5)E4;@"< KSP?EZ'%+&86,VO9.Z70X>1P5YZ/2_G??78^=&CGL;^ M:V#+-)&S(6A(=6QW!'48K=\-C5CKJ06\#F[V%E4(0Q7&>1W&,U[/X;_9%\3: M39/?:W+:6G))GBNO,$,9'+87!)Z\#T]Z]530_ASX9\'W%HMS&MXDB[-12Z)N M+TF,89R!E<[B/+'H*\>G@VI*53W32*C4II?%?==+''?"='OOMCVZ,@D"_(4* MX=3CCVYZUZM;7+7,+1S##XVL#Q7A/@GXTZ5H'BNRL_LR&UN9FC+J"F020&/' MKCK7O+:1>SSO=PVS+;$<.3@-ZXSUKZC+\1"C)1A*Z>C/Q?BS*8X>K*,5:VL3 M+^*XCM_A/H5NN3Y5](QR<[ _#7CKP;I]OKVGIJ$!N)&92[J0V\XY4CCGIGO7:WW[.7P^2*-[?POI44L! MRCR6B2LOXOD]O6L\5:A5M;0^9PL_;TDWN?BO:Z9>7P;[/;2W&T9)@C9\#U.! M4]KHMW.3MAD.!N.5Q@>O-?M'=?#NVT_0[^*P:"V0V\BA8[8(/N$=%K\N/^$> M>'[;+*0R+9LS''/4#K^-9X=JLW8Z#HG]N:G;:?:L9+NYD6**+^\Q. M ,_6OK;X=_ +Q#\&O"&O77BR*WLY]3DMQ;V\YKPG]EW0 MX?$GQX\)V1A%POVQ&\MCP<'/Z8K]$?VEO"&IW?@NSN!;.D<5QY=F\DSEF M5L<]A1-K(ME!PPB7"D>]?$.SV/TY2LM3J-0B?^P6D\R0"$%L*'AJWC35[?1] M*MFNY[L[4B7J>,DGT4#DGMBOKWX9_L]:%\-[^#5IKDZYK(0&*[D0)%%DV22?0"O1PU&K)%C<90HOFDE*70\^^ W[.%YIVNV^M^*M-MK&QLT#6 M6DJP)>7@B251P-HSA#WZCBOJ:0K-;SP/M>.:-HG5U#A@1C!!R#UZ&J EST.? MK4L;+D&1MJ#EF]!7N0IJ,>1-GR%?$5*\_:3_ . ?"?Q3_9PU5_%&MZUX*\.R MR>'%=V$=LNT"9699DBB.'(5E)& 1AN#Q7@DUT;2Z*NC)*A.Y2NUE([$=C7ZS MZ[JMNZPR%U2!WC"%SP."NP_7.?SKYO\ CY\,="U7Q[IWB8VL'VNTN#'-';P' MS+^8)%Y2OSM(#-GH6.,$X. U@FXI7NSMI9FX.S6@[]F3X:W?A?PU*)(2WB'5 M&66Y &6C!XCC]@JY)']YFKZ8N-+GT?PO/<32I916D3N^#G(4$_KBH/A1X-F\ M)>'(Y-191JMT/-NF/)5CT3Z*,9]3GVK&_:)\6KHWPXN;2&;-QJ#"T3C;P>7_ M /'1C_@5>C1I)2C3@>/7KN?-4DSYFT^-;F=I6)9I&+D^Y/-4?$J1W.O0Q^:J M^3$ 0P/&PO];GGE$]PS/\H!"+@<#GD]!7Z'@Y*,O0 M_.,XBZE/E75C;70HWB!\VV(]&;I^E%=Q:16 BQ%I,,F.OFR2.?T(HKW/K'J? M'/"J_P 2/G:"Y<1A YV?WMW) %9%N3ZUIP'D,M6N[N_N9;O=)>VW MV.4;0%\G(.Q1T4#:N .E1#0#C_D(V'_ ($C_"C^P#_T$=/_ / D?X5G>JE9 M,OFKVM?\3*)]ZZA?B9KZVJP_:('D6/R5NWMHVN%3& HE*[AQQUK,_L _]!'3 M_P#P)'^%']@'_H(Z?_X$C_"E%U(?"[7)A[:G=0TN:.F_$C7-)MK6&WG@!M8S M##.]M&TR1G/R!RN=O/2LH>(K_P#XEA\\9TUBUK\H^0[]_P"/S,I4#,I7:6]N.PXJ+2M7N=%N'GM)?+E>*2%B1G*.NUA^()JU_8!_Z".G_P#@ M2/\ "C^P#_T$=/\ _ D?X5%IW3ZF=JMU+JB&WUZ\MM(N-,2;_0IW25XV4'#K MT93U![$CJ.*TM2\>ZOJMHT%Q+;EGV^9<+;1K-+M(*[Y NYL8'4]A5/\ L _] M!'3_ /P)'^%']@'_ *".G_\ @2/\*:=5*R92==+E3TVW+6K>.M7UBT%O++#" MGF+,YMK=(6ED7H[E0"Q&3R:?JGC_ %?6(/+N)( S.LDDT5M''+*R]"[JH+'W M-4O[ /\ T$=/_P# D?X4?V ?^@CI_P#X$C_"J ?:3#:QHTQ#!@SL!DG*@YSZU3_P"$KU0:^-:%VR:D"#YR#' 7;@CN M,#D=Z3^P#_T$=/\ _ D?X4?V ?\ H(Z?_P"!(_PH M:[BN4DM[9XHI856UMHXE"R*5?Y5 &2&(R:RFU>Z?2DTUI0;-)C<+'MZ.0 3G MZ 5:_L _]!'3_P#P)'^%']@'_H(Z?_X$C_"I;J/=B?MI;F5D49K5_L _]!'3 M_P#P)'^%9L\7V>=XRZ2;3C?&VY3]#6?*UN8.$H[G6?"4X^(6CG_IH?\ T!J^ MK%E&%KY1^$YQ\0=(_P"NC?\ H+5]2JW3FOU'A3_=9_XO\CZW)Y+V+]1^HQ3W M5C/%;79LKAT(CN%0.8SZ@-P?H:Y6/PCXMZ_\+!N?_!5:_P#Q-=6'(I1)7V_* MF>_S,Y(>$/%V2?\ A8%SCO\ \2JU_P#B:E7PGXOVY_X6#:GV9'.SEU\*>+R?\ DH-S_P""JU_^)J9?"/B\#_DH M-R?^X5:__$UT2W(!S5F.Y#@4>S$YM',-X2\7JH/_ L*Y_\ !3:__$T+X1\7 MGG_A8=S_ ."FU_\ B:ZUG+J 6XI4D"Y&:R<$+VS.2/@_Q$O&"3LI^(-SGU_LFU_P#B:[*2ZV GJ/:JESJ.Z9QCC(_E3C3N/VIRO_"+ M>+_^B@7/_@KM?_B:E3PIXOXQ\0;G_P %5K_\371BXR">].BNN>M:ND'M&81\ M(>+\*1\0[DY&?Q[/FW<<^V*S#-M_#FOD3X_P#[57B'QCXSD^#GP+@&L^,Y MLPZIKT9_T;2$R0_SXQO ZGH.@RW SG%0U-(*53W4'P&R7VM:A;'Y8ML@E,1<>F$4@]Y"/6I?VMO*^-G[>_P=^&%XIG\/:=:G M5[NT;E)I/WLC!AZ;(%'_ )O6OH;]F7]FG0/V;_"( MKIH0VHZ %U6SE7[R%& < ^A1FX^E?4]Z#*P8#*MT('Z5\W?MX>,+?P-^S%XV M>YE6.XO[<:;;1N.7EE8+@#O\NX_1#KW MQ#:V^L1:EIGV>]ANE$J3-&S1-N!X))2O6K*&WT^RAM;:)+>WA01Q0QJ%1% P M% '0 "O)?V1/!<_@G]F'P!I5RA@N8]/-U)$V#;(^*?B5J@"6NEVXW+;!N!)*1P/9?Q. *WA*,(1G(*=1U9+HQP\O:Q %=Q/\.-_&-VOB7XF:R-]YJ.2*]=_9V^'G@[X8_#BSTSP=?6FL6TF);K5 MK>99C>SD#=(SJ3GJ,#L,5=\:?!;X>?$#49K_ ,1>#M'U?4)D5'O+FU5IF51@ M#?C=P/>OE3Q!X3B_9#_:6\ R>";JXM_"'C&Y%A>Z"\KR1I(75=PW<\;T()Y& MUAG%8RC.E4=2:33?W%Q<*U-4H-II?>?<\TIZY_\ KU ;MDY!*GU!Q44MYYK% MCQZ"JCR^]>M&!XDVRRUTY.-Y_.H)E=D)W?A4+24V6?*#FMHPLE=#>2ANI'2N>U(C\ZZDM#*3.DT*5ET* GD$L?_'C6SX307&H7 M#+U6/I^-86B$'0K?V##_ ,>-;G@EPFIW7O$/YUX&.7[J9]/@-*D+&QKLC6^G M3GIM0G]*^;_$T+F%!NV[SDU]-:U8R:E8W4,$32,T;#"_2O"/%_AG4(VB62PF M1 P&\BOSK&-IV1^B8.GS13-(VV6//"O[>QZUU'@SX27.I6T<\>85*AMS#)K:UWP2-%TJ:&=O-O).2%P MNT#I@9J\+[1QM-&5=PYKQ.:\/6,B$&4 \_7/O7(?$?Q1JFDV\\&GR2VVTS9*.".G<$< MCKV-8+2IRFK5Z?,CR[]E_P",NA:_>/X8F\)6Z:M\\TDUM8JX5<_>9ADA>@YZ M$C&1T]T\4^('O;2"RTP;)[MS#&5Z(HY)QZ#!_+WKSKX9_#/3O!UUK&H^'%"B MZEWR6^<2Q,N<".0]5/\ =;OWKMX/$;#3SJ5GI+7=^CE9;=V$;[NI ZC/?;W[ M$UZ?*KJ70XV_O,WQ'\)-+5-/U<11OJ-K&4F,RAA=1,,.C<=^<9]37YC?M9:9 MJ7ASXOP7R328M[6*2UD#'S$17<68* M!R,8'/;FOE;]MOP!#JWAXZS961EE6+[.TBGYAR&49]"01]35UK+_ -J+PQHE@XT* MSN=0O=I"M#7P:G)3FSW:.8U(4_9Q,_Q' MK^J?%#6K[6=6NGNKE61$!^ZH.?E4=@/2O7?AQ^RW/XMT.UDO#=V94F2Y.P!6 MSDJJ@C)(';\L=:N?LS_"*X\8^.Y;W4;1%TNSVS3@+A9''W!MZ#KTK[+N;".S MU6WA\A=K0AR,<'EA6\Y)6A3T2.&G%S;G5U;/'/@'^S+X9TC7HM0U6RN=3NQ( M([2PQNC@3<#YDI'5CW&>.>3GC[CO9UM]=TB&(+&L1.Q(QM487& .PQQBLWP1 MIL-EH\,+4[OEBSQ]16=FM6:W6R/43J^V[CA9N"G0]ZX; MQU\)O#WCIFFCTR&SO64LUW%A 3V#+T;OS6SJT[B^0!2!C(-6FU5;"%!@RSG[ MD=:[[D;+0\$/P7TFSEDCGEDC=3@H3M(J:R^&/ANRNXI"?,9'5AEL\YKT_P ? MZ1-?:9%JCQ@7,7RS>6,?(>A_#^M>>1HYN8PI ^8#K[BL:^+IX>RY&V^RN;X? M"SKQSD[W9YEKNN7?A MQ;.^M.2DX#ID@.I!R#CZ5U>D:Q;^*K7[1&\3;4!&]\$-_F<'_Z]<#IT]QH\YD@'F)D>9&.A'^>]?>8W PS*A[;#M*HOQ/R MS 9Q6R#&O#XM-TI=>WF>MFQN[A)K,6%K]@N]JW-AHV5VMQ M;E?(,<_RRQ/U5??OS[U@_$3Q*UU*&O()'O'7RED4@L0OKG_]>*_(\7ELJ9_1^5<2^TA!U*EZ?\RUNNA'J&L'PZHNM.GBU::0;HK! (Y9F/)B"G@M[ M DGL.UP'*#R1+@#IR>0?PKHOA=\<8_#\ZOXAT=K\[@?MMJP2?TW.&X=A_ M?RK'HQ;I7G1PM2E&[C9GLO.:&*J64KP_K4Y7PAK7BKX+:S=7-@%6-76*[MYE M+0RCJH8<%3UPPP1Z]J]3MOB9X?\ B1J+ZC=:HWAZ_;$+6MQ+!Y; C[Y>1,%> MV#SZUV T3PE\5;#5_$.A:UY5W;K@EXU@F4GH)8WQ&ZY],>S#I5SPU\&(I]!M M7O=.TVZN_)+7%Q%:(%;G[_3TQG''7!-14J\ZM-:KSL=>'P=13Y,-4O#=7U1: MTOX.0$=,\;<$=0*X#P[:_\(.RVF@1HT$K9FM 1L8]R%;/Y@5ZWX.U MO2]NITGQ$M_);WL4'V'5(I3E&!0#(YW(<31V@93(95 505Y/T%? M-WQ'\=2^.=9^SVDC+I<+YBC/R^8_0OQ^E3_$7XFW'C24V=BKVNEJ3NR?FG.1 MRWH..!7-:;IOG2(BJS,?[JYK]DRC*OJJ^L5]^B['\N\1\0RS&7U'!ZK[3[_/ ML='X-TMIKGRWDER>,+Z^G->Y> ?#THNHDG"%$ ^^@SFN3^'/A)W=&F!SP 6X M;'^?6OHC0?#$4-HI/).,X[UGC<3S3:;/6RC+_8897W6Y?T;3H+)TAA@CD/!) M'&*]2\-0JP3Y,$=]V1^=>A_++#RX(P!D%:\F\8/':"0*!#CN$!/YFN]U M+7&:'R"0KR O%CG..1^8S^5>4>)_$?VF*2/8MW@?-;L<'W*GJ*,'0J-ZBQ^* MI*.]C'MM9CU6U(:69Y8CL;S#Q[' -);:X-)NHYU7YX^64K@%>X_*N?LM-DMK MM=2M798)@0;.Y8!V [J>C8_"K^I(=CY!!8$\CVKTZM&#=HL\O"XFHES21ZH^ MEP:]96VH6CJQ=1)'*F-Z?Y]*@NK1;VVEM;N-1=*IW;. _;(_P[5YKX%UR"PU M)+*[NI;-)F_=72-Q"_8$="IKT74%N=)E7^U9!Y&1Y5\F?W;=,.#R%/OG'(S7 MES4J,[,^EHSA7A='S]XM\.7-O>ZKIJ@P%#]HLI$'W&'+I]&!R/QK@$\66,RQ M1WD3B9EVJT9!5OP. *^FOB+X=34+,7<81;V%=VX'*D?7^5?'NM7JV4U_:RQ M20RD+G P.O\ 6J]JFKHZ8P.?\1?8H+F>ZTZW4*')DM]H'))R5%>8>*_%NEW= MK/:!9X92NT@*4(_*I?%GB.>ZU66UTV=D525EE4\$^E<=J5D\4J.[-+),/M*ND?+&3 M@UT-YIHC:26,8W\$#UJ"73Q;V+$K@\#\:\Z7,WJ?64.BY?_ .M7T+J5F;=C$B+AN!GK7@_[%=TEC\0+_3YFP+W3F" ] MWC8'^3-^5?4OBKPY*9MT8SM[GUS7SF,I6J420[O(NXSF M-R,@^Q]0?TKSJE.Y<)):'GNNZD8&9(0LPV_<<\_2O(_$NNSWEV8L) !P$7JW MMQ7K'BN:YWB.72I'FW$%H?F!_$$?K7/Z1\.=3O+[SK?34@D<\,?WC_E_]>LH M45%W-)U?=LCSFT\-SW,BSW,AAC[M)Q@?[(]?>NK\/>&;7Q%>O:10.JQ81(BN M6;(R2?4FO;?#'[/FH0Z=<7["VN]9((@BOWR%/; &0I]_UKT/X _LU:UX?N=4 MUCQ,(H+ZYNFDAB#B5@@ 8XX!/7'8$5V13=['F5)QBO>U/ +?X5R? V*'4+2 M-IQJ$H1K=1F2)L9"H.Z]R.O->T:-'XCM_#C:Q>Z>VF6,<>]I+X^62.PV\MD\ M #'>O<=[GUK4I;RY):60Y^GM6Z;M= M%TF6[?ET'R*?[QZ"LG2+;YL)]2O=;U(65C%(]O;$C@O=A'9'X_C<6X1=22NW]Y;\.Q-"\U\YW2 _(Q[R-T/X#G\JZRPCBC"%M^3 MSD8YK$TG3Y$"03SV\4<(^9FE#;G_ (C@9/M^%=% VEI*IEU"691_#;6QQ]-S M$?RKV802/B:M5II/2W=G3Z!)'9SB7SY$C21'(,>1P #T/M6_8:-;1ZTT(G1R M)3M#*PXSP>GI6!IWBC0U9XX=/FG(Q\US<;5''HH_K7X -?)JC.6)2?<_0/K%*&#E)=CYR^,GB$>']%5E +3RB([UR-O4\? M05X'JWQ070;*-3;QRF:<*-X((&.H(_SS7J/QP:?4KC3;9&)7]X_'KP,5X%XK M\"ZMKD]H$A2*"!=\GF3QH^"< A68'''7&*\G.<5B(UY1I7T2_(^UX,P4*D:3 M>JE)O[GH2:KK/@K666:>UFT?49 08BN]&)[@CI^.*Z?PQX7\)/=Z6MR%C2+S M!(T )+$+D,,9Z\?G7FUMX2TZSUA5U&\2WC1V9Y /- 4#C.#S7<^!=7T70]=B M;1GGU-?,;(:,XR>RJ>H P,9_QKYRA54JB=:$4[J_3\#^@:5)N;@WLG;[NYZ9 M:+I.E^,+C3[2YF(?W "XPI/7/+<^IJAJSPZA>2V5['+?75E;&2,C M**ZD@GYONDG'2N6O6;Q!XIM;RVL;I)ED$T\2 M7HM]/F,> J/$^5P-O?IGU_\ UU;\-:+?>&=3G@=N_?BOAW MB*TZCE<]2-!64I;G>-/I?C73+"/6E":G Y9;BW7_ %9SC:&8$,,#\.:Z#P#= M6,OB63PIH,EUFUC:]N9FB$KR)O4;">,CYT"D$]6XP>'61(X&U)_)Z)# M;(%RQZY [GCTZUZ!\.;:P\ ZXFKV\C-<);>1>XXKZO\0_&[ M2-%758HM35]1@02V\?DQO&TFT;26? ^]DX&<< 9KY7N+?Q)XEUR;Q!?6WV^> M5WGEN( I.<\DA?3FOF5/%2D_;?F>-EL:]*\9:+S.B^$_@D>(O&OAZVU73R]C M%>(&;.[/)."W0DL ,5]S7=E=-S?HHNMOSB([E4CJN0!G'3Z5\;>&/&UGH]LP MN+1U[Y/\O2O0_A-^TCXG\2ZA>6NII#+&TF(#*@+(., D$!N_ M.,].M>Y@:L8/=GS'&."J8F$,33U45;:S/H+X4ZVVE:_?:%*=HE\M(I @PZ@DL>M?#]SJ]W'K*W_F[+T,LF]1C#8R.![8%?9/PB\: M6_CCP=:W,,B+<0_N;F#/,3_X$'(K[#'TN>C"LO(_#<%+V6(J4);JYG>/O#_B MB+P]=#PTNG3ZFQP(K]F"-&0=P!7HV.F>*_,#Q]X>UWX=7'B+0?$&ER:??-I[ M26S3G*N@89VD#G K]:O%GBC2/"6EM>:S?K:P<[?D+NY'95 )8_05^7O[7WQU MD^+_ ,0(TBTN72]-T>WDMK078 GG#L"\C8Z [0 O.!G// \W"W4FDM#U*Z36 MY\Z? KQ5J_PV^*6C^(M.:T>XLY@X6X!9".>H!![U^E&E?M+VWQ9\.WN@WE@F MF7\D0F:5)E: JI&3SA@.>N"!W(K\Z?#?@:]-W#=RJ;>-V'EKM+22G_903R1N) .*XLSE&%.UM7H> MAED'.K?MJ;'C31M+BU&:"*\M6>-BKI!.KMN], UYWK&C7D,#VKY)86"DK31]^\7+EOR,_1[]BJ/PCH6J+EVL?'8V,H3YWLQ^E)X?UHS)'#<121$JP$G (_$X^AYKFOB/?Q>& MO#[Q1G:L[[5YRS>G-7Y?&.DWFY9)UM+ACAHI.,D<<,.#7D?Q/\31:CK-C8I= MB6&!]S-NR![5WP@UI(\V]Y:&[+JC+IL0F598G0':PR,CH2/:MWX9?#N76-?F M\7ZYM>/SVETNWW%@H(P9V!&-YQA0,@#GJ>.4\$QK\0O$4EK;NLD%DH>2,,0- MN<*"0. 2#VSP:]VBCO+&W2-KR *J@*D-L%10!P!\Q-;.7*B&KLT+F=8^BCT& M!7QY^T!XX/C/Q\+*VD\RPTD&%2#PTIQYA_ X'X5[/\:_B?)X*\.M#!/&^KWN M8K=%7!3UD(]!_/%?+^@Z/-._F,&8DY+,7CZEH^SB:% MQ#Y 0."WQFYN)#O8%]FS///O[=N**XG+78Y##D]ZL)I$LG21!7\]XCA[-)5IRC0=FW^9\'4P6( MS7_GPP^HXG^1G/8HQ73KX"O&Q_I$ M/Z_X5(/AW>G_ )>H/_'O\*7^K^:?\^)!]1Q/\C.4Q1BNPC^&.HOS]IM\>IW? MX5)_PJS4,?\ 'W;?^/?X4O[ S/\ Y\L/J.)_D9Q>*,5V7_"K=1_Y^[?\=W^% M.;X6:BN/],MR" <@-_A1_8.9_P#/EA]1Q/\ (SB\48KLC\+]0_Y^[?\ \>_P MI/\ A6%^/^7NW_\ 'O\ "E_8.9?\^6/ZAB?Y&<=BC%=C_P *RO\ _GZM_P#Q M[_"M33O@CJNIPB2'4++']TE@1^E)Y%F2_P"7+(>#Q"5W!GG6*,5ZB/V?=;/_ M "_V0S[M_A39/@%K49Q]NLC^+?X4O[#S+_GRR/JM;^4\PQ1BO1+KX):M:1,\ ME]: #TW?X517X4:BQ_X_+;\=W^%5_8.9?\^6:+!8A[1.)Q17<#X2ZDQP+RV_ M\>_PJ9?@[J;]+VU_\>_PI?V%F7_/EC^HXC^1F7\+CL\=Z6?]MO\ T$U].QW MSUKQ#PA\,-0T'Q%9W\UU;R1PL253=D\$>GO7K$=U[U^D<-8*OA,+.&(@XMOK M\CZ#+Z?NI_>J\T(B7.XG\*^KY;;'J.JB1IL M?+S2F3C^E5'('.\_B*H7&H>6"2>:M1;%SW9MR1!D/S8;''I66UUM8@GD5FR: M\X3 '/0'-4UNRYR3DFK]G87,]3H([C/>M"TG"]:YF&[(8>Z))ZTB:CY)Y.<]JE4CG>G4Z$S9%9]^?(N2PX4U$FI M1OT;FGW$ZRHP;H>E4H&:J\K".X]Z<+@!CS64TQB8C/2F1WNY^35INI MWC&T!$)8;=VYLMR<#C&:\)^ VO?&_P#9Y\(KHOAO]FDR7$A# MWNIW&IJ;B\D[N[?R X%?H$9BQP.33A-Z]:Y)8>\N;F.J&(M'V?*G]Y\O^$/V MCOVB]7\4Z/9:S\ ?[(TFYNXHKO4/[2#?9HF8FXNW'0R#OGH2V M#C( Y)K[6GDV,><$?C57[3P8P)ZJ-F>0_M.^(_B#X8^%5P MOPLT+^UO$L[I:QK&JG[+$5.Z102 2, #/3/3BOB;X':9\;/@JVI:BOP'NO$G MBK4Y'DO/$&IZBIN'W')5>NU<\GDDD]:_2N?!R6_*JKRA1C]2*WE0YY*7,U8R MAB5"+CRWN?&DG[0O[12OA_@&5^NI UW'[0GP\\;?$KPIH6H^#O$,_AKQ/I,R M7T5FTI6UGDV\I(0#R,D#.0>01SD>^:BC7#?*I/OCK6'D?$CXDZ=%X;TG0@?['T!9-T@DSD.X_')S@D@< 5]22# R>: MIR,02<_G6RPW-;FFVETT)EBDKN$4FR\;KC'>F&?CK6>T[ $$\ <FH MH\F1>:7<,$]#4+SG:*J_:1NY&?84GVHA "%QG(/>M5 Y'*P^;)QDYSZ5BZF0 MK/CHHKK]"M]-O5G-Y=&W*H2F%X+5R>L&-6<*P*_WCP33CJ[&,KK4VO#DOF:( M%ZE'8?K74?#JP34_%/V1G">9 ^#[@@UPO@ZZW0W=OG[K!Q]#Q_2NK\':@-*\ M;Z3,6 0S+$QZ8#97^HKQL;2;A.)]'@*EG"2/H+1-$MM$@D&T2/(Q^AT)*3Y6[&EIMU M!!"D-NJCL,#I7Q;\9_B:E]^T=XQT*=V6'3GMH+=T;#1.($8D<]"7.17V!X50Y_(UZK\%_&NJ_$/X=7FI:MILFFW M N+E8$DC">9 K_NV !.>%P>G(Z5\8P^/[?6A;6,'="OKB.>=+4QR2(Y8,SEVSD@9R&';K6,(055WW9LZDI4U&VQ MN^ KM[3Q)-:L\F>B:5K^G^($>;R#9RS?NF=FS MSUP2.H]SS]:R/&O@VW\2>']3T2_4I#=P-$Q[KN! 8?3J#ZBLWPA*J6]PC1[NY>.9%46\DQ,41'5D'\)/&?I19RCHQMQ3NS\C-;U^Z\,:K MK'AZ_E U&PN)+:X20[6WHV-V#V8W"_,DD[#Y@&'4#&![ 5U0TF#6=8LXXVWR MP961EY4#CY<^H.?SKHM-\22Z1IC)(^Z%AEI;LC:Q[X!Z5K>'+&TNU34[*")+ M>7@M N$+#J1[&N>%1-V>YUSIN,;K8Z""(66GJH 48KE;2$S:Y)/G 3))]JZ M6_GS9/[\"N7OICI^BWER!EWQ&HSU)(']:V9RG3:5K)O[.))P3(A8[F_N]15V M">%'6:,&61NY[5R]O,1HEP\8$+E1&CMVR0,_EG\JTM(NW-NJDYP %!')HN!U M_DI-ED/ID5Y);6K0:TMJX^>.;8>/0\_P J]1L+J"WQ;F;-R?F( MJ"YN]$TK6M]\(XIY$,P+=_X2?SKHI-)NYC43MH9<@=N@(/TKYE\82E_&NJ)U MQ-@Y]0!7U?=_$+PU:1L_GQG:,\5\B7M]_;/B74;XC N;F24?BQ-?297%.KD]+T>">12P$$@/*@\'Z?X5U7C M6)+BXM+0*WGI&95&1@^OZ"DT/0GO)T!BN>\0Z1J5Y$\45RLBN29(+X>9%)^."5_6O9;7P MJUS$?,4JQY&[JOM535/!M366'Q6E9:]RZ,,9@5S4'[O;I]Q\Z M3>'K:Z:IXJ#B^Z_P CE? D4/A3Q):311RK!-(L%U9,_2OH M?2+Z'0GN;O2TCMX7(5H!"%51P,!>W '->:+H*S6MM(T<=RT+93S,EASG&<]* MGO\ Q;JUN!$;:W0)G@ YP3T//2O'EP[6J2]Z"/J:?&=#!TM:LN5GM%S#;3ZA M');RQR+L63RD&QVQR"/7/O\ E5QKRT2);TL]NL)PY9U4*<>_7BO!CXVUV9E$ M4D=FJJ%46\?7ZDYJ272]0U4K<7T\ESSD^8Y8?K7?1X=E3?OM1]#SZO&M+$_P M(RF_[SL>J>(OBSI<4(ATI&OIL1N >YST KU)?$,5C!''&K2;@1YG7N1D?EUK2C\&^ M%K*6Q%Y?[%? CA67Y7QCGCI^-3^*F\)Z1HI@M(3)?/\ -;O'NP1N.?F.?>OF M_:0KU5[C^X^ODJN$H2.I^O2II?$- MUI(U-F)AMH8Q!$),MRQX^IP#TJKX.\60^'YHEFM@PG.X+UV>M0_$#64O[2WD M$:+#(?/=P^-N3A3CN," &))P-I!(7('3Z?UJSX?\ $5Q<32:?J#+-DG8Q M&"/4>WMVK!F65Y-\+'>.,*,[JHW$%Q-.LP4V\BG[[N%/UYQ2GA8R35AX7,IP MDFV[^IW&HZ/'+N\H\CG:W4?XUJ:5\0[W2-,73;NT?56Y1%FN!&I7^ZV_C\3B MH/ VHV^MV_DW4L9O4X+KT?\ IGZ55\86$<$F059ATW<8^E?*UHMS]E-:GZAA M*B5)5X/1D&H>-QI4QMCH^I:9:.A+65\PFAP.HC<9R,<[?BUI<5[ M>W6DP.8;M@/LEVA!/EL,C/\ > ''X5[[9^.;NUMC::@YN8MICC>4[@HP/O < ML/\ )KQ'Q;:-;^.1$6CDA2$^4\1^4J! M7O@F^\(1XO(2FW+: M<"W+.Q)^N:J7T0EU*WMARL(#N/<]J] U?X?ZQH$8$MH;F.-&DWVYWCZXZ_I7 M"Z?930L\]U&\4\I+%7!4CT'-7)J6B.Z3C*RB=7\,?%[>!O&VAZX@/^A7 >1! MU9,X#7%B:7/'F70\W&T7)*K#=?B MCZ,OK:*7>FT,.>1_.N7UBP6;Y@_SQ\@GN/0UTDL!O[G;;9GW@%?+.X'/?Z5M M:+\-;B=DDNT:5CSL(P@KPFFU:QY3J*.[/+]%\$'7]0$]PICMU/)'!;V%>L:) MX0L[>-8;*R0=,X')^IKK+/P5!;!3(W 'W$&!6O';Q6:A(E"J/2E&GU..KB5+ M1%SPYH%KIJ+B%/,'.<"NCGLQ)$<-LXUZUT>W:]O+A+6TA4L\LIPH M'UKY\^+7[1EWXJCFTGPVTEIIARDMYRLDX]%[JOZ_2O1PF!JXN5J2TZL\3&XZ M&$C>K+7HCBOC%K6J:MXFN+&\\06^LQP2$-'IRLMLISP,DY=AW[#GKUKF+/3I M(E5VBPK#Y<]Z73X 1N9N>.O[J'K^+>@K]%P6!CA MHJE17JS\ZQV8/$2=:N[=D9_BKQ5-HUE]DL>+RX(0NHP(@>_UJ7P9>PVNEW$4 ML7F3 Y6Y^OIUX]J\SANVU.[,LRO-=RR;F?>1\QXZ=*]P\ ?#JY\2V7^C M8%O;$G<1R[<;OY 9KZ9TJ=&"4V?!3Q-?$U?W*N8]I;?9%5"V 1T[DGFMW3;: M>T82SPLMJXX++S^55]2LSIE[MGP9PQW(.F0>F>]:\FLR7%ES#Y>YNQSP*]-) MN*Y=CY&K&,924]&C/M$5-6DD0;ES\K2?PBN[M]3N;NTMK/3$9KLR[5D''+#J M/0<'GTKC=-C6XNA&N9'; 5,4/>-?ZG M\!4XAVLDKLWPEDFV]"4ZD^C::FGV<_G10G]_<9YGE]O]D=!],UB>.->8Z,[% MCMAD5.G?%4['4DN;CS% $$9W%?[S 5SGC"_-UX>U)@<$31/P>Q)KDCAH^UC= M=3OJYA+ZK4Y9=';[CS/QW=W%T;.XC<1[U8C&"QP17@OQ1N9Y-3MUWLB-".,X MY!.>?Z5[/KLQ>"$-QM8_-Z UP?B/PW<>)+W3Q:V?VQE9HW3U7KG'7UK\JXHI MSAC*L%?6SMY']&>&6(AC,%AI)VOS)OSN>:6WAO6M2M%=8KJ:"8C+*I*E1WST M_"N[\#^'SITR0&.4F=MNV/YI/0%?0YQZCZU*FOW\$RZ3H5D\UU$0A2*/"[0Q M^\>_IVYS5/Q'_P )+I%P#>6_V>YAD\PHA!0-]0<@CVKY!5*-"2:=V?T#&M2P M]=IR3LCUO3+BZ\/S6MG?:@ M@0^3':GR1>DX5FX8@$'T_'-9NF2_\+#T6.Y&K2Q:Q(Q62VP&4[4)^8YZGU/J M.]=/JUC"#U//I7!-+J%Q*S6LG^AQG:I<9!Q MTP1ZC^==M;01:8D=A<6*ZC#=/N9E8'G&2_2_OHM(MG@TN C8D M,<>7R!CK@\?[7>OGZN&UYX/5O8]6$?;6NM#A]"\0C2M022>.9U1@0X/R@]AR M1SFM>\\F[U1KF&YDFBED,\D84@+&0._3U.?2NFT#X;W7B/7[;0]*L4U"1(OM M+3,0JQKT=W;&%&,C)_#->Z^&?V?_ O:VD+^(HI+WST51# YB@52!\F1AG/O MD [AQQFJ4/8P<6[?YF%7,J. 7+4ES2[+5KU/CK4-)\/>*;^6?^UFAGED5&CA M4.=H X)' ]JW[7X)3026.=(?V"_''P"N8;BVOWU?PMD0VU^ M-\?\05\$E#UZ':<>O XXRISDVW]Q\S2QD)R;]G#Q%;(98-5L'MX M]S.&F:$D;1MXVD<]3DCZU;\.^ W\+Z5)]KDF$S,K*N2@C XR"<$\UCZ=\:M> MN($^SZC'YCH$DCN8Q(3Z\$C)&0*O0^/]:\1Z?%+J!PQ!*%E"NP' )QP>YKTL M'.E&HVM6DSCXB4:> <9/XFK?F>H>&==_MZ/]_(K7T8'F@'EO]OZ&N\^'7Q#U M#X9^,AJ%KF6REVQW=L3Q+'QG_@0Y(/\ C7S#I>O7>E>($O[=_P!\F%8'HX[J M1Z5[KX_M%>#=,\ M-#5K^^:VD/R_8#&6G+XSM ''XG ]Z^2Q&%JT'>+T/LZ&(A77O;HS_AK\!/"_ MPAVMI=D]W=A=C:C?D37#CCJY''3H !7F_P"V#\*-%\::)9:K=1SI?W&IVZSN M+A_*D15;@Q;MF< #.,UW6E_M:_#W4-#FO+B\N=.NHEW'3IX&:23G^ J"K?F* M\RUWXY6'QWU@:#8Z5/INGZ?*EVL\[@RS-RH!0<*.3W->#B8MPDV>WA+*O#L> M;V/@RTT2U5;>%(MR\$+S]0^-/ VLW=P76U+Q+]T!UX_6OCXPE[2]C]!52+IM7/!1>W-KUW6M7CU:ZLFBL+*3='YK*#-*.F.<[5SG/*%4U!U,L^G]7C;D M,T8_BC)!(QR,X('6N5GN[S6[EA;P-;1%L&0J=Q/HJ]2:YOP-X6TWP:T$\0-T MTK,(YI&YAESQ@#H" .#_ '1ZU]*?![PGJWCN^M]?U2V2&QT^97@NE50UTZL< M@'<"H4K@\$'MWKT)61YT6[79ZI\&? -M\-?!,$!B":E>XNKV1N9"[+PA/^R. M,>N:?\0?B!8^#=*DO;R0,W(B@4_-*WH*S?B9\9M*\#(UM/&ESJCC]U9Q2[G^ MKG'RC]:^:=8UG4_'FM&^U*0R.^52)>%B!Z!1Z55#"RK/FGI$RJUXT]%N4-3U MB_\ &WB2;4[]]\LIP(Q]V)1T51Z <>_-:^I7T6G::L$2XNY5VKM'*#NQJOLA MT*-&*[YGR(XQWP#S]!6?HD4M3H[ M21GMT*VT,BD AN1GZX/6BJL-K]@C\MKIU;T1<@?C14NG&^YK"H^571\"0.*U M;;M61;CFMBV;IFO5Y;'U;F;=FPP!6M;,!BL2W< "M.VE'&:+&;EPK,ZM+E$7+,%^IIZZH.B?F:Y5+HLN=AO@3AS\H_B]*E:X:(C=T(R&!X(]J=A:G0&[ MSZ5--<@06K9ZJ5_)O_KBN=6^W]/YU9>D-U%, M^V$N #DGI6/-]P<9.![U< MTK7I=.G#QMD9Y4]ZYA9P""3@5,EQD\*.5DMLZ!+H,.,"K MNGQ_:YPN,*.37,1W@SP:Z7PU,7C<]3FLI0MJ<]25HG3H0B *, 5#<3<>]0O< M8&*HW5[M'WJPC'4X5+F)+F[PIR:Y[4;_ "V >*==ZAPV3WKGKR[#RGFNF-/4 M[H;&C]J/E8DFI8'7-0'5!SDXJU38^9,W5U$QOD-TJTVM%R! MN'45QT^K(@/.2:KG6R9W.QN=3$LC!6SZTR.^([URL%^6));)JT M+W& #2Y"UH=7'?YP"3BM*#5@B, PZ5QL5W\NJ!D\HGY0 M=WW1G/UZTKW?+'M7,66H;9!D]:TVN,@\UGR"ND[FY;W8(L7*JNXMQ7+17 M10Y#&I)]381,&?V%2Z=S)WOH:,EX)7;GO3&$@7>J\5BK>C/6KT&HJ4"-\PI\ MAHY66A+)1F3_5@_6N[U;4)M6G+2$B M4=03U%8Z6R>:2QV'! P >:WA)J*YMSGJRBI/EV.7O=(FA!8#<5G3P/& M>."O((]:]*LM#N)(Q,B>8%&6[@CTK!U/25B!$B!6R3@')K>%2+>YR2G*/Q(X M@R21DD C/7-,:0\8&.Q/K72-HRSR1A5*C'S#&:2;03L^;!*#"\=J[541QSK+ MHAJ[HYO:WZF5X$;'"SJ5QC\1_*NHNT=&26,8*D'/H17*K97$%TL MH ^5_, ZG\Z]5TWP]_:ME]H&0CJ& /ZUYN-<8/F>S/=RV;J)PCN>G:1XFAU' M2+2Y:8*9(E9EST..?US61XCUNS5[<^>&>1UA4 ]6)PH_$G%>/ZK!76_"#PY/X@O)]$D8#'^R,5^0?[57P?U+X?_ !B\1PWEMJ"6,EV9[74V MA9H[B)P''S\ L-VT\YR#7ZXZ6'66$,/G4R _6LGQ'#;ZNTUMHKK-+N3);2V^\H)%*[EZBN5AT>\T.2%;E M-IE3<,5LZ=-@U49..XW=ZHT=/DU+0X)+>5S?6A&Q[5EZUJ$,,OE6]O\ MVT.SL.1[$]ZV6NI2J[5+1YVL1GCCK[UFZA:*ETT14H[J)0".0#D '\JXZN'Y M8\T'H=]'%*<_?CJ8NIZ5'K]G#YV#)&>@Z@?2NM\-7%P1#$+AFB1=NTD=,=,5 MBV< #8''/4D9/X"NH\)6]LFMPQS+O\X,OOG'_P!:N2I!*2;.AU+Q:Z$^J<0A M5XYP17,>)G AL+7.=TF\_@.*Z[Q?IDFB03WC'S+%!ODE YC'JP]/?I7G.H:B MM_XFMH4.X*H48YY/-;NR.#2QU-RDZV%K'$@;)\UW;[HP,#/YU8TR6Y:X1;=! M+)W(' JII.KVVN7EQ%&+.]MK:0PEDN65U9>&!! &)"D)WD_,7!! []:[6ZT**71;F"6)=C1%<$>V?\ #\JV46UJ1*21 M\7ZK:W%AILLDR"-6^0%L]35/1%QM!"LHZ<\UV_QFN[:?68-*M70+:#?-C^^> MWX#'_?5<-=:A%H>D7%U(Q4A=J87(W'@5]ME>&]E1UW9\9F>(4ZE[Z1*=K;OJ M_B2>Z5\QI($4JH' X->F:3X76>':X]Z-9 MQR6&YP3QP%.":].M4E!J-CS<-3I58.1S5GI\&GM(V6E .!VW'T'L.]7;N -; MHQP^XE3CZ=#^=4M>EAO[Z&-3<0;.&:)01M')!!P<5#->"TT:SG2["J9Y6S(I M7<1MP.]=JPW/%/J>+/,?J[E%?"C@/&^CF.0?(3%(/E?[K>XSZBN/NO#\5Q,6 MMV>>!%!?S0&8'OVZ5ZIJUS+X@NF6X\MXKKEGC*DQN/XQCGCCC'(-8)\/?V%J M<4%W(KGY6<1YQM/N?4?SKVH1G3I\B?O=#Y+%5J=6LY3BG"ZU.$U+P]+I4<$D M\+1B;]Y'MX./I5=?"@UN8"(%^-K%AT_+O7J'CG7-+UF^CCLH2]M:1^6KL=H; M.,D#]*K>%)HM/N#)<11PQ%E48RQ+'H,^N.:Q4L0J'.TU(Z?]AEB/8W4H'G=Q MX NK!E A15R3NV_=_/VJ]"B0VA5H)"@8(7 Y^OZ&O4?&%[:W43I!&DS+]]?0 M>H_,9^M<+?/$MO)%L>,;U'[MN.C=B*5*%;$13J'17Q&%R^H_J]K6.-DLVBNY M?W2LK*65BO4=C5\V'V2%90G)Z$'@>N:O>3%/')'YFU1RKDU##K334^3Q&.YWS7([.46QV1'&3G>>J_2N@L]4RL:#*A>-U2 % QM48P<^IZUH6DI2)U4X9AAL^E=RH1>Z/#J8FUL07 M-S?%-PLXF=0<\R-\B?JV?PJ#3_$9:[(BD6W0 AB 5 [Y_I45**<].B_$]'" M5)Q@DWNSV.[\ 7MEH0U15!B:,*"W''0DGZ5Q$&I1:5?Q2*1(JMB5FQ\ZGA@! M],BM-OBW>WOA5;*6\$<(8HH!)D(P,$>IP>:\]U769=Y#[9#V)4XT^VF<;)(!Y+_P"YU0_AR/PJC-JR?8MF]Q<,V&Q]T)CI^)_E7HND MY12/FE4]E5*Y:F"A/5K4]O!YM6 MI*W3L>NZO"!*-J>I.>G6N:O-&@NYUEE4>8GRJ_H/\*Y33/'UUH\,4%W_ *9" MB@*A;YPN.S'] :[;2]>TO7;9WLY5E9E'RMPZ?5?>O#Q&#:3C4C='WF!S2$I* M=&7+,YK4+"6)'C4;T*.N1]#3;:%7U"&-F$:X +-T'N:Z>>T^9<@Y]ZHW>F@ ME5R2",U\MB,IC+6G*Q^B8/BBI"T<3&_FCT_3?V85U>[2ZG\56D^G3JK$6J\E M.H )./QQ7H4?P(\"16P66RM;U%[2MYF3_4U\KQ6&JZ7"\>FZWJ%A$>=D,YVC M\*](^&_Q*TKP9II@N(-3N[N0[IKN>X$S,3UV@XVCV KPZF7XN#?NW]#V8YWA MJNL:C7KH>NGX4>!K1"(_"VCH6_@6RC+-]3BLMO@/X)U"?SY_"FE+M.57[(@_ M/BJEK\>_"40W/'?!SU_< D?CNJ>3]H[PE&IV1Z@[?W3 !^NZN66%Q3V@S99E M1W=4],TK2;+1K6."TMH;:!%"I'"@4*!["M!;G=PJD_2O"[[]IW3HTQ9Z+=SD M=#+(L8/Y;JY75OVE/$]UE=-MK33 01N"F5Q^+ MNZUXL8RZQJES?R$\+*_R#Z*.!^54X-+PPP#M SR>*]K#9%"+4J[N>!B,]FTX MT58V->\6:[\0+U)-6NF,0.8[=/EB3Z+_ %ZU))X?6S" 8?([=JDL+&WA"F:4 M1D]BX8YD9N@'MZ#VK4>!D, MBLIW-TY_7WJN]H]N=XRH/<5]90PT::/SO%8RIB)N^QK:'.;:9,R;".!M SD_ MX=:]B\&>,I]"M[B'3[L%#"S.TK;LMQG'L/UKQBS^Q1V&YY&^U<@**U+&9[9- M^[:7&W![9]:ZYX>%56FKG)[:I1:E3E9GI=UK+7-W',MP\D;/^\#-G#'Z]O2I M[NZDN9E;>.G(7 'X5PBW/V>7$T M$F+IV+ !E5CG /2L&;5[G423+*TS9)PQX)[FF0,;V5HVEVL%W'.23CH*4*=G MS-:F,IR^%/0UH+EH(VR^TMDDYX.:;=7J3>&]4BZY:+G\36;=WA;;&%VLO'UJ M.X@N+?0[TR(R&1HL ]>IK*JE=/L=>'IN:<'U31QFK$W4#(.#CBLO5;Z72]!^ MQVLKQ:A(KM=5/&P'&3^8^]6C=6URI;]Q( >A8%0?Q-<_>12)=B25O-<$ M-G>&Q[5\3Q7A%*,<9'T;/TSPXS*>"G4RZ>C3YHKNUNOU/IM?A%8_ 7X8:+%+ M"AUVXB5KB<@,SS.@+9(_A3<% ]LUX5XLT5[Z:5W!8[B6X[Y.?K7V1+K.E?&; MP#8W<;2Z@D"E4\I-TD&=O!&,\$8/U4]*\+\>^#]=L/%UMHNDVSQP3HLJR1PB M:1]L@#$C! RQ!SP",'@*V/PC,L/4A5<$].GF?TME.84JE+VT]9R>OD?,]A_: MG@S4I+W3HA(0=Q!7@8R,Y[ @D9K2M_B!=ZF+N[AM[C35$R-=11SM^^ M.J'C@# ]*]=^,&E-\*]$N+O48[8"I*K-..J/0O#/B MG1SJMP-3U"+3KN<^8XE56,X4$ J #D\#C ![5)#J5A:ZYR0H4^9@X 9N@[]AFK_ ,%4BO\ Q1Y&H(L\ M=PWEJEPA96DQGKTR .E>G#%RJ-7CJ>Y#&U=[ M\ =#M[CX!:79V*!9M-OKB$KC (:1F[XSE7'/_P"L0.F:W9 M]-3QAX6O=+U"$2VNH1>1)$023G[KKUY&,CWQ6E:^#9;2XE\X#R"F^&_%U_H=PNV^LKEK=MR]2K8W8/;'->M:??62Z0UOJ2_/;1DPR M 8);KAAW'^>:[C]HCP!>>'_C)JNJWTT5V?LMN%V8!1M@5E)&8^ M(YA+Y #8DD +J!R%Y'/UQ7Z[D&#J8FK3C;66_H?C_%N?TL/@I5%+W8*Z\Y=+ M#+"%KZX:2&+;&?5>/QKVKX::&;!8[F A)2/GR-Z) 998XAN()^[G M@5[CX*8V5OA&S&J''OQUK]CQT&HQI4]D?S/D-2,9SQ59:R.^46U[)L10ER1D MH<'/^[6;JN@+<'US MSUS6Q\(=+.BZM=O=@0-)L52SC! )X' ]?>NO%U8:PRB"50S?\LW&UA^!HU'P MZ WW<8]OUKP\9E<*T>3X6?48#-Y4Y*2M)'H,THNH,KEE(ZCD#\JYB]B*DI+' MD ]<=:XZ;3[VPD46MY,@/:.0C%1/<:R"P-_,T8'\?S8_.OE)\.54[PJ+YZ'U M\.)**TG!_)G07WB2&R80,=LB@ =OI7'>*-?=XVSD9X"CJ:@U72;W4)4DFF>8 M@8#'H!3(/#;PN-S&09X+CG8M*-O'8=ZAN);'0G!:0O+T$$2[F)]"/\:[J."@ MG=ZLX*V.=M79%#2]+FU"Z:68O-.[;B[$EF/XSP!R%Y_ MB_PK$M9KG7I-NEP?8W0YDMBWSD=R#_2O3_ 'AM/,AR@!<@,,=#SS7=6C[.!Q MT*BJR23NNYR\?@*^GOY+R4,\94[F/7Z5H6O@R\DEM[6UMR@D8 D%!9Z9/>JJB^.XKG]2LAH\K MPPF0,W^M<-T'=0?YFIM)U>:U4[#(Q/"(&8DGZ5[,HN=--,^/A65.N^:]W^2Z M'L=CX:TIK"W9B&8KC+#G]:*X.'4M;%M'YD_V3))"W$ZQD_@>:*^?EA9MM^T/ MK89AAU%)TG]Q^>MM)@BM6WE (Y%%&?&XQP#CZ5E9EU%F14E&E%RET.DT#P_+>QK M/(KIXM&M5CV-"&@SR"E16LZ27.UF*^]'*>& M\3*;TV+:^"8)X\)A"X^61>AK$U30;_1M/NHYHRRB6.1'4=1\RG^=>F>&0LLL M<65>-B,K_A7J=_X+LM:T=X7B&2GRG'/'(%>;7Q:P\E&2NF=N#]KB+M/8^2+6 M$3W,C2DI!%F25O1-?!KZ1"]K9PF3#^ M9([8"D\XR3Q@5YL([>&8FZOEDE)Y2W'F'_OKA?R)KOIRC4CS([7H*)22-Q&. MP%/CN>=HR3Z 9-1AT:1O+A)3MYK9_EBDD!(.9=J]EC4*/TK3D,W)(MK.5(RV M#7SS^T7^UT?@AXJTG1+'2H=8GFA%S>^9*5,$98!< =20&//M7N-_>VFD:=.XA=3G*NNX?I7R]KW[9/CP_%#Q)X0\*_#R+Q)+H\\B$V\LC2&-7"[V4#C MEE'XT[]@OXF_\)1\.;SPO<3E[W0),0ASRUL_*X],-N&/I7C'AKXL7OPB_:G^ M)>JV?AJ]\427+W%JUK8@EXP9HVWG"MQ\H'3O7-5Q#E3IRC+E3>MBX48J&/AC%X@32;IH)FM)9691O=5+ #C.P_E65X$T#QI\=?VC-(^) M6O\ A>?PCHVBPA(8KDD23%=Y0<@$G,F2<8 &*\N^ WQ>\0_";QQ\3;C0?!-S MXP2YO-UR;>9H_LJQRSD%L1O][:BF[+3I<^ MJ_@E^V!/XZ^(0\"^,/"5WX-\3NI:&&?=MD*@DJ0Z@J2 2#R#CK7<>$?VI=0D M_:QU'X/_ -BVHL+> 3C4Q,WFMFUCFQMQCK(1]!7R]\$K_6OVG_VB+7XI7EC: M:)I/AI%MEM8K@22,X5V1>S'ER2VT#C%;/AO4'M?^"E>MW(&6%FG7_L'P"MH5 M:DHP;=TY6]4@KV[4=1QG!KX,^ %\)?^"AGQ5N5'#V%T?_ "+:FOLV M^OR[X)Q[5VX+FJ0;EKJSQL53C1J*,5;1&5\0/&R^#O"FK:Z]II%1_LL?%#P9X7_:7\9RVDYL]&UYVLM$2 M.VIO'!I4).:O*U_0_1HW8'?_/K7R1\ M>?VY]0^&'BC4=%L/ EW,+&Y-JVHZA(8[>5QAL(5!S\N#USST%4-6_:%^/UMX MDN[*V^%<,VEQW;PQW1M+C+1!R ^?,QRO/2L7_@HW<>=\/?#.,?\ (58YQU_< MM_\ J_"M<16NBQ:DK,S(&Y! M8,H&?;C(!Q6E^T]\)-6^+GPQ\-/H)236-&9+F*VD<*)U,8#*"2!GA,9^G>O& M?CW\5?BEXB^#MWH_BGP1#X;TQ98(KN^DG'^D2(ZE5B0G^\,\;A@'FL<17JTY M-MM)*Z[,ZL/0I5(KW4W=W[H^Y+/7;?5K"VO;29;BUN8EFBE0Y#HPR"#[@BI! M>UY5\$9;JU^#OA"*]8FY738MQZ'&WY?TQ7DW[9MSXYE\-Z./"YOO[+\R3^T! MII;S2V%\O<%YV\O[9Q7J5*O)156U]$[''&CSU'!.Q]>VU[CO^M37_B/3M!L) M=1U6^M].T^ !IKFZE6*.,9QEF8@#KW->#_LN7/BQ/A'IJ^,FN&U3S)3&;UB9 M_(SE-^><_>Z\XQ72?'#Q1X0T7X<7R>.'?^P+UUMI(T61C(YRRK^[!89V=:.> M]'VNVES)T[5?9[ZV,+P-^V7H/B+7?'L6I:AH6DZ5H3LFFRRZFB2ZEC?R@8C/ MW1@KG.X5UG[-W[0(^.G@N;6+B.QT_4HKAXY--M+D2R0Q@X5W4_,N[G&1S@U^ M>?@^[^%%I\$O$1UR$W7Q!F>7^S8T6X"Q A0GS#Y.#N;D]A7UK^QO_P (%X=^ M#TVO:-,Z7T5NH\074N]0LJ*9" &XPJO@%>#[FO'PN(JU*L5)JUFV>GBJ%.%- MN,7>Z2.I_:1_;-_X4/XNTC0=/TB'6KB2$7-\9)BA@0MA0N,Y8C<>?;UKZ@\) M^++3Q;X=T_6;&99;.\MH[J*0'(9&4,#^1K\I-&^+W@3QCXG^*?B#X@KJ+WWB M*U>TTI;:V686R=58DLN"NR,# [&OI?\ X)_?%X^)/AK=^%+J1CBL-&%#F2U6[/I+X^_&ZT^"/PPU;Q3)%'>7, M 6*UM'?:)YF.%7UQU)QV!KD?V9?VF1^T1X.O=0N;*#2-6TZZ,%U81R%@N1E' M&><'D?537RS^VO\ %W1]5^,?A+P=JT\Y\,Z%/'>ZPEHN]Y&;#! I(R1'QUX\ MP^E87P8^./ACPW^UI>7OA@W%GX/\6MY,L%S$(?)N'Y4A02,>9P.>CFIEB>7$ M\M_<3M_P0AA%]6NX^\U?_@'V7^T!^U!X>_9_TVT%[#-K&NWX/V+2K1AYDF#C M*MG]E&" :89^8P_D?)[9\[?^.*^V=0U.PAL6?46@C@ M5ER;@J(P=WR]>.N,?A6R]K7G.T^519FU2H0A>',Y'C7[3_[6FL?!,>"3HOAE M-8D\1QRLMO?N\,L3#R]J%1GYCYF"/6O-]4_;=^)W@F*/4?&WP9OM(T3>%DNE M,JA'/"OP;M_B*B7>HZ5>PI):00)^\=GX M56[+@Y!)Z8.,G%>-Z-^WYX@\.:EI<_C7X9ZCX<\,:K(JVNIN7SM/?YD ;J#@ M8XY%>N_#7P1IWPE^"&B^&=?GM;FRTJS)OI+H@VX8NTC_ 'OX0SGK7S3\5O$^ MH_MF^+-.\'>#+%QX'T:^%Q?:_,NU'8*5.S./X6.!U.03@9]-?'GXU?$#PC)H=SX&\%MXZCU&*2:YF1V7R<; M/+Y'J&;K_=KR'X=_MO\ C[Q1\8=+\":G\-;;3[Z6X2*^$=S))+:QG&YV4# P M#DYKVGQ9!EW,^.)%0!>O)P!VSUS7Q_\ #74O%'[( M_P 8]*T+Q%;Z9KL?C"Y59-6A5GNU9Y%3[Y^; 8@E3UR31B/:TJD7S-1TOY"P M\:-6E)9^IFA^.%TW3I[5D0DJ 2%]ZYVZG-W$XP1FO6C04&VMV?,U:DZD5&3T1UFAZ#_: M%]%;,%C>0_>=A@C_ !JYJ7A^/3=4-K+API"[TY&/\:XBU\3$72!)-C,0S/W7 MZ5?F\01WUF7EE;[6'PF>C+[GKFATZCFFGHYN[>XGBB5HH4,A\Q\' ZX ZUV M*+C'4\>4G.>B+%CHC7URJ0*763C:!@J/>MW3A-I*S:=-B,JI=&8]?4>^*P=. M\9R:3)'<*L><8\LC&?4UG^)?&TVH:D;E$7?"S (!RPQCK_2O.KT:M25K:6/I M<%BL/AZ?-=\UR]JD<9G\UPKC.YD89!KVC0X[*U\'6D>GX^RF$%=O M*W3-V";HP['TK8^'OC7^S)GT>[;%I.?W+$\1N>WT/\Z\/$T+QFQVV^W%PO6,MOXZC%<7<79!D8]SQ[UWU@_E:;,>N3C!KA/$&F M&VD,Z#,&68YJAX9L%'C4:J%5) /*,BG! M=1T##OST-2S7"Y:1CA5&:PH=0FTFWB=LO<"3''?+9S7G4YA*-XL]QUY M13^&K;[;\2[8D9$8WG M\JZ:OO3BSFIKE3.D\>S'^U+>$?\ +*+%8=C,1-@]QTJYXQNOM?B6Y':,!:S; M8XND]ZYIRO)V.F"TU.ML7"QX[GFJ6HR9U6-CU\L ?@:L6C8'K65XKN6T^W:Y M7 =4P"?K4N=D/EU(8=9B&OW%@=N_8LD.#Q(N &'^\&!X]"*O^#KV6]\;2.[X M2PB.^WC894OPI..^,\?XU\L?M+?$F'P)X*T>YEFOX)=6U>"":;2GVW:6X)>3 MRCV8A0!_O5]*? KP#%\-?AG86R37]Y<7(-V\NIN6N1OY1')YRJE1CV-8RAS6 MFS555R\I[!:ZFLLSB&?<%. #UQ6?=>!M&UJ[-]'"MCJ2@XGA&,GL67H<5S*3 MR+*9$)C;.>*TK3Q/<6LH9\2 =L65_#J=J)[?&?XE[@^E9]_P"# M?M\RZA;2_9Y5&?*(S&Y]QV^M)03?NASVW%\-7UW9V86ZDWRMRN#G:/3-4_'W MC[_A#_"^H:G>S K'&5BB)YDD/"J/\] :BENKJQR=0MFMD09,PY0>Y]*^6/C1 M\4F^(&OK:6CDZ/8$K&P/$K]"_P#0>WUKVLOPKQ57EZ+<\S&XA4*;DOB>QSJ: MC-J5Y/>W,IDN9Y#)(3WSD_UKFO'/B$SZA;:;:G=Y/S2;.[D<+^ S^=6]6U2/ M0M+6XW"2XE/E00,P4NY' R>/>O,K1;E3-=SS8FD9O,DW9PQ/(7'?U-?IV&H) MM-+0_+<5\_P#A_P"(VI:;H4FCVSJFFL"&"#YB#U!/O6\VK33Z9I;(H1/+8DD\ M+EVQ_*NSZFZDKU$CRI8[V-*U)O;7U_R/:+?49K:%]0M),2KQ+M'')^^!Z8X( M[$CL14.M7QO/#EC'M_?-)-(LA SPP'3T/K[5YYH_C>6&#'FH_DN Z@$AQW/T M(X([UN:C<3:MI6CG3PJ)Y:[88=4Y14NY\WB<3*K" M3B^AG_VG+82LSKNVGL1]/4>_'>N1O M=5FOKE8MI:9R%"DDGT%9LLWDF6&566Y1V&,C''!Z<^M>LZ$7J]SYZ%:=]=;G M:65@DL\2R7 VJ-SDC('_ ->KM_J<,][%&'(B0[8XP, #U)]37%6_B&:=C(K$ MW!(WKGB3U;_>]?7K5O5#<09EFECB.%<1EL%L_P!WUI.E=WD/VDZ:LCLM:OH[ M#5(S$S(0?G8#(!]AWXXK"OKA9HWNXF!5S\T6<^6WI].>#^'45#;7-SJZQW$@ M?R-WE;U7.<\4Z5HDOA D927/D21M_$0Y=Y" I+$Y(QG%;TTW=O8F4596N;=M=)#D\D\$<<>]6+*\66X M=L(>2P]*PK+6A#'L95W%NK+T&.>?QK1UJ^TNW:U72U>1P"TMQ(3B0Y' '8#% M:M\K2MN9*DY)]#8^T?(60,BYQDG(-0BXDE=\, JCENU8]YXDDOK>&%1Y:*U6 M/%-[I N@^E>>+;8N?M#*6W8R5CYJF-\] M\.=@^5",AFSWK,@TV\;2O[2DMI_L?:<1,$/_ L8J-K MUK>]W/&J2!<$,,\XZ_C6BBIKW7='F27LY)VU1MO$GB/5)([-0(E3>[(NU$ [ MFJWC/PXWA2PMIC>6]Y#?AO)\L$%,<'.:S]'\57/AG4)I(K>*9Y4VF.7[I'7L MXCEMI\SYRK1-@C_"KC-!>:E*LI\N%H_WIZ%C_+]:)J^C-(T[2TW-O1_B!JVFQ@:C$M]",#/M%U" M!48BTF8YS."#TZ9Z8KSBYACTVZA+S17P:-9/+!.%/HWO56YFCN[QY'5+>)"& M"H#P?05YE3"4ZFRU/7IX[$X=V;NO,]@"+*I,,B21$\E&!7\Q5.:P4''6O(I; MJ60;H6>!"204)6IX?$6K6,>1J<['HJ;]P_7->?/ RZ,]VGFL>5>TCKY'ITFF M94'&":K_ -G9)7'->U>07?C/Q# MJETTCWLRK(W$<9V*/88[5L>&?$TVDWK?:9%E9E._SLOC [9-6\%42T>IG'-J M,I\KNEW.QU/Q/HFD,5>Z$[@[1';C>V?PZ5FZYXNU(6%I/9VT=E:S9VS28=R! MU^4=*X[4G6_G>Z6--KMD8!'/YU";F66#RG;YX.(SB4I M2BMNEB_;:Y>+?"[DNI)I\X5I3GC/)QVK;U+4)M7F8/+^^3(3!(##T/O7+11O M%,/,_2M8O&)&D+$Y.=J]:]&.&AS:8RL@1SQM P#7I6A?LW>*-?\/_VZM@D=K*@>"*=P&8'^+&?2 MM9U*=!+VCM/?9[2"U,Y#':<@'N:DL_$AM+"YMT"R&X4!M MR XYSP3T/ K2UCP7XCL],U&XFT8Q6&G28N)VX13D#C)YY(Z>M M2B+&GRCYL=3[__ *JUM8X,1!0>QKV\ M?GW82U+.K-A>?FQZGWZUJZ+B.XN2+9Y@P*A-VUASP?>N8M[@P7P\J4QJHW;A MVK?MKZ E&>XXQDX4\_Y^M3/0YHPNS0C@FEC,JV\2F-MQ=AN('?KZ=/QJ+Q%J MUYY-S#&[1JNP*$&".3DY ]>*],^%NK>&(;V63Q!'),C1D1/* -PQDC'.>G?T M%VTX$/&77(DYX(PC M;,YP?7%:6&6()O#,-S;A@(/6NB2I8FE*A4UB]#S:ZQ&#KPQN'TG'4G^&_ MC7Q!X)U26XT/49+&0(0-R^9$2>Y1@5)^H/%;'Q"_;$^*&B6D5A96FCV%J(@5 MU&STT!B=Q^9LDJ">I'KGBN2CN&T]@0F(AD8/7GO]:RO$4BZL!#(S3VI491^F M>^*_%L\R2K@79ZQ>S/Z)X4XFP69P53E7.OBCL[]T>57VM^(?B'XB@6_U"XU7 M4+N;9$MS*6 9VZ*,X4$GMBO?[GPU:Z9IX85Y1I?A.ZT'7[?5]+#W#V;>;'#N"E7Q\N&/O5OQE\1M499M)U&%UFN0 M'GN8B1(1C@>Y !/M7QRH\D6Y=#]]RW&T)TG4HM7VL/4UA:%XBNO#VH)=QO))*C;XPSG:K_WB,\\9_.J"6P. M-QV+_GTIYM6*'8A<@\$"N1/6\3K_ 'DG&4(V:^9^D7['GQ/T?0U/A?5-3EEL MO$[)+9W,SE1'/L&$WDG:3A1UX8 =QGZ8\1^%_+NS"]E_:4,B["[1KP".3GM] M<>]?EAX"O)-=\%WND6TAFFLXS<6UQ(H0K+U(QU.21SZD]*]D^#?_ 4$\?\ M@S3;71?$NBP^-K>*)$CNA/Y-U&O ^>3#*Q !^\ 2>IIUXQQD/9O1]'^9\]GV M5U:5?Z[A6KR7O1T2OW3OUZGW5IGPWCM[)K25UDC&0BRX>1%+9Y/4US/Q%^(= MC\,M(>ZN;JVO-257A@AML8CS[YX(P,_CFO&_$_[>\&IV2P:/X>GTV2:,F2>\ ME5BA_P" =?KD5\]?$WQW?ZG??;==,D@ECS!$!@,IP05.>.2<@8ZX&0']%P,^PJE+?3:U=>9(H1!G9$OW5%=%I_A^YEABN)H9!9 ML=N1C)/;'I7[_EF AE]-5*O\27X>1^"9_F]3/*WL,.K4(?CYLL>'-K;6ZK^']6@@RCIC,; G\*\ZTO1E5QERIYP/05U6D62@%G<[MN,9Z9%>PJ"J: ML^7>8JFN2'0]/\,VT6JW]N;>;$C/M"."H;Z'I78>,OA[/X6MH)9HQ(D@Z*,@ M,3''ART9^-C M_.>/4&A%ADD58^2_/. 16S96CSPO',3*,?)+N4,/;=G^>:VJTXK=7#!UI2?N MLIVOBBYC$,D]M#<( T;;+A1]I>R.'D\3OY#K'IRC R-TG'\N*Y^3Q9J1F$<$5M&2>P+D? M3-=)>I:SE4C@G$(XVK*H4_7Y&16S(J=1AAD UX$*CYCZ&M3CR63 M/-M7T/3K1&>ZF>8GCRK;CZY8USDNO2VZO'IELEE&!C="N9#_ ,"ZUW6NZ==G M/DKO4# ,0!!/X5QNO:+?:4Z_;'D1).0S-P1["OH\-)224W=GPN-I5(-NG&R[ MHD\.^ -4\6VLMW',J;9-A-PQ#$X!]**CT3QM>>&H);:T8&)GW_O.3G&.WTHJ M:L<8YOD2L8T998J:55OFZZGYOQ3X/6K4=PMB_\4B]MQ$!M]:X47AQ]ZI!> M$'[U0ZEM@=.+=SI%OACK4BZAMQ\WZUS*WQZ9-6EOAY2H$ .(DDE8BVF'E MR9[9/!K6,NC./%TO:49);GU%Y\?"HT[,[_P /:G/YL1W@L<$+M!:O M<-%UN";31*T@(5!7RWI6OB&/[/;[E7H78X>3W/H/:K_BKXHGPKXX#I>0D_ZRW.Y0/]K'(_$"JEWXEGUJT>XDD;S[0[U /+ M1,>O_ 6/Y,?2LV'5&$@EBE,$YZ-&VT-_A]*]'#X?V4;'K2DVKLV#J(<#N/K6 MCHU_IF^7^T]YBV8C"'!#]B?;UKFY-92J>&].U=='>_ CDNS%YN(]V64 ,. MH &<]":E^&'PUT?X?>!])\/K;6MX;*'8]S) NZ5R27;GU)-; G*,4<,K#^%A M@U)'=X..:YWAH.?/;78I59QAR)Z'GND? -_#_P ?9_B)HNL0V-E>P&&]TC[- MQ+E<$A@P Y"MTZCWIWPX_9\D\"?&GQ?X\?7([R/74E1+%;8HT.^5'R7W'.-F M.@ZUZ9#>8ZG]:M"Y#?Q5"P5*-FH[._S!XJH[IO=6^0LI:-B#QGO7D?P"^ TG MP:\0>,]3GUF+54\03)*(EMS'Y(5Y6P26.[/F8Z#I7KQD648)_.LZYN3$WE@\ M#J?6M)4(SDI-;"C6ERRBGHSR7PK^S[+\/_C-?>,?"NNQZ9H>I$F]T%K=FCD+ M')VL' 7YN1P<9(Z5*Z@6(:;]G(9<6\<6=^[!^YG[ MO?%>HV#&[N$C#! >I]!4^K1P6T9:&N162PE-*UM+W^8Y8JISO;O7HM1&\9<;LBIA@:,)< MZ3OZFE3%5)+E=ON.GEUJ64$$@?05XYI?P,ELOVBM1^)QUE)([N$0_P!FBW(9 M?W,<>=^[!^YGIWKT"*\+'DFK<5W@]:ZYX>-6W.MCCC5E3OR]589=> _">HW< MES=>&-%N;F9BTDTVGPLSL>I+%;?#;]FK3? 7Q8\2^,9)-.O;74G>2RT M\:>J"P8R!U*') VCCY0*]56ZYZU*;OY",T2PM&4E-QV)6(JQBXJ6YIRW@Y/Z MUXO^T9\&9?CMX=TO3(]732#979N3+) 90_R%<8##'7WKTRYO,(>:HO>\=:JK M1A5BZ<]F9TZDJ4^>&YS7Q,^'U M>,V/[)DU_JMI-XS\<:EXJT^R;,%E,65<#H&+,WXXQFOH"6]/K56:Y)'.:PJ8 M*C4:E);>9V4\35@N6++ F6"-8XT"1H-JJHP !T H2Z!/^-9,MT1G)Q38KGG. M371R6V1&^K.GM+G)7Y\$=,UC_$;PQ'X_\&:IHC"V62ZA9(9[JW$ZPN00'"GN M,G!!!IL%T1SFM&*['K4RIQG%QDMR.=PDG'='C6K?LIZ=J'P9TWP9;W%A:ZI; MRK)/K@TY3-, S,1G.X9R!]X]*[SQK\)X]8^%-WX,\-7%GX86[2.*XNX+,9D1 M"M)\/QVUM>?8H1&]Q) N97SEF.<]22<=JYO1 M_@4_AOX]7/Q$T36(;"SO8#%>:1]F.V4E<$APP ^95;[O8^M=Z;Q1(Q0D)DX! M/(%;V@:OI"Q21ZK:SR#G;-;OAAQP,=.M4\+2:6FVUC'ZS4C=WOS'D_PC^ *^ M O&/BSQ1K^J0>)M8UZ4-YC6@18$W%BH#%L\E1GT45/\ 'OX!V'QCT#3[6PN( M/#VIV%T+B"^AM@2.#E< KUX(.>"*]%%[TYY[YI#>\_>H6#HN'LW'07UJMS^T MYM3@_BO\ ]'^-'A?3+;Q)<$>(+"$)%K5FGEN'P,G:3RI/.TGCUKS33_V*KW6 MKBWL_%OQ1UK6M MF!AT_YE&W/0LSL,^^*^A_MW&,TJWOO1/ T)OFY=?ZW*6- MKQ7+%_UY=CS?XV?LY)\5M1\"-IVN?V;:^%6.U+B%KAIE#1D#?O!Z1=3GK6]^ MT)\"-/\ CSH%G";P:3KMA*)++5%C+M&,_,I (R#@'@\$ ^M=Y9:RD$13;ES[ M5:OX+G2O(:X\K;.GF(8IEDX]PI)4^QQ1/!T?>37Q;F"Q5:/+K\.WS/%?B[\! M_$WQ6^%.@>$]0\:)%?6,@-[?QVC;+X*"%W1^8.?ND\D9&>*\VT']D7XA^$]+ M33M'^,%QIUA'DK!;63H@SUX$M?537>]>2.N:EO=.OK.T2ZEMV%JV,2]5Y^E9 MRP-&4E.2=_5EK,*]./*FK/R1XI\6?V=+;XJ:7H#7/B/4M.\1:/;K%'JEJYP[ M8&YRF>"2,Y!!YZFLCX2?LQ6'A/XAV'BWX@>(M3\?7NGG=:12L8TC8'Y6.YF) MQZ CGGM7MSW ^E59+K=\I_.M)9?1E+G<=3"..Q"C[-2T-"2_1V@S4L.J7!M929V6(*%QGWZ5AO<&,F1?NYP/:A6%PSO]U0,@ 5Z48*VIY\UU M-P:H8V/*UC!;'!.F^AU5WJDT.V>3YU9=W+9QD53N-8>*26Z20%=VX M*#QG/&:Y>[U[SHT"E@H;/EDY '8?SJD^H/M;DJ'Y/O6WLD^ARN$D>DZ7\0YX M;JWL;AHA:R'?B/HDAZ'GM[5U,L#3%&*[HV/^L4X_'->#3:DQ";% 9?XNO-=E MX)\>9"V.IS%E3_52N>!_LGM]*\G$X.R^:^=]2U*?RPXE8,K9&#@@=JZ3P[\!UCJNI^G8',(-JFSM==\*R0@RP$M;H M#+(OH>P^E?,J?%F1?BI=6=W*L]AN$<*V[JZ[C@#G.,9Z_2OJC2]"UGQ]I,5U M<:B+>U<;A;P1@*1VSSS^-?._Q9^#=EIOC2.>WD^R7GRR"5%&US_M#^M?)XE2 MIQC-:69^G[_"SQ,/%7AB^B)7=;NT1 ]JSO!HA@\;7TK3 M1_NX]N-PR*XC]E^*^L-1\5Z5>9D$=VQ653E6!7-3W?P@O+7QGJVM1ZY=0HQW M?9E<;!^%>S[*E4NW*UE='Q]>52A)QC&^IM3W(N];U&4G@RD#FH9]5L+"=6N+ MN" \[Y *\Q\1^$/&VJW)DTC4A;PL3EBN2??K699? C7-6.[Q!JSW'(--NHRT-];R+ZB45G^/5FOM.7[$?.D M4;MD?S;QZ #K7CDGP)UJPVIH>N2VO>%]%N]"TW2K*\N6NI]FUY6 M R3_ $KDQ.#HTHITYW.G#8JI4E:I"WSNW&G2@PR< 9*-R#3=.\2 M6VK$Q@^5=+PT3?TKRIP?-9'HP::N7RVWJTOO/\+>'YBUL#MO;R)N)/6-3W7U/M MBOGZ18;6!KIG$<"@^87Z)]?;O52"02JQE;:B\ER?N^Y]J\Q\:^/7U*ZET^R_ M>:>AVSD$XN,'U[ =0?6OTC X%4HJG37J?%8W%O6UDO$2;2'* MPK[=V^IJ:RD,E[[BW2*1##,P*RR$(H'0[B> 1W%= M+JUI9V$86POEOBNZ.<'E0<\,I],5];2A&-DD?G^+J2G-7ZFE:0M$L?_:1:L4@G,DH<*H P"/6 MM?3(;_6[@VEK&\LY&QD1<_Q'/^?>NZ,%NS@E"ZY3K-+U0QVD\OF!8?ND \X/ M/Y5OKXC\NVTYD=Y4:W(DBY".IFDW;B.GMZ=:\W,L5HLR)*LL3[4\T' 'KQ[8 MZ5M)XTGM="?1;:RM+B.\M@K2RPAYHP'9B48_'MNM;DD'G(GEQ;VC0&>QZ+H6JB;REB>2VDR,0LW M[MS_ ++?PGV/'N*]<'POUK4]+DUV93!((&*QA"Q:3 51GW'.?7->":#XONWE MMHX;1=\; QIJ6T%C!(;E]]T#L6VB/RJ0<W81(\A(?: M& QUSSC\L5$9%AVEE8#MGBNU^(OA.;P1K=Y87D8GO(6 _=!BBJ!@?4\=*\QU M/4M\@Y/WG552*E'9G+5P;I2Y9+4],^'5CX-U._OW\7:I<6%I#;& M6""W^]<2$D;0V#C'TYKG(]0DEU,W)+-:6[,T6XYX7[J_4_+FN3MM22.2)W$N MU3ND*=57IWK3348GT0PQI_I+/DL3U Y(^F<5"I-5)3] M="C;0\Z2FF=]#H,4&B"^FN2K2#*J"!M&>M3?#W4/"NF>/M(G\3%[O08)?,N@ MBY!P,J".XSC(KS;4-=E:'RS-(0O 4G@#K6>VK %!&>>&)]#6-2G[2+BVU?MN M=.'G*$D^J/J;XV_M5?\ "=:9<>'/#=JFE^'L>7LV#=*H/&;;LY3S0.=FXR2RM;AVDCMX7+").RJ3S@>IJO!9/=#S('$J+RP7[ZCU*^GN.*Q+<3O& MK1I)+(XR/+!./;CBMK3\O/',[P63( _VE,FMW[L=.@Z5)S:1_&L:=;ZZ\&FW5M#&A*LA!0MW^8X MY]1GBO%AC'4KNE9Z'T<\"H4E5NM3RM+>WMHYFN)E>53M6-&SEO3/>J3R,P\M ME=H@=VQ?6H=0BD&2K*P+<>60P)_#I1'-MC;#LLH.",8->JEH>5.&I=26WGNU MC?\ T=!PRD$8/ICUJ6[FM'5!'"%8#!P.M9TA:\CNBS;RKF5I7P#N[TVVN8O[ M/E9M[3@_*<\ 5FX7=Q.*33.ATSQ+):VB6LZ1R01\*6!RHSFL[Q!K$&LW$ BC M9@I)8GY2@7A1[&DJ:3N ML55 MDD1=WS=2.,?S%1W]M()5DD88&":-P%8K(<8)([ M#VJHRA*7(MT9/#R45.VA +VV+(8HWR(\-ELY;/6I;2YEC5[F$_Z@AF8\XSP* MPIB(X7G5BD.2N7(SDC*>AK=63L M8RH.]S6N-6=9[2290$C<';CD\C)-?5-Q\?H]6T*QAMKQ((XHE0@$ C Q7Q= M=37!"O(#N*AE!/..U,NKF6S95@O?-!4$F,,!R,DQ3\)9KK3+065J6VQQHNW/OCMGTH35 MI-/#PS6["4C.2>E4_%UY:R74%O;R[Q%_K'7H#[52-\AB>.)\JO.Z3EFK6,7& M*BBY5]?KW_.N2BP+ET$OG1HQ57&<,,XR M,ULV-I]H!2,[9.P)X(IIRSK.E[IT6M>.]4UJT2RDVHFU48CJP7A<^V!7* MZBSNFP,< [F;^\W^ [5:4A&8,-QZ?6E@M4NIHD>58D8_.[ D(,]2!6+I0BM$ M0L1.;O)W.8F#+\F1CM[5+*TEOIQM2(I$,F\$K\RD]<&KE]I[1RG'.>A%9DB2 MVLA;8LAD^3YN=ON*PK1IU(7]?@+HFHVL5P([EY+==^ MY@.5DXX!]/UKH?$'A>UDTTRVUS8WEI+N#,@21@0,AP.*^5Q?#F&K4G&@^6_P!Q^A9=QMF&#:CC(\Z779_Y%N/P7I%R M-QM$0=Q&Y4C\,U83P?HENH>.*9I!_"'.!]1UK/1KN,A4DDYZ>]3+->QM\DK[ M^XP!_2ODY\'XB^DH_C_D?=4O$ZC36G.G\OSN=)X76UTO5%D%NT,>0OF(3OC! MX9AGJ<'GVK0\<:1!HVM21.T<<9575XV $@.<-@=21UQ7#O+S@<@>@'2N#;5?WK]2&X -9 MT9_6+NVQY=9*C4BKW?\ 6AT%O/86MH;@1B27=A8Y)23CW"XK9T[5YKJTC,$= MO;;3T6(TS1DOE#N_E( ,G'7-6K)_[,+/!,9'8X@!'W?\ ;_P_^M45 M*:EH?1X6LX+FV1[1X+\87VEB."1I99"O[R7JJ?[)(X![D=OSK!\:>+)M;036 MD@:/@S(>< _Q#_9SZ]/RKF/#WC6ZL+Q_.LX0WNG6AG6:. M0@G"YSD=&4CT(ZUX\, H593:UZ>9[[SB5:@J:EIU+-T0D8=[:*92.7";2,_3 M%9MRUKY:A497)Y ;('YU>2Z$UL%3_CW)(8$\QX&2A^G8]Z6309)].\\2)"^< MDMUQ[#O7JPY5N?+UIU')Z:#='M5GG4RS+"B#<,\5TME'-(/,DQ! ?^6LO&X? M[*]37.:0\-M<(ENAGFS@W$HW,/HO05Z3;>";V:QCOKMS!:.N7N)6QM ZG!Y^ M@[URXJ<:;]]V.G"49UE^[5[#/!-RT^H-;6,9)CR9+F?&$7U]%'ZUZ./$4,"" MWM)"Y<[6N&_Y:?3T%>-ZYXQLK$#2])A>&UB.^5RVU[AAW?V]JOZ7XTDDM&=D M1<8CC'7D]3SZ#^=>)6PDJ[]JUH?74<#BM M9+#[=$9PV'4?-GO7E%WKLJV^GP!W5A;*[8.T9))Y_#%:%E\2181KG=);E"KX MZG! )_45\[/!U.7FIGU-+-**ER52?6;MM'OG,4S6T_7)^5&/H.WYUSNL^/9= M186^I6J71C4;+:/?DLES=6A'6.2'?^H/\ MA15?2LW"R& QC ^3C\_>BM'3L]VG+V&E]Z_S/U50K_P#/M_>C M\V5NCQBI%NB#7Z2#]C'21_S#O#O_ (+D_P#B:Z3_T#O#__ (+U_P *O\ A36>/_H'?WK_ #'RU?Y#\[C>8'6I4N\J^(9M2^Q)/(TDAB,TC'UC*<@C\02*;0:^OA^RU"HP%TD?\ ;K_] M:G']EY" #_91 & #;=!^54^([O\ W>7WK_,IX6N_LGR)'<,Z@9+8[U-\ZKE@ M0OO7UNG[,GE8V-I:_2W_ /K5(?V;)G7:T^G%?3R#1_K)_P!0[^]?YF#P>);T MB?)*W[A0C'S$[*W.*E6X4#*_*3V/(KZK_P"&81GKI?\ X#__ %J7_AF/_:TO M_P !O_K4+B2W_,/+[U_F+ZEB/Y3Y52Z.[M5J&YYZU]0_\,R<8W:7_P" _P#] M:@?LR$='TS_P'_\ K57^LO\ U#R^]?YD/ 8A]#YF>Z$:<'YCVJA>7 ,1?N*^ MIS^S(YZRZ9_X#_\ UJ1OV8G88,FE_P#@-_\ 6J?]9/\ J'E]Z_S".!Q*Z'R4 MNKFV8,K#-5;WQ 74J".1CK7UU_PRTIZ_V2?^W;_ZU-/[*D1ZKI'_ ("#_"E_ MK+_U#R^]?YFOU*M>_*?&L.I;90W7!S@UHWFM+>*@"[<5]<_\,IP_W=(_\!1_ MA0/V5HQT&D?^ O\ ]:FN);?\PTOO7^9,L!7D[\OXGR%#= 586Z^;@U];']EA M.PTC\+7_ .M2?\,L@=#I0_[=O_K57^LW_4-+[U_F9O+\1V/E6.ZYSQ4LMSLZ MXY&>#FOJ?_AEL_\ /32__ ;_ .M2?\,MG_GII?\ X#__ %J7^LS_ .@:7WK_ M #%_9^)['R56TD_P#;M_\ 6II_940]3I)^MK_] M:C_6;_J&E]Z_S'_9]?K$^-EO=S=>E-EO>#7V2/V48\_\PC_P%_\ K4K?LHQ, M,%=';ZV@_P *K_6=6_W:7WQ-%@:Z^P?$D][YAQZ4D5W@U]L_\,F0?\\]&_\ M 0?X4?\ #)D'_//1?_ 0?X5#XEOMAI?>OU9?U.O_ "'QE#=\#G J['=\#!K[ M!'[)\(Z)HW_@(/\ "G?\,J(/^@1_X"__ %J7^LG_ %#2^]?YD2P-=_8/D(7O MDO>17UY_PRJO_ %"?_ 7_ .M2C]E55.0=)S_UZ_\ UJ/]9/\ J&E]Z_S) M^HXA_9L?(ZWB[AGIGFN@T+19M:CGGAECBAC/W)6&\C'85]-#]EK:7XJWNH^=;+1X9%&[>Q M/O2WWAIQ"9+;+'^X:^CT_9PO4Z7FGCZ0FI/^&=]1QQJ%D/\ MDU5_K*G_P P MTOO7^9R?V7CKW/D:6=[>0QRKL<'D&E6\%?5LW[,7WK_ #.I9=B>J/E^VOW@E25&_>(=RGWJ>;4Y+J=Y MYFW3.=Q;WKZ:'[+[C_EKIG_@/_\ 6H/[+\A_Y;:7_P" _P#]:G_K,O\ H&E] M\2/[,Q+Z'S3#>\BK$NJ7)LS;>?(;9B"8]QVYKZ/_ .&8),?Z[3,_]>__ -:E M'[,=P!C[3IH'H(/_ *U+_65?] TOOB2\JQ#W1\NRW..]4YKK'.:^JF_9?F;K M/IA'O;__ %J8?V69#UETL_6W_P#K57^L_P#U#2^^)/\ 96)['RJ+U"00 3TP M>]1FZ8!@&QV(!ZU]6']E=_\ GII7_@/_ /6I/^&5I/\ GMI7_@-_]:FN*/\ MJ&E]\27E6)?0^4H[A06)89[*1G-4]2U=50HI 9NNWIBOK@_LJ.?^6NE?^ W_ M -:HF_9+#=7TDGWM?_K57^M5E_NTOOB9_P!C8EZV/C0W)DPBY8D]/6EN-3D@ M58Y,J\;?=;MZ5]D?\,E$-D/I /J+7G^5-E_9&\TY9](8^K6N?Z52XKM_S"R^ M^)D\EQ3>Q\327@8[B1DYS1/JSR+@MGC;T[5]J']C]2.NC?\ @(/\*A?]CU?[ MVC#_ +=/_K5:XN:_YA9??$R>18I]#XI-V-H].]2:EZ-V^AXKL_%^K:1\5!9W^@W*MJ"' M;+:3$)*H]U[_ %%-NO@QDY#6@;T$7_UJQ;CX0SVLHDBGAB=>0R(01^->/C9T M<="SHM/U1]=E^,Q67U54CKZG7_ KP9JOA/QKK,MZ$^S7@5T"DGD9KU7Q7H%F M;.\F*;7D4@LG!KQWP]JWBKPI>1RRWD&J1(,;+H'=CV;K^==UJ7Q4L=7TMXKB MUFL[@CM\Z9^O7]*X(T*D8"Y&T^(P71QV$@_P *LR^! M;G:&:1'SUYQ5_P ,>(=-ET](_MT*2#JKN%/ZUU/GQ7%L&CD61<=48$5M&*1E:6=CV(4#FL9?#UIIMZ)X8,2;CB4\ MD?C6WKOC70[5%#ZG 67JD;;S^2YKA=7^)T #K86KW1S\K2_NU_J:SJ8>I.=X MH<*\80LV=O:ZZS 1W!4>A['_ KE/'7QK\/>!T>.2Z&HWX'%E:L&<'_:/1?Q MY]J\QU_4?%/BD-&U]#86S'_4V:,@(]"__9GU3Q1.&NKS31$/NP"W.P?XU[T, MSIX9RNK"SEDM+56!)*@> M1Q'Y9)!'?U'I7VSIG[%X9@3)I/U-H>OY5U%A^Q-%+C+Z,?K9_P#UJ]*GQ-3I M*RP\OO1\Y6R[%UI6BJ&WLP M/,GI^%??VG_L10(ZL&T0..0WV+I^E:]O^PY:.%WIH+[>!FQ'^%;+C",=L+/[ MXGG3R7%MW2/SGBN&R9,[4)Y8= ?\:W-(\9WVBO=/I=PUBLL>QY TJJ>"58] M"<]17Z$)^PY9-C]SH!]C8C_"K$?[#]FBLJV_A\!AA@+$2/4U->:M-8R2&UD?!A$3R[,8!SE2# MSZBOT33]B&R0L1;>'P3QD6(Y_P#':4_L06)7:;;P\02"O..G\-/\ UV_Z M@Y??$EY%C&K6/S0DNIH9\Y?)Z$\9JQI^IW%K;SR,GF0$X^?.T,?T)_PK]*#^ MQ):-&D9@T HARJ_81@?I0W[$EH_WH= /J#8@@_I3?&R_Z Y??$S7#^+ZH_-4 M7B"\=E;S'VD[N@!Q6E=>*KJ[-BUS(?/@Z!XQY6T'Y>!UY!R:_14_L.Z>Q):T M\/,3U+6"D_RH'[#NG#G[)X[WE6O_ ,331^PYIX7 M/#N,YQ_9R]?^^:G_7-?] ND\"_$;4O"=K/JD-VD%S$ZPJ M"ZK(,\\)D$CC&L2UD>+3NEJ?"OC3QW=>)]5O)[RY+ZBS$&4GB0=@??'0 M^_-8ME<0ZAX@LTU"1M)M3$"\J6YD(4)PVS/)) &>.N37Z"']B*R8DM!H!).2 M38CG]*E_X8KARIVZ'E1M4_8AP/3I2CQFHQY8X2:^<299%C)N\E<_.NT^UW%O M=WL:Y2#)DD9E QT& >OX5'9:F#&L&8[*UAT>*62_"YGN&EWH M?0?7]*Y.WN(%5VFDW$B:_P"KN+>MC\W[?5&AMYECZ M8],X/X4MK=.7P)?+PI(SW]J_1X_L/Z?C_CU\._\ @O7_ .)H_P"&(+$];;P] M^&GJ/_9:K_7;_J#E_P"!1,WPUBWT/SHAU"9G;,C.&4KECG@CIS6QH/V)[4 CRM!VGDK]B&# M^E+_ %UOI]3E]\32/#N+CT/B;1O&$MA,SV=W)$AAE41 \H/+8EF]6) )-4)] M8DUJT$TK9O.4BGD./,Z9CSWZ@CZD=,5]V#]B^($G;H8)0QDBSZJ1@CITQ49_ M8I@*;?+T''/'V(8&>_W:R_UQBG?ZG*_K$Z?[%QMK6/SOGG%R!]U F2S-U^F* MJ0:N+6CQVFTC\0*#^QFIF:3.B^8S%BYM.22\(VOPUL=2AOG?6)""Z.3^OMDGCZ5Y'XAUJ/4+U7$,%O#&H5( M(F.T8ZDYYR>M?<3_ +(MS*H5[O2F09PIMR>O7MWJJ_[%T,GWAHC?6S'^%<]' MC#V=[X6;U[Q'5X>Q=5I\J5D?&7A?XFGPK+++'<21&13"%A.!@]\?YZ5QGBCQ M!+?3$2CR=[%]W\)]\^OO7WV?V)K5NL6@D_\ 7D/\*63]BBVE"AX=!<#INL@? M_9:V7&4%+G6#E?UB4N'\;R\KV/S;G+I(0QP_6KE[X@U.^LK33KO49Y[.SRL$ M$TC.D(8\[1SCUXK]%O\ AB6U.-T&@$@8!^Q#I_WS0W[$EF[;F@T L3DG[".? MTK3_ %UC>_U.7WQ#_5W%=C\[[HRZ+=28,5U$05CN8VW12?[2-W%&FZW9):7$ M-W8"[G8?N6.0$)ZDX(R?TK]$6_8FM&1$,.@%4X4&P! _2D'[$EH"3Y.@9/?[ M"/\ "G_KNNN$G]\2%P[C$M#\\K&*Z%N88@&3&^0IV^IJ&25GMTA)&Q&++@@%?HC_PQ1:@Y\K0? M_ (?X5(_[%\3Q>41HAC!SL-F,?EBG_KO_P!0<_\ P*)M'AW&I*Y^=5O-)-'' M&\G[I,[0>@S75^")/#MMKKS:^DE]IT499+82F 2R'H"P!(4<].3P.*^YO^&* M;?\ YYZ%@=/]"'^%.'[%5N/^6>A#_MR'^%93XS4X\KPDUZ./^9K_ *OXO9(^ M(L6VHW2Q:>@C,CD(KOPBY[M[#J:G4I!,\;2K)LQ\\><'M7VRG[&*1L&3^Q%( M[BTP?Y4X?L:JIR#HH;U^R?\ UJI<;65EA)_?$\]\*XR]V?$898\$$G)^Z1V] M:+B<.?D. !C'H*^W#^QMELE]&_\ 3_ZU(W[&F[^/1?_ $'^%'^NM]\)/[X MCCPOC%<^($EFF*JC&7')4^GUI8-&N+V0>7%DL=QQR!SZ^E?;C?L;N3D3Z0I( MP<6N./RIO_#']W"I"W^EHOHML>E9OC%/_F%G]\39<-XZ/PGP1JFCJD\T1S6!>Z0%M$F+@%F("#K]:_0:Z_8SEG9F>\TIF/))M23_*L^;]BMR"OVK2- MN,8^R'_"I7%T=_JL_OB=/]@8RR/S_CL[I"1"K,3SE7]C&XE/S7VEM];8G^E/_6Y/_F&G]\2'P[B6 M[\J/AR/09F1UC629QR=IW5L^&M F>=%>W8JSC(88P?4'M7V5#^QE=P$F*_TV M//7;;G_"I8OV,[I6!_M#300<@BW(Y_*LI<5J2_W:7WK_ #-Z>0XN#7NZ'BQ^ M"K0^'?MJ.?-"'8Q/\P/3->:3Z3;VV93X?S&G?D=KZ?(^47\/WEG$%6%D0 )YKJ0 .YS[G->A?"_XMS_#&)X+6$W* M2Y\Y!T<]!S[5[U/^RSK%V_TQR.A:W/\ A3H/V4M1M9-\ M&IZ="V,;DA8']*UEQHU!JGA))]-8G'2X.QJJ *^B9/V3[^9RTFHZ:['J6A)S^E,_P"&1[G& M/MFE_P#@.?\ "H_UQ7VL+._K$U_U2Q\7>&Q\_P!GJ$;W<T9++] MX?CTYKA=:M5M)O*$IE8D?=;CWR?Z5] W'P!\77D7E7'BH3Q@8"R/*1^1)K-; M]ES5Y#E]7LV/J4:N6CQ94A\>%D_FO\SNQ/#F)JJU-61Y_P##_P +7MQ;SZLT M1M]-ME)-V!GGN$'=L?E5SQ-\0/[4L4A56ALH"1&F[Y'^K M>-ITHTJ&B?Q7Z^EME^9\^/?K/>N2K%Y.![^E=!ICDW$=OGP+^RIJ2,"NI:>I'.5B8&I(OV7=7A??'J]G&^=VY4<'/K78^+KIQ^J2^^)A M4X6QQKS>> +)YH+&-Q\N>H]0?<5ZA#^S7X@MGWQ>(+>.0JP_$DL.G".&FUZQ,<9P_C<;)5)Q2?EM_7<\Q:1XL)&YSC>U %=T#BJ<\(/&*T2ASD5' M)'GM3N(P+JTSGBL2]T_<#\M=@]ONS5&>SR.1S5)B/.-0TC.?DKG[S2W3/!8> MA%>IW6F@@G'%8EYI(;/%:*HUL%DSRJ\TU6SN4H?<9K&NM$#'( (]J]4NM#'/ MRUB77A\$D[<'U K>.(DMR/9]CR^YT'.F^'P"#L_2N@LM# Q\HK=L]*"XXKG-#)T[ M2 I'RXKI++3]N#MJW;6 7M6I;VP H AM;4#'%:,<>W'%+'#5A$P* $50M/4T M8-+^% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-% M% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !F MC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% "8'O05 M!I:* (FB4TQK8>E6/PH_"@"DUF#_ U&VG]]M:/X4?A0!F_8/]BGBQ4#[M7_ M ,*/PH J); =JE6$+VJ;\*/PH :H%+@4OX44 &:,T44 &:,T44 &:,T44 &: M,T44 &:,T44 &:,T44 &:,T44 &:,T44 &:,T44 &:*** %HHHH **** "BB MB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** M "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH M**** "BBB@ HHHH **** "BBB@ HHHH **** "FLFBFNRDM,]OT MJO+8Y[4P.%FT52?NFJDFA*<_+7?'3@>J_I4+:=ST_2I \_;05/\ #2?\(^H_ MA-=VVFC)^4?E2?V8/[H_*@5CAUT)0?NU9BT0?W*[!=-Y^[^E3+IHQ]W]*%H, MY>#1AQ\AK1@TE0!\IK>BT\#M^E64LP.U &1!IH'\/Z5H0V07'%7X[;VJ80XH M K1P #I5J.$ 5((P.PIX''2@!JKBG 8HQ2T %%%% !1110 4444 %%%% !11 M10 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% M !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 M%%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4 M444 %%%% !1110 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 M F:,TM% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9HS2T M4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 F:,T MM% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC M-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% "'FDQ3J* &E0132@J2DQF@"$Q M YXII@![58P*6@"H;93VH^RKZ5;HH JBV4=J7R1Z59HH @2(#/%+L&>E2XS2 MT ,"8I<4ZB@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T M9I:* $S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3 M-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* M$S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B M@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* $S1FE MHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T4M% !1110 4444 %%%% !111 M0 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% M!1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 % M%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 44 M44 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !111 M0 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% M!1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 % M%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 44 M44 %%%% "9HS2T4 )FC-+10 F:,TM% "9KGY_B'X5M9I(9O$VCQ31L5>-[^) M64CJ""W!KH:_+C]F/]F+P-^T;\:OC@OC.UO+@:5K;FV^R7308\R>?=G'7[@K M:G",DW)[$2DTTD?I(/B3X28@#Q3HI)X &H0__%5T08$ @Y!YS7RC!_P3(^!M MO/'*FF:SO1@RYU23J#FN/_;6^(WBGQQ\4O!O[._@+4Y-'N=<1)=9OX6(>.W. M<(2,':$1W8 C=\HZ$Y:IQF[08G)I7:/JK4/C=\.M)U1M-OO'WABSU%6V&TN- M9MXY@WIL+YS^%=A;7,-Y;QSP2I/!(H9)(V#*P/0@C@BOF+0?^";7P*TKPS'I M=[X9N=8O?+VRZM>P7'KFO&OAS-KG[#/[56C_"^76KO5_A M9XRP=*6_?<;.5V*K@] P?"M@ ,'4D9I^SA*_(]4+FDOB1^@V:,TM<[\1/!T? MQ"\":_X9ENY;"+5[*6R>Z@&7B5U*EE]QFL$:F9JOQM^'6AZ@;#4O'OAC3[X- MM-M=:Q;Q2@^FUG!S776=[;ZA:Q7-K/'?3^'=)_ (N-'\'>*K@Z9JVCFXDEAQO16(+ MDG&) XR3@H<<'%5[%7Y;^\3SO>VA^@>M:]IGARP>]U;4;72[)/O7-[,L,:_5 MF( K$\,?%;P3XVO7L_#OC#0=?NT!+0:7J<%S(H'4E48D5YU\=_V1_!W[1OB[ M0-8\97&HSV6CV\D,6EVD_DQ3%V#%G8#=VQA2OUKY4_;;_9&\!_L^_#*R^)/P MRAN_!NOZ+J%NJFWOYY1+O; 8&1V97!P<@@$9R*F$(3M&^K*E*4=;:'Z,YJI= MZS86%W;6MS>V]O/O@%HFNZ:]I:>+-6T M"&Z@DO5/V=+IX00SA03LW') '2OA'QCI7Q;T?]N;X)Q_%CQ)H^O7LMRLUA%H M2,EM;1;F##:T:'<2,DG)X'/&*4*?.VF]@E*UM#],LT9I:\O\)?M)^ ?&_P 5 M=9^'.D:K-<>+-(\W[7:-9RHB>6P5\2%0IP6'0UBDWL7=(]/S1FEHI#,W5_$N MD: T2ZIJMEIK2Y\L7=PD1?'7&XC/45HJP900<@\@CO7Y<_MF:+JW[47[0OC[ M3=$E=].^&GAN2?$8R'G4J\J?4EB/^V5?;?[&?Q2_X6[^SEX/UF67SM0M[8:= M>G.3YT/R$GW("M_P*NB=+E@I7,XSO)H]KS1FO(O%G[6/PN\">.=8\)>(?$T> MCZQI-H+Z[6Z@D6-8R%(VOMPS'>N%7+'. *X;P%_P4/\ @O\ $+QE;^&[+6KV MPN[J406MSJ5DT%O.Y.%4/D[<]MX7\ZS5.;5TBN:/<^ELT9I:J:MJMKH6E7FI M7TOD65G"]Q/+M+;(T4LQP 2< '@#-9E%K-&:^2+_ /X*B_ ^SOC!%=:]?1 X M^TV^F$1GWP[*W_CM?07PE^,W@_XX>&!K_@S68M7T\/Y4N%:.6!\9V2(P#*?J M.>HR*TE3G%7DB5*+T3.US1FOG[4?V\?@KI>D:W?W/BSR_P"R+LV$UJUI*+B6 M<9RL497+@;3EA\HXR1D5?^!G[9WPP_:#UN;1?#.J7,&M(AE73]3MS!+*@ZM' MR5;'< YQSC%'LYI7:#FCM<]RS4%]J%KI=I)=7EQ%:6L0R\T[A$0>I8\"OSL_ M:>_:E\.:+^VIX FA\3:C:Z#X3E>T\100I.L:RK(^08P,2\$<@&OH/7/VB?@G M^TQ\&OB%9OKVHS^%--L4DUN:"RF@FAA+94INCRQRG8&M'1DDFUHR5-.Z/=O$ M'Q#\->%_"-SXIU/6[.V\.VZAI=2\P/"H+!<[ESGYB!Q6AX;\2:9XOT&QUK1K MR/4-*OHEGMKJ')25#T8>QKX\^,&F^"]+_P"";&L0_#RZO+WP>;)7L)[\$3.I MO5+%@54_>W=A5?X4?MR_";X'? /X;:#KFLW%_K<6B6PN+'2+?[0]O\O21LA5 M/^SG=[4>R;C>.KO87/9ZGVYFC-<)\'?CAX-^//AOZU/>ZY& 9M.TFW-Q+!GD>8\YHS7DGP-_:I^''[0PN(O"&MF74K9/,FTN]B,%TB=-V MP\,O3E20,C.,UJ_&G]H7P)^S]HT.H^--:33_ +22+:TB0RW%P1UV1KS@<98X M49&3S1R2ORVU'S*USH_'OQ&\-?"[0&USQ7K%OH>DK*L)N[HD(';[J\ \G!K< MT_4+?5;"VO;259[2YB6:&5.CHP!5A[$$&OS7_;1_;4^&/[0G[/E]H'AB^OX= M:34K6=;+4;-HFDC4MN96!9>,C@D'VK[#\*?'[P7X*'PP\ :SJ,UEXEUW1+)M M/A>UD,4V80 !*%V Y4C!/7'J*UE1E&*;6I"FF['MF:,U6U34[71=,N]0O9EM M[.TA>>:9^B(H+,Q^@!KD?A#\9?"WQS\+/XB\(7<]]I"W#VPN)[62#LW&H:W"<7%CI%N;AK< M^DC9"J?]G=D=Q3C&4W:*N#:6K/5-6^*WA+0O'.E^#;_7;6U\4:G'YMGIDA/F MSI\W*\8_A;OVKJ\U^;][\&2&4"X)1 ME8=<,#D9'/6OM;7/VC? 'AGXFS> M6UU-.\0PV)U*5;J)XX([<*7+M,1L' / M4UK.DXV5M;$1FG<]*S1FO$]%_;+^$GB30O%VLZ3XG;4=+\*Q)-JES#8W&V-' M;:I3*#S.1_#FO3O ?CC1_B5X/TKQ/H%PUUH^IPB>UF>-HRZ$D9*L 1T[BLG& M4=T6FGL;V:,UP/ACXZ>#O&'Q.\1?#_2]0EG\4: GF:A:M;2(L:Y4<.1M;[Z] M">MY[3FC-?-GA+_@H=\$O&-QI-G:>(+V#4M3NTLX;"XTV82B1B%7<54J 2 MPYW$5]*4I0E#XE8::>PF:,U!?W]MI5C<7M[<16EI;QM+-/.X1(T R69CP !S MDU\N>(/^"F/P-T'6WTZ/5]3U9$?8U[I^G,]N#WPS%2P]U!![9IQA*?PJXG)1 MW9]59HS7!^%OCKX$\9?#63Q_IGB.U;PC$KM-J=P&@2+9]X.' ((/&,=QC.:\ M,;_@IS\#%UW^S_[5U20 >.N1C&:\2U[_@H7\$-"\) MV&O'Q/-?1WQ<6]A:6>? O]I?P#^T5IEY=>#=5>XGLB/M M5A=Q&&Y@!^Z60]5./O*2.V)/BS^S?\ '']I'P->W/B/6I/'VA:E%I^E MVT%I/%;M<+<959,Q8(W\9W 8JHTY-M-/03DK:'VGFC-&_BMHGPX MO]0EB\6:S ;BSM%MI&1T^?DR ;1_JVX)[5N_$/X@:)\+/!FI^*?$=R]GHNFH M)+F:.)I652P48502>6'05'*]--RKHZ+-&:YOPQ\1O#WBWP#9>-+'4$3PU=VG MVY+ZZ!@58<$EVWX*@ '.<5\\ZC_P4R^!FG^(6TP:SJ=U"K^6VIV^FNUL.<$@ MG#D>X0^V:J-.CR1Q7%">0> M@H5.;=DM0:,UYA\&/VE/A_\ 'W1[V_\ !VMB]:Q4-=V<\30W-N#G M!:-AD@X/S+D=LU\.>%_VT?!6D?MN>+_&>H^+-3_X5]=:8+:T4PW+QB<)"#B# M&5Y1^=O\ZN-&4KJVQ+FE8_3+-&:\U\"_M&_#[XA_#74/'VE:_'%X3L)9(;G4 M;^)[5(F0*6R) #_&N..2<#FO'F_X*8?!)=4%O]NULV!D\K^UQI,GV7/KG[^/ M^ 9]JA4YNZ2*:,UG>&_$FE^,-"L=:T6_@U/2KV(36UW;.&CE0]"#_ M )Q3/%7B;3_!?AK5->U:5H-,TRVDN[F54+E(T4LQ"CD\ \"HL[V*-3-&:_,O M]FC]M;P1X&^,_P 8-:\7^+-3;P_K>H>=H@E@N;A1%YLK?*@!\OY63@@?I7U_ MXP_;7^%'@CX>^&_&6HZU=MH_B-97TL0:?,TMP(VVO\I4;<'^\1GM6TZ,XNUC M-3BU>Y[KFC-?+?@K_@I/\$O&>NV^E'5M1T*6X<1Q3ZO9&* L3@ NK,%^K8'J M:]Q^*WQ?\+?!;P8_BKQ7?O9:(DL<)N(8'G.YSA<*@)(/K4.G.+LT4I)JZ9V> M:,UXWK7[7_PDT'Q#H.@W/BZ!]:UO[.+6PMH)9I!YVWRQ+L4B(GVX@GMFA4YMVL',NY[3F MC-?-GA+_ (*'?!+QC<:39VGB"]@U+4[M+.&PN--F$HD8A5W%5*@$L.=Q%>T? M$WXK>%/@YX7F\0^,-9@T72XSL$DV6:1ST1$4%G8XZ*":3A).S0*2>J9U>:,U M\O>&O^"D'P6\0Z]:Z9-J.K:&MTX2"_U;3FAMI"3@'>"=H]V [D5PG_!3KXV MZ;X8^%>G^$]-UV[T_P 5ZC<6^I6WV R)YEJI=6;S4XQG'&>:TC1FY*+5KDN: MLVC[<+!023@#J35#2?$&EZ\LK:9J5IJ*Q-MD-I.LH0^AVDX-?._P-_;3^%/Q M+3POX&TWQ#=WOB:ZL$MFADL+A=TB09DS(R8_A;DGFE_8STKX/>&O#GC>X^%. MJ:MJ&GIJ'_$V?5%?='.B$X0-&A(P3TS4NFXI\R8U).UCZ6S1FOG._P#^"@OP M0L/"#>(3XJ>: W#VL=E'9R_:Y74 MMB(!"_,/G;"YXSFNJ^ _P"UG\.?VBY; MRV\(ZK-_:=HGFS:;J$!@N!'G&\#)#+D@$J3C(SC(I.G-*[0^:+=KGL6:,UYO M\:_VB/ ?[/ND07_C36EL&N/Z+_P4Q^!6JV- MQ<3ZYJ6DO"0!;WNF2F20$XROEAP.;'X9^ M?\5:EDV.D64EY(H/+[5) M"CW)P!]:BS;L47_$7BK1?"%@;[7=7L-%L@<&YU&Y2WCSZ;G(%9?A?XJ>"O&] MP;?PYXOT'7YP,F+2]3AN6 ^B,37PI^SG^S[<_MN7E_\ &+XTWM[JFDW5U)!H MWAZ&X>&W2)6P>5(94!^4!2"Q4DD]_7OB/_P33^%/B'3#+X,@O? 'B. ;[34= M/O)I460?=+I([<>Z%3[UT.G3B^64M?P,E*35TCZGN]?TS3[^WL;K4;2VO;G_ M %%M-.J22\X^52S7P#^TQ87.E?MG?LQV5Y<&[N[:&VAFN"Q;S76;#- MD\G)!///-??]93ARI/N6G=LS=8\2Z1X>$1U35++31+GR_MEPD6_'7&XC/45# MIGC#0=:F$.GZWIU_,>D=M=QR-^2DU\.?\%/M'M?$/C/X':5>H9+.^U:6VG16 M*ED>2W5@".1P3S7?^(/^"7GP8U*Q=-)37?#U\!F&\M-1:0HW8E9 P(SZ8/N* MT5."BI2>_D3S2NTEL?7>:RM0\6:'I%\EE?:SI]E>/@K;W%TDLDL*S2J@]VV8'N151H7GRMZ6 MO<3GI=(_4/-4K'7=-U.ZN;:SU"UN[BV;;/#!,KO$?1@#E3P>OI7BW[%WQT_X M7O\ [2M1O9,^(]+_P")9J\;<.)XP '(_P!M<-]21VKQ?]AW_DZ#]I/_ +# M_P#1\]9^S:YK]"N:]K=3[:NKJ&RMY+BXE2"")2\DLK!511U))X IME?VVIVD M5U9W$5W;2C='- X=''J&'!KXN_;WT7XZ/X \=ZAIWBKPYIWPNAM4,VG0QR#4 MYXCL5T9S$5P7)Z,,KP3U%>S_ +$7_)J7PV_[!@_]&/0Z=H<]P4KRY;'L^IZK M9:+8S7NHW<%A90KNEN+J01QH/5F8@ ?6L'PQ\4_!?C>[>U\.^+]!U^Z0$O!I M>I0W+J!U)5&)%?%/[3*]"O[;[)=Z5,\9EW/MVD;N6 M'W@PYX.<@U:I1]U-ZLES>K2V/OK-&:Y+X1>(-2\6?"OPAK6L1>3JNH:3:W5T MFW;B1XE9N.W))Q6OXO\ #X\6^%-9T1KE[-=2LYK,W$0RT0D0KN'N,YKGM9V9 MH8FM?&?X?^&]0-AJ_CKPUI=\&VFUO=7MX9<^FUG!S75V=[;ZC:Q75I/'=6TJ MAXYH7#HZGH01P1[BOEO0_P#@F9\"]+T)K&\T/4=9O63:VJ7>J3I.&Q]X+&RQ M@YYY0_C7F?\ P3YO-4^'7QR^+WP=35)]6\+Z!,\UBT[;O)99O+..PW!AD#C* MYK=P@XMP>Q',TTI+<^]LT9I:YGXA_$GPS\*/"]SXB\6:Q;Z+I%O@-<7!/S,> MBJH!9V/95!)K!)O1&ATN:,U\LZ+_ ,%*/@IJ^M6]C-J&L:3;W#[(M2U'3'CM M7.< [@20/AWWBS5)K+3=9;99W\%I+<6[G (S)&I" MY!R,]1DCH:MTYIV:)YHO6YZ9FC-9]_XBTS3/#\^N75]!#I$%L;N2]9QY2PA= MQ?=Z;>"?L*MX@NM9GNH([CR=)M&E:%'4,OF$E5 M5L'E,[AW KV+X3_&?PA\;O"*^)/!^K)JFF[C'+\I26!P,E)$/*M@_CU&15.G M.*NT)23=DSMLT9KQ"S_;4^#MUX0U/Q-)XPBL=(T^];3Y7N[>6.5YPH8I'$5W MR$ @_*IKK++]H+P#>?":+XE-XAAL_!DJ,Z:C>1O#NPY3 1@'+%E("@9/8&DX M26Z#F7<]#S1FOE;3_P#@I;\$[[5X;26_UJPLYI/+CU6[TMUM6YQG()8#W*\= M\5]#^(/B+X9\+>"Y?%VJZY96?AJ.!;DZFTH,+1L!M92,[MV1@#).1C-$H2CH MT"DGLSHLT9KY.C_X*>? Y]4^S-?ZW%:[]@U!]*?R#[X!+X_X!GVKVGQC^T9\ M._ ?PVL/'FL^);>W\,ZC&LECI6EK>7&/)MYYU227)P-JDY//'%?,WAO_@I;\$?$.L0Z?+J> MKZ.9G"1W.HZ:XB8DX'*%R ?4@#UK1^/>@?!W5OVA_A5>>--4U6V\* M=>71]7U&V:[@^T1.(!$N[+/+C8GW&ZD?K7E-I_P4G^!EYXK31%UZ^CB>7REU M673W6S)SC)8_,%S_ !%0.^<5*ISEJD-RBMV?46:,U3NM9L+'2)-5N+VW@TR* M$W#WDD@$2Q ;BY;.-N.<],5\PZC_ ,%,O@9I_B%M,&LZG=0J_EMJ=OIKM;#G M!()PY'N$/MFE&$I_"K@Y);L^JLT9KS?X.?M#^!/CX=;/@C5WU>/1Y(XKN0VT ML*@ONV%2ZC<#L;D5Z34M.+LQIIZH3-&:\\^,O[0'@3X!Z/#J/C778M+6X)%M M;*C2W%P1UV1J"2!QD\ 9&2*\J^'7_!1+X,?$CQ-::#::MJ.EZC>S+;VJZG8, MB32,<*H9"P!)/\6*M4YR7,EH)R2=FSZ8S1FOGSXR_MU_"GX&^++KPSX@O]2N M-=M AN+/3[!Y#'N4,N7;:IR"#P3UJ]\$_P!M7X5?'O6QHGAS69[;7&4O'INJ M6YMY9@!D[#RK$#G ;. 3C%'LYVYK:!S1O:Y[KFC->9_$#]I'X??"WQSI?A+Q M3KRZ/J^HVS7<'VB)Q (EW99Y<;$^XW4C]:\IM/\ @I/\#+SQ6FB+KU]'$\OE M+JLNGNMF3G&2Q^8+G^(J!WSBA4YRU2!RBMV?46:,U5N-7L;32GU.:\@BTZ.$ MW#W;R 1+'C=O+9QMQSGIBOE_Q!_P4Q^!N@ZV^G1ZOJ>K(C[&O=/TYGMP>^&8 MJ6'NH(/;-*,)3^%7!R2W9]59HS7#^#_C=X'\=_#I_'>D>(;67PG&KM+J5QN@ M2'9]\.) I4CW%>&W?_!2_P""=KJC6Z7VMW-BLGE-JT.E2&U!]"M(\47_C**VT_5U=[*$VTS74JJY0MY"H75=RD;F ''6DH M2>R'S);L]TS1FO&?BY^U[\,/@II6E7?B/76\_5;9+RRT^S@::ZEA<95RG&P' MU$OV M'?'?AOQ3I&K7/[1OC75K>QNXKF2PN))_+N51PQC;-T1A@,'(/7I7!Z5B+_@K M+J?V[AGT8_9-_P#UYIC'X!_UKK+?_@JU\';FXBA32?%X:1@@S86^,DX_Y^*A M_;3^$'C#3O'W@[X^?#/3Y-5U_P .JBZAID2%I+BV&2&"CEAM=T8#)P01T-4N M?FM4TNFB7RVO'H?:5? __!2;$GQ7^ 4=K_R%#K#&/;]['GV^/UKN-$_X*B_! MVY\/+=:P-;T7643$^COI[2R+(.JJZ_(1GH6*^X%<#\(O#WBS]L_]IG2_C)XB MT"Z\.?#GPRH&@6E^N'NW4DHP'\7S'>S#Y?E503@FIIPE2ESS5DBI24ERQ/9/ MC+^U3\1_AI\0M1\/Z!^S_P")?'.EVRQF+7-.EF6&A M_L\_&#Q1\8_#VIZAXI^&VJ_#2ZM+H016.K/(SW"; WF+OAB.,G'0].M>KUQ/ MQG^(L_PF^&FM>+;?1+GQ$^F(DITVT)$LJEU5MI"MT4ENG;MUK"ZDE%1U+LUJ MV>4?M1_L]_$WXSWT.=.T.;Q?\&[OP?8>$/&/A65I;\Z9))+%J(W!&G+R%G+9*=6(PRXP. 0_\ M%4/@T^B/=RP>([?4$0G^S'T]?-+_ -T,'*=>Y85A_L&^$/%7CCXM_$?X\^(] M(ET"T\5*UMIEG.I5I(6D1RXR 2H$4:AL?,=Q%='+)4VJBLNGK^IG=.2<3._X M)=@KJ?QK$O\ Q\C78]^>OWI\_K3O^"JO.C?"=4_X^#KS[,=?NI_7%8&C^,X_ MV"?VJ/'Y\8:??)\.?'$OV^QU>TMS*D4N]GVD#KM,CJ0.?NG/C'QQ!^WY^ MTO\ #S3_ 587\_P^\'3_P!H:GK%U;M%&[;UF1&JJ#@G(/$$7,4\HR-L;=&P-RIZDLWW5!JW_P4B_:2U;P;K6B_"ZUO+CP_H.M M6BW6M:Q8();MK9G9##$A90,A3GYAG(&0,YS_ (.?M^_LZ_ OP-9>%O"OAOQ= M:V, W2S-I]L9KF4CYI9&^T?,Q_(< 8 K*G3E&/.E=O8N4DWRMZ'W[I.EVNA MZ59Z;91""SLX4MX(EZ(BJ%4#Z "OB3]J?_D_[]GS_<'_ *.>OICP3^T-X6\= M_!.;XIV<>H6OAB&VN+J1;N!1<+'"6#G8K,,_(< &OSZ^.7[8/PZ\??M7_"7Q M_I-SJ#^'O#:XU!Y;,I*O[QF^5,_-P14T(2YGIW'.2LC]4Z\E\&_LP>!_ GQ@ MUSXEZ5!?+XHUGSOM3RW1>$^:P9]J8XY45L_!/XY>%OV@/"4OB3PE+=3:9%9]HD M\J1%7=EBO(8YP*QC&:YDNFY;<=#ZIKGOB'XRM/AYX%U_Q-?,%M-)L9KQ\]]B M$@?B0!^-=#7QY_P4S\>W.F?![1_ FE,7UGQGJ<5DD*'YFA1E9ACW-M%T[Q3XQU666[M;ZX D$ S@,/1FD MD/TQ6G_P3>\=Z7X9^*_Q3^%VF:M!JNA_:WU71+JWDW1S1J^QBI]T,1_X":^B M/!O[#_P=T/PEHVGZEX T74]1M;.**YO;B#=)/*$ =V.>I.37S1^T7X#T+]C[ M]J/X1_$3PEI%OX?\*WTITW4K:S3;$ISMD)'O'+GZQUVE6=EJFE:O;1VMS;0+&\<;!P4! 'R\*<=,@56\'NLG_ 50 M\5NA#*WAI2".A'DP5U'_ 5(_P"36Y?^PS9_^STDW[2FO)!;W)'TY\/KZ;4_ M 7AN\N'+SW&FVTLC'JS-$I)_,U8\8:AHNE>%=7N_$Z_L"^(-0\5_M5?';6-6T:;P]J-]LN)M*N&W26K-,Q\MC@?,!C/ MYKNE'EC-*?B!\8/$>LZ#9:KK.F^('@L[F\B$O MV=6>4ML5L@,2!\V,^]:O[6'A_3_!7[;?P UW1+.#3+_4[P07DEK&(_/ F5/F MQC)VR,N3VP.U:7_!-#_D+?'+_L9O_9IJ3]MG_D[7]FW_ +"9_P#2B&AM^W:\ MOT"W[M?UU*7[46AZ:W[?GP(B.GVIBNT9KE#"NV8^9)RXQ\Q^M>\_M;^'M*T+ M]EKXH'3=,L]/,FC2;_LMND6[!&,[0,UX3^WC ?VA_P!F/XQ0>";^ZOSI>A[[E[BT M> +YA.T#> 2?E/:HLVJV626Y=QEM[L"2/]G.!V%>%WO_*)2'_L%+_Z7U=_ M9_\ ^"@/PJ^&/P*\)>'/$QUW2];T?2H8'M'TQV-SA>'B8':58<@L5IRC*49* M/\S$FDU?L@J MA^RO\/M9_:#^+/Q+^-_BG1[C0]"\3V$FC:+:70Q(]JZ+&TF/0(BC/0EFQP*Y M']G+X[P_L)WGB/X2?%VPU'3-/BU"2]T?6[>U::"XB; )&WDJ=H8%0<$L#@BJ MG>47&/Q:7$M&F]M3?_;5T"Q^"?[2/P8^)GA>UBTC4]2U0V.I"T01K=J'C!+@ M<$E)'4GOQZ4SX>^';#]HK_@H;\1K_P 76T6KZ7X(@^RZ;IUVHDA5D<1JQ0\' M#>8_/<@]JR]=\7S?\% /VD_ 8\(Z3J$?PS\$W/VZ^UF]@,2SR;EP6) %2^.O%%Q^Q+^VKXB\>:]I5]=?#SQU;_/?646_R9CM9AR0"RNI.W()5 M\C.,4U?EY/M6_7_(3M>_2YW_ /P4^\*Z+;_LUMJ$6CV$5_!JMK'%=):H)8U) M8%58#(!] :P/VU?A[=WW[,/PR^(^B*4U_P #P:?>K-&/F$#1Q!C]%<1M],UY MG^V_^V+X>_:!^"]SH?@;0-;O]%MK^WFO_$5W;>1:V[@MLB&_8YT*\\.OOU?XC1V^G6<$)RX\P SJ/I@Q_5J^B_@%\+K?X,_![PMX0@50 M^G6:+<.H_P!9.WS2M^+LU?G3^QQ\+O$OB[]I'3O!/B:4W?ASX1W5[<1QD903 MM-A!Z'+@./9#7ZKUG62@E37K_E^!4&Y>\SD?B[XLF\"?"SQ=XBM@#'9FV1:M83V3/\ W?,C*Y_#.:_/S]EO]J[2 MOV0/#NL_"/XN:;JNC:EHE_-)9W$%H94FCQV'Q>\/Z7H/_!2OX0?V9IMIIWVG3VFG^R0+%YKXN1N;:!N. !D\\5A? M%WX6^'OC#_P4SL?#GBFUDOM%?08KB6U25HQ,8XF958K@[<@9 (SBL"'XT'X[ M_P#!0+X2>);;PWJ?A[16M7ATU]601RWT(6<^>$'W5+%@.3G;U[#TR^_Y2MV/ M_8LG_P!)WKHUCZ\IEH_O/1/VL/A;X-^&W[)7Q,3PIX5T;PWYVF1I*VEV$5NT MH65-N]D4%L9/WB>IKL/V*/\ DU7X:_\ 8*7_ -":M[]I[P)J'Q,_9_\ '7AK M2H_.U.^TV1;:(=9)%PZH/\2VT.K>*+O6WMK>XND$AM4P'/EYS MM.&5O3?:=J&C1L_E')V@D*0&VD* MR-M/R@C(Z[23?-!;V1FGLWMJ=7_P4$T'3-/^-'P!O[73K2VOKGQ %GN88%26 M4+-;[0S 98#)QGU-?>-?EM^T-\8_&OQK^+7P/U;7/AW>> O#B^((TTI-43:/C?\ X*A^,]2T/X':-X>T MZ=K8>)=8CL;ET.-T*J7*'V+!,^PKZ'^$_P %O"?PN^&VF>%=)T2R6PCMD2YW MP*QNY-HWR2DCYRQR>?ITKRO]OOX&ZO\ &[X'-'X<@:Z\1:%>)JEG;)]^?:K* MZ+_M%6R!W*@=Z\^^'/\ P4V^'5GX'L[;Q[#K'A_QCI\*VU_IW]GO)YDR##%" M.F2,X?:03CMFFHRG22AWU%=1F^8Y;]OCPOI7AR+X4?"3PM8P^&_#?BSQ(UUJ M%IIX\N)F,D2<*.%&9"VT8&0#BOLV/X.^"HO \$CPUIO_",?9_LQTXVR^65Q MC.,?>[[NN>%F=WVG&-GF_=V[N^ M,K*33?$/CBQOK_P"Q3*4DBA\F5E+* M>5+-(QP>:>"=$L_ M 7_!4C7M-T*VBTW3M4T$W%Q:VR!(R[1([':..77=]2:L_M>Z+I^D?M@_LV&P ML+:R,VLAI3;PK'O/VF'EL 9/UJ:+_E*Y-_V+0_\ 2<5-^V;_ ,G@?LS?]A&?AWX=USQ!!+:QOJFL3VIM[7381*A!8G)+%@% X'/!/2DH2DZQM]3L(2P7SV4,KQ@G@$JQQGN .]6?!G[=_Q(&A6'A:X^ M OBK4?B!!$MI(OER06TDJC;YKEH\HIQDYX'/S8YI3BYQM#HW<(M1=WV'?\$Z M(;/1O'G[1<44<%C86OB&-51%$<4,:R7? P%4 ?0 5I6W[9OPZT#6=2\-_!; MX0ZQX^>&1OM<_AC25BM9&).6+JC.V3GYF7!Z@FO-?V*=!\1^.O"?[5.E2Q0Z M?XJU:9K=XH'_ '<=TZW@9%;)X#'&00X&%PV!@#!K2<.:4G:[TT^0E*R70?^S)K]]J?_!0W M7+J?P+-\,GU70Y9+KPW,P)!V1MO8!$'SD;\;>I-=?\/_ UI$_\ P4Z^(&GR M:5926":"K+:M;H8E/EVW(7& >3^=0(D$6G[+G_ 4)U/QWXTM;V#PCXDT9 M8(-2M[=I55A'&IX'7:T6"!D@,#BB2;DTM^42VOYEO_@H]X@M=%\0_"?X?PZ- M=3^%]1U%M3U/1= MP)K\(Z*L2(N-S$%\#U(]!77:A^UMH&H^"9O",G[./Q*' MAR6U-G_9J^&5$"Q8P%"9P,=O?FN9_:9OF_:8\%>#OCC\%XKOQ!>> M9D#VS6 MKI+<(IBD8I&?F8*0N1C)#-@<5VV@?\%1/@]=^'X[G6_[:T/6D3%QI+Z>TKI( M/O*KK\I&>A)4^H%3RMPBE&[7YE77,];!_P $S;#Q/H/P>\0Z)XAT;5]$MK+6 MI&TVVUFTDMY! Z*V ' R-V>G&2:^O+BWBNX)()XDFAD4J\7_ M +/'QVC_ &A/"5_XEM/#FI^'=*2^:VL?[57;+=Q!%;S@ , $L1P6'R]>P]4K MDJMN;;5C6*M%6/@G]B3PSH^I?M*_M%V]WI-C=06^K[88IK9'6,?:)QA01@=! MTKW3]I'XO?!OX#)X>N/&>A6FKZW$)!H>CV>FQ7%T@8C>T2MA8P6 &[(R>F>1 M7S'\/?C#HO['G[7'QGM_B1#?Z7IWB:Z^W:??Q6KRI(AE=U("C)!$A&0#@J0< M54^-?Q6TG1OVGOA;^T5/I>H:[\*]0TXV]M=BU^:WE1IHB=C<*P8[U!()&<":V\5:U'Y)L_P!X MH!4&$$AP=N ^/F[XKN?VJ[Z?4_\ @FEX*NKF1IIY+;1B\CG)8[!R:P/VOOVU M?#7QU^ _B;PY\/\ P_KNMV)%O)J>NSVIM[2P03(5!)R6=F 4#CKD$XK7_:=_ MY1C>!O\ KUT;_P!!%6E;DNK:B;OS:WT/>_V?OV8OA9X$^%GAC6K?P5I6H:R^ MG6^IR:IJEJEW=F);:'5O% M%WK;VUO<72"0VJ8#GR\YVG#*N1T" "OL7X1HLOPB\&(PRK:)9@CU'D)7PGX( MUGQ[_P $^?B3XUT6Y^'VL>-?AWKUZ;[3M0T:-G\HY.T$A2 VTA61MI^4$9'7 M"+(O"FM>//#?A+35NH?#FBVGVIYKB1-_FM$3A ME!:/.?[@'>N1_:&^,?C7XU_%KX'ZMKGP[O/ 7AQ?$$::4FJ.3>7C>=!YCLA" ME5QLQ\O.3ACV]D_:S\.^*?@/^TEX:_:$\.Z'<>(M"CM!I_B"TM%)DBC"E"YQ MT4H1ACP&09QD5M%*M*GLO$EC?06#'4K4Q7<< M22S*BG> P&T+QW&*][N/^"H?P431ENK>;7KR_=.F>HYJ8WBXIQL MKC=FFT[Z'TA\+_"6AV7P_P#"][;Z-I\%X-)MV%Q%:HLF3"N3N SDY-?)G_!- M;_DE_P 9/^P["+&ZU"+Q;<6$=H]A+9N%CDB@ M^?,GW2OR'!!].!7G/_!-;_DE_P 9/^P[$]3^'/B#Q=>Z!8WWB-=9ELX]0NHA+)%$L<;!4W9"/]"L? M G_!3SX=3:%:PZ8-;TIFO8[5!&LS%+A69@."2$3/J5!KH?\ @E1_R03Q#_V, M=Q_Z*BK.^-W_ "DQ^#G_ &"6_E=5HVW5GZ,A+W(F3\+]"L?C]_P4-^)FI^++ M:+5K/P5#]ETNPNU$D43(XC5MAX.#YC?[S ]0*[#_ (*B^'M*_P"&;&U+^S+/ M^T8-5M(XKOR$\V-3N!57QD @= :X[XK:'X\_9)_:MUSXN^&O!]]XV\$>*X-F MJ6NF(S2V\AVEMVU6*_.@8,1M.XKD&O-OVS?VE_&GQX^!LR0_"O5?"'@F#4+= M[C6=>8I+--EMD<*%5SW)(W=.W=QBY3A*.V@FTHM/<_1KX5?\DO\ !_\ V![/ M_P!$)7DG[?JW#_LD^/\ [/NR+> OM_N?:(]WZ5ZY\+%*_#'P@",$:/9@@_\ M7%*L^/\ P78?$7P3KGAC5%+6&K6-CRG] MAM[5_P!E#X8<>BKSZCK6TZ,Y3;BKI]3.,XI69S?[7?_ "??^SO_ M -=(_P#TI-?=U?F_^VY\0X_ '[2W[/\ XS\3VL\:Z;I\.H:C;6D8,JL)=TBH MK,.0OQ?T3QII_P"SO\1K&*\BT&>^EU)8YXU% MP(DE@+ J&(W84\;OQKU:^_X*E_#R^@:'PKX0\8>)M8?B"SCLHXU=NP+"1V'X M(WTIRISE3BDMK_F)2BI.[.6_;U43_M5_L\0Z?@ZQ]O0X3[VS[5%MS[9#_K6S MXS_Y2G^#/^Q<;_T5<58_9U^"GQ"^+_QU?X\_&'2_[ GMHO*\/>&Y 0]LN"%= ME/*[0S$!L,68L0,"J_C/_E*?X,_[%QO_ $5<5::7N+I%B\^[*#C_ (8Y_;@# M_P#'K\.?BCP>T5K?;OR&)&_[YF]JT/V'?^3H/VD_^PP/_1\]>V_MD_ L?'KX M(:MI5I'GQ#IW_$RTB4<,+B,$[ >V]7 M5+G[))=/(,,TA>;<2/7.P(,:, 2- MP) Y%6OVI?VP/!W[0GPPN?AA\)(]1\<^*/$S10>5;:=-$EL@D5V9C*BG/R@9 M *C))(Q6\.9)-"??H^IVD=S:_+M M(1API'8CH1V(KH*^6_%OB+6_V(?V*M#DL[:RUG6O#]O:VDL5T7,#22R_O,%2 M#@%VQSV%==X3_:*U#5?V1%^,-_I-L=171[C4WTVV=DA+1LZA0QR0#M&>O>N) MTWO':]C=26SW+'[5G[2^E_LY^ VN5"ZAXNU,&WT31T^:2>8\!RHYV*2,^IP! MR:XW]A;]G?6/A'X2UCQ9XS9I/'OC"87VHK)R]NA)98V_VB79F]"0.U?%WP4_ M:Q^&R?$Z^^*_QE3Q%XK\?O(1IUM96$+V&E1#[OE!YE)8#IQ\O)Y8EJ^V_@K^ MW]\-_CQ\0;'P=X=T_P 16^JWDL!J;^&]&MOM,MY.^\AC%D! ME&Q,Y[!O4U^B5?$G[9O@[Q7\+/CEX*_:#\)Z+-XAM=%A^Q:W86RDR"#YQOP M3M*2,"V"%*J3Q65!I3U*J?"9WQI_:=T[XO?"C7?!MU^S]\2_+O+-XK,S>'/D MM9@I\J1<'Y=K8Y';-=9^SS\'KGXW?L+Z=X!^(NF7VFWBK<6MO_:5L\5S:&.5 MOL\H5P"-H(QZKQT-3#_@J)\$SHB7@GUYKYDS_9:Z83.&_N[MWEYS_MT[XM_M MLS:'^SII'B33?#]YHWCOQA)+9>'] O%+7*GS#&MPR[1D8VL!C!+J 2.:VM.R MBHVU)O&]V[GRIX=\4_$_XB)IG[(6H7L%C+I^KR6FHZV+D,SZ=#\XA7^\ 2! MG) 12!@U]3_MQ^!M'^&G["^K>&- M%LM)TS[#;P1+UP+A,L3W8G))[DFO'O& MG["NO?#?X Z/\0-!O+F7XU:#2X+8>2$?WC&!G_ &CO_O"NE^/_ M .T#IG[1O_!/+6_$MH4@U2.:SMM5L5/-M4^A]0:T;4I1<-KZ^ MI"T34M['T'^RI\(?!7AW]G_P=]@\+:7$^JZ/;7-_(]JLCW4DD2LYD9@2V23P M3@= *^>/V7=+B^$?[=7QE^'VB+]F\-7-B;^*R3_ %<+ QN@4=MHF=1[8K7^ M$7_!13X2^ ?@OX8T76VUVSUW1](M[633FTUB\SI$HRC [-K8R"S#@CI5[]B7 MP/XD\QN 1(+7(._!YVX2-0?XL,>F*SM**FY[/_ M #+NFXJ)YI_P3I_9\\ _$RW\=>*/%OAVU\2:A8:Y)9VL.IKYUM$FT,3Y+?*S M$GJP/08Q5G]MO6]&T']H7X2_#Q?"%UJ?@+1H#K$OA'PO8K_IC/ZUWG_!+'_D0OB3_ -C/)_Z+6KG[<7P_\6^$OB;X!^/'@O29=>N/"I\C M5-.MU+2-;;F.X G;AY%8@';D'H#5N7[]IOT^XFW[M6*'Q*_:HTCXC_#/6/! MEY^SU\2SIMY9/;0PMX; C@;:1&R@'Y2AP01TQQ7BVJ?#3XG^,O\ @G5HNDR: M!K)O_#/B&26;1KJUECN9;%0Q4B-@&95:7H!T!QTKZ.M?^"HOP4ET)+V>;7;? M4"F7TK^S2TRMW4,#Y9Y[[A^%:^O?MMS>'_@[X:^)UU\.M=B\.:EJLUG=6I0_ M:[6U4-Y=R05"X8J."0.>&-)<\+)0MJ-\KW9Q'PU_;\^ ?BSP?IW@WQ7H[>$8 M$@2SFTG5M+6;3T8#:5!0, N>[JN.^*Y;]N#P/_PB%_\ !3QUX7\,+XK^%GA/ M!ETJPS/;)#O21&_B'ELHP&.5^4 ]153]J#]JSX ?'CX4:II.AZ/-XJ\>ZG"( M=*C30W6]M[@D;3YI4'CT1FSTPSC,IL+AIY&6"0' .V-D! ;<,=#0HN+4HQ=^S$W?1OYG1>'?VR?V(_B1>:C&ZZE8Z.]K)%%@[Q+(RJS#) M4Y.57!.1W]%_:5TVYT?]K']E>PO)OM%W:K#!--G/F.LD:LWXD$TXP46FKK1Z M/T"[:?R(?VL?!NC?$#]O[X-Z!X@L4U/1[S3L7%I*2$E"O.P#8(R,J,COTKU_ M]N?X8>%1^R5XP2W\/Z;9C1[:.YL/LUHD?V9EE0?)M VY!(..QKSKX_\ _*2+ MX'_]@YOYW%>W?MQ_\FG_ !(_[!P_]&I6=VG3_KJ596D?(OQ[^(6LK_P3P^#6 MC17DD;^)6MM.NYPQRT$8;"$^A*IG_=K[T^&OP>\)_#KX=:;X4TK0[%-+AMDC MEC:W1OM+;?F>3(^=F.22<]:^/]1^ FJ_'S_@G1\.+'PZHE\2:/;1ZG80E@OG MLK2*\8)X!*L<9[@#O6GX,_;O^) T*P\+7'P%\5:C\0((EM)%\N2"VDE4;?-< MM'E%.,G/ Y^;'-.<7.-H=&[BBU%W?8E_X)Q6=OIWQ"_:'M;2".UM8/$44<4$ M*!$C4278"JHX XP*^XJ^$?^"9,VIW7BKX\SZU;Q6FKRZY;M>06[;HXYBUT7 M53DY 8D#DU]W5CB/XC^7Y&E/X4? 'P]\.V/[1/\ P4/^(M_XNMX]6TSP1#]F MTW3KI0\*LCK&I*'@X;S'P?XB#VK[7\4?"_PEXT:P?6_#NG:C+I\T=Q:32P*) M;>1&#(T;C#+@@=#['BOB+XFWNK_L5?MA:S\4[K1+W5?AIXSA\O4+JPCWFTE; M:6SV#!UW $C<&(!R*]8M_P#@HY\-_%/B30?#W@FPUOQ;K.K7D-L(HK)X([=7 MF)-)+_P"$6I?" MC4?[:A@%WJ!VS:BGGQ##+Y2'Y Q'.>'Q6]\'_C!HO[%O[1WQ=L/BIIFH6UQK M]\;NPUN"T,WFP&61QCN58.IRN>5(.,5G?M ?M#0?M"_'CX$ZGHGAG5]+\*6G MB"..QUC58O)_M%S/!YAB3GY5POS9Y+=!BMX0Y9:+2V_R(%1^R5XP2 MW\/Z;9C1[:.YL/LUHD?V9EE0?)M VY!(..QKSKX__P#*2+X'_P#8.;^=Q7MW M[3S)D&&*$=,D9P^T@G M';-.<93C:'1NXHM)WEV.0_X*'0Z/\,?#/P[^'/AK0Y=.\+^(M>DU'5-'T"+# MW>UH\QQ1@XRQ?(48&X+Q7;V_[7/A^T\&CPG#^S?\28_#8MOLG]ECPT/(\K&" MI7.#_DUS'[0T?B+]KGX'>%?B]X"\,ZCI^M>$M:EN]/TN[3-U>6JLA\U4 Y.Y M%8*I;(! )-=CX5_X*@_">Z\.Q2>*(]9\-^(HDV7FE-I[RE91PP1EXQG.-VT^ MH%59N"7+=K<+I2>MCR']G?3O$?A[]CW]HC1M6T#6_#VBPQ7=SI%KK=G);R+# M)"^0 X&<;%SC(R3ZUZ'_ ,$__P!F3X9:U\ - \7ZWX0TWQ'KVJF* MBI,Z*L<<@*H,+V&J:#HEKIEU;6,^JIL>^3 MR-QE51E0,G'#-TZCI70_\$\O^31_ _TNO_2F2IG*7))[._Z#BE=+R/G'XP:V M_P"RI^V_>?$KQ?X,N]=\"7^GQ6NEWMC;*Z:?B.- (@V$5TV,NW*G:^17TC\+ M_C_\!?VF_&>D7FD2V5QXWTQCI69MM0BPI#>6Y'SC:3E59ACDCBL;QO\ MMW>$/A=\5O$?@3XE:'J>@V=M*!8ZP+-[BUO8&1225 W<$D?*&!QVZ5\]PW7@ MS]HO]M+X;Z]\$/#Z@+ZXT+39[X'<+F6S MC:0'UW$9K8Z4M% %74=,LM8M'M;^T@OK9_O0W,0D1OJI!%)IFE6.BVBVNGV< M%A;+RL-M$L:#Z*H JW10 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 ) MFC-+10 F:,TM% &8GAK1XM6;5$TFR34V^]>K;()C]7QG]:TLTM% "9HS2T4 M0W=I!?VTEO=01W-O(-KQ3(&1AZ$'@U6TC0=,T"!H=+TZTTV%CDQVD"Q*3ZX4 M"K]% "9K-U3PUH^N3PS:EI-EJ$T/^JDNK9)63_=+ X_"M.B@!!@ # '8"J6 MK:)INOVPM]3T^UU& '<(KN!95SZX8$5>HH KV-A:Z7:QVUG;16EM&,)#!&$1 M1[ # I+_ $^TU6TDM;VVAO+:08>&XC#HWU4C!JS10!5T[3+/1[1+6PM(+*U3 M[L%M$(T7Z* *P/BAXDU+PC\//$&KZ-I5UKFL6MG(]EI]E"TLL\V,1J% R?F M(S[9KJ:*:>MV!\P_L!_!K6?AC\*-0UOQ;97%GXT\5:A+J6I1WB%9T&XA%<'D M'[SX/]^OIW-+153DYRG2OC_ M ,->#?BY^U/^TQX(^(?C?P'+\-/"7@QO/MK*^F+W$\H;> 55B2P3)V* %[F MOO"BM83Y$[+7N0XWZD5S;0WMO)!<0I/!(-KQ2H&5AZ$'@BJ^E:/I^AVOV;3; M&VT^WSN\FUA6),^N% %7:*R+.-^,.J^+M$^&NNW_ (#TR#6?%MO"LEA87./+ MG<.NY3EE_AW?Q#VYKY)+]M4U9H&WI& MYSMC##AB,L21QECC(Y/N5UX:T>^U.+4;G2;*XU"+'EW:6B@!, MU\J?$C]H3X]?#/XFZ_86OP1G\=^#5F!TN^TF9HIGC*+G>5$O1MW5%/\ .OJR MBKC)1>JN2TWLSX@\*?#OXM?M2_'SPC\0?B;X03X>>#O"#&XTW1)IO-N;B?(8 M%AP?O*A)95&$ .2:^WJ6BG.;G;R",;&-;>#?#]EJ)U"WT+38+\G/VJ*SC67 M/KN S^M;%+1691E6/A;1=,OY+VST>PM+V3)>Y@M421\]&?$'PVE^%'P[L[^.^U*;4[DR7,^W("J&5&)P6P F,G);C M%??=%;QJVT-W;/PT,\8=&^H(P:JZ/X;TCPZKKI6E66F+)RXL[9(@WUV@9K2H MH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* (YH8[B)XI8UEB<;61UR& M'H1WJCI'AO2/#YD.EZ59::9?O_9+9(M_UV@9K2HH 3-&:6B@!,T9I:* $S1F MEHH QH_!OA^'4_[1CT+34U#=N^UK9QB7/KOQG/XUL9I:* $S7SW^WIX/USQW M^S)XET;P[I-YK>K3S6IBLK&%I97"SH6PHY. ":^A:*J,N62EV$U=6/,/@MX# MLX/@_P##Z#7_ _;#6=/T2SA=;^S4SV\BQ*"OS#*D$'BO3J6BDW=W!*PF:,T MM%(9C'P;X?.I_P!HG0M-.H;MWVLV"".M+10!D:?X M1T+2;YKVQT73K*\;.ZXM[2..0YZY8#-:5S;0WMN\%Q"D\$@VO'*@96'H0>#4 MM% &9H_AG1_#WF?V5I-CIGF??^QVR1;_ *[0,UI9I:* $S1FEHH XWXPZKXN MT3X:Z[?^ ],@UGQ;;PK)86%SCRYW#KN4Y9?X=W\0]N:^7'_:P_:/U#36TFU_ M9MO[7Q'(IC349;MQ9(YXW%6C P#ZR_C7VK16D9J*LXW):;V9\]?L7?L]ZO\ M ;X?ZK+XIN8KKQEXDOVU35F@;>D;G.V,,.&(RQ)'&6.,CD_0F:6BIE)S;DQI M65D1S0QW$3Q2QK+$XVLCKD,/0CO5#2/#.C^'VE;2])L=-:7_ %AL[9(B_P!= MH&:TZ*D9G:OX>TKQ D::IIEGJ21GWNAZ=>7BX(N+BTC>08Z?,1FMBBC8! H P!P !1FEHH I: MKHVGZ[;?9]2L+;4+?.?*NH5E3/KA@13M,TFQT2U6UTZRM["V4Y$-K$L: _10 M!5NB@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* $ MS1FEHH 3-%+10 44F:,T +129HS0 M%)FC- "T4UG5%+,P50,DDX %>>?\-' M?"82&/\ X6AX,\P':4_X2"TSGTQYE-)O85TCT6BJFEZM8ZW80WVG7EO?V4Z[ MHKFUE62.0>JLI((^E6LTABT4F:BNKN"QMIKFYFCM[>%#))-*P5$4#)9B> . M230!-15+1M;T[Q'I=MJ>DZA:ZIIMRGF07EE,LT,J_P!Y74D,/<&HKOQ-H]AK M5CH]UJMC;:O?*[VEA+(+0DGV D MH2;V0KI'H=%1P7$5U!'-!*DT,BATDC8,K \@@CJ*?FD,6BDS1F@!:*3-&: % MHI,T9H 6BDS7/^+OB'X5^'\-O-XH\3:/X;BN6*02:O?Q6JRL.2%,C#<1D=/6 MFE?8#H:*XOP]\:_AYXNU&/3]"\>>&=:OY.$M=/UBWGE;Z*CDG\JZ)/$VCR:_ M)H2:K8OK<< NGTU;E#V^GVD]U=3Q6UK M C2RS3.$2- ,EF8\ DDUP,7[1WPFGD5(_BAX,D=C@*OB"T))^GF4)-[!=( M]$HJ&TO+>_M8KFUGCN;>50\WRR7>HZ3!/*X%PX +NA)P..M?7FHJSZ M?=*JEF,3 -=(^'_AG0O#.G^?+'H_BFZNH M-8N((B//&_P 4/&_QF\1:$WA#5;[1_P"Q?"^A MZ@ZO/;0KEA+< <*S28.WJ!G/;/@>D_#B?Q/X"U*Q\.?C/-'"%*L0R\KDXSQTK2\??&O4S\6?$?@;2M*TW4 MM%T/PG<:SKDUZCOB1E806X 8+AP"6!!RO3%>:Z+\(==\6_L >&] _LF_TKQK MH%DFH:?9W=J\-U#?6LK.BA& 8%L%1QR'%;?P'\%^)[_X-?%#QQXIT.]TWQOX M[^VW4FE7%NZW-O"D+16UOY9 8' ) QD[A4.,%=]M!W;(/#G[2%_I'P2^#MCX M/\&Z0_C3QO;E-+T&T)L],L40%I9&QN98D&#M')R:YN?6OB#>?MK_ @T_P"( M>B:/I^HVNG:J]O?^'[F66RO(WAYVB50Z,A7!!SU!%9OAKX;^-O OPT_9V^(5 MAX2U35M3\%V$]GK/AE83%J'V>=2K-'$^"9$Z[#@G(KIXO%OBOXP?M:_"[Q#% M\-O%GAKP?H]GJ4)U'7],:V=II(>=Z<^4O"!2Y&XDXZ5=DFVO/]1:Z7\CW3]I M+_DW[XC?]B_>_P#HEJ\T_9P^ ?PS\5_LX^ 9]8^'WAC4;F]T.W:XN;C2+=II M6:,98R;-V[_:SGWKU3X_Z;>:S\#O'UAI]I/?7USH=Y%!;6T9DEE=H6"JJJ"6 M)/ YKY]^"G[2.I?#OX-^$?"MS\$_BS>:WI.EPV5% .)'887/E:=J,SZS8VCXQ*^Y!$ MY4$$JN#].<V@T/Q_\1)HKNVTMI@ZV,5N0UM;R..- MQVX8CID>XJUX[^*7Q!^*WP5N?AC8_![Q?I?C;5K%=(O;O4K)8M(M 0$EF%WN MVNN,E0O)S^>K49.^_1?WVX@&20;BJH JGJ2>*/!/PPU?P3^U;X21-.OKC0=(^',>CG6!;/\ M96GCG4;/,QM#D#=MSG%=!X'\,ZQ:?MH?$O7)])O8=%N_#VFP6^I26[K;S2*3 MN1)"-K,.X!R*CW5LN@]66?A#^T#XA\36/Q&TOQ=X72W\9^!9?+O+#P\SW4=^ M&B,D1M@PWY<# 4\\CUP.'\7?'WX\> _AV_Q,UWP'X2L?"4*)=77A^34+I=:M M[=F ^+PG\1+'QQ^U)?^%-,O=.US5(;$^'[ZX@:**YD6 MU(8PR. K$'(R"0&QFO!/&WPHM?&/P/U"TTOX*_$O7?BH=/#7VN>+Q=,L,R@& M9X?-E*RN2&"+%&2=PZ5<8P;^[\O43;L?4/C?]HSQNWQFT#P'X"\-:3K#Z]X: M36[:ZU:>2".U+.BZT*>26RO+:7.UD$@#J0>"#Z]L5P_P\\+:Z/VG/ NN3:#JEKI47PTAL MIKRXLI8XH;CS4)@=F4!9 ,_(<-QTKI?"WA[6+#]M#XB>()M'OUT6?PM80P7Y MMG$$\J.2T:2$;6<=U!R*S:C:UNA2;O<^@J^1/VYKSPY8?$?X!W'BXV \-1Z_ MT>QUB$0W,4D M4AC<.@9MIW*>,Y]<5Y%^U'X(U'QA\7/@-)!H%SK>DV.OSR:DT=FUQ!;Q&)0& MF(4JJD]VP*BG[L]?/\ARUCH>'?M1^(_V=_%'PRDTKX86GAF^^)5Q=VX\/KX. MT]([U;GS5(;?"@PH&[.3CIWKJ-0U;XA:-^V?]B\,:1INM>+KKP!90W5SK%T\ M-E:LLN99I#&K.V6& JC)+=<"OL+2/!^@Z!.9M+T33M-F(VF2TM(XF(],J!7B MVD>&=8C_ &X]?UY])ODT.3P9!:QZFULXMGF%SDQB7&TN!SMSG%:QJ)IKUW)< M7>YCZ/\ &GQ-XV\*?&KP-XYT33M(\8>%='F:>31IWELKN&:VD:.2/> Z].0W MKVZ52_9&^!GPX\6?LP> ;O6O /AG5;R[TP&XNKO2+>2:4EF&6$-1^"OQ9N]:TFR%O+]F\*R"!WW,>)'9<#D7Y!?7WCI? MV7K0_"?X_P#Q8^$&G33/X2TU+76]'M99"XL4G&9(4)YV[B,#V]2:^JJ^>?V9 MOAUXK_X3/QY\5O'6EC0/$/B^6&.UT0RB22PL85Q$DC#C>W!('3'8\#Z%K"J[ MR+AL+1245D6+1244 +1244 +1244 +1244 +1244 +1244 +1244 +1244 + M1244 +1244 +1244 +1244 +1244 +1244 +1244 +1244 +1244 +1244 + M1244 +1244 +1244 +1244 +1244 +1244 +1244 +1244 +1244 +1244 + M1244 +1244 +1244 +1244 +1244 +1244 +1244 +1244 +1244 +1244 + M1244 +1244 +1244 +1244 +1244 +1244 +1244 +1244 +1244 +1244 + M1244 +1244 +1244 +1244 +1244 +1244 +1244 +1244 +1244 +1244 + M1244 +1244 +1244 +1244 +1244 +1244 +1244 +1244 +1244 +129HS0 M M%)FC- "T4F:,T +136=44LQ"J!DDG@5YX_[2'PEB=D?XH^"T=3@JWB&T!! M]#^\II-["ND>BT5R>C_%OP-XAT;4M7TKQGX>U/2=-7=?7]GJL$L%J,9S+(KE M4& 3\Q'2NELKZVU*S@N[.XBNK2>-989X'#QR(PRK*PX(((((ZT--;C)Z*3-& M:0"T4F:,T +165K/BS0_#NE/J>K:SI^F::D@B:\O+I(80Y;:%+L0,EOEQGKQ M6H&! (((/>@!:*3-&: %HI,UB>+_ !UX<^'^E'4_$VNZ=X?T\';]IU*Z2!"W MH"Q&3[#FC<#*]'\1>1S*FG7DO:9X9TJYU36-1M-*TVV7?/>7TZPPQ+G&6=B HR1U-/ M5AL7Z*CM[B*Z@CG@E2:&10Z21L&5U(R"".H([T_-(!:*3-&: %HI,T9H 6BL MNW\4:-=Z_=Z%!J]A-K=I$L]QIL=RC7,,;?==XP=RJ>Q(P:T\T +129HS0 M% M)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T + M129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- M"T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS M0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F: M,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%) MFC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +1 M29HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- " MT4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M M%)FC- "T4F:,T +129HH **6B@!**6B@!**6B@"OJ'_'A<_P#7)OY&OSC_ M &5_BS^SCX5^$%IIWQ#TG1KKQ3'?7AN);SPG+?R%3.Y3,RV[AOEQQN..E?H[ M?*7LKA5!9C&P '4\5\1_LK_&G5/@9\'[/PCK_P '?BM$II86 M629G7:S%2>".U=-+X6O3]3*6Z.V\>>)?A=XO_9 ^+>I_"O3M.L=).F7,%T=/ MT5M,#RK&#\R-%&6P&'.".>M7F^.^J^!_ _PA\">#M)L-8\;:]X=MKJ,ZO=FV ML;&VC@0-/.R@L1G@*O).?H;?Q)^)EY\>?V=_BIIND?#WQWH>HQZ-)%!:>(= MDM);UW5L+ F6,A&WD =QZUY;\4/@1=&[^#GCO6OAQ=?$70--\+6^B:]X9BMR M]_:D1JR31P$J696+*4Z_TN*3TEW_ $$V]T>N>$OC[XX7QO??#KQ=I/AN'QK= M:3/J>@:CH-W),YPW6N0_9^\"Z'=?&1=<\)? ?_A7'A?3;)U&M M^(K"2RU2>Y?Y=D,)9:L^-H+S*C;Q:I\3OC'>CPCH'AWP-I;^)= M0T=-4U?6]7^TP:+8.X^)_P\UO1O#>E M_$3P[ID=[;W=G/4CICGEOVC-"US4_C[ WC7PYX\\6? M"4Z2BV&G>!_M#1B^W?O#=I;NLAXZ$G'(]ZQOV:_AE?\ AKX^?$>?3OAEJOP] M\*:UX9B32(;Z)F#D.5/G2[G59F)+&-G+ 8S348\M_P"OS"[O8Y7X9>-/$7@; M]@/3-8\0Z#X4\4:(M[;1Z787T$L^Y7OF61[E6(4NKGO:?81:AJ^J^(+B2*PL$D_U<>V(%W=AS@8P/QQ\XP:)XNU M/]AM_AN_P]\767BCPYJ=G'-#<:/+LO%-^9"]LR@^:JKRQ P/IS7L>MV_B;X M?M'>)?'D7@W7?&?@[QCIMI#&_BAI'BOPUIVC_$CP5I!U=+>VG>?3M1MR/DFB)VN%SP5/(] M>H&+J_[3WQ@\-?#'2?BOJO@7PU%\/ITMIKFPCU";^UT@E*J)P-OE $L&"98@ M$ GJ1S'B_P #^-OBZGQM^)USX,UCP_!J/@]O#OA_0+VWSJ=VH)=I'@3'M+CD1HY$M8E M9'&"I"#(([&OF*\@\3?LI_&CQGXEM?">K^,/AIXTN$U*Z/AZW^TWFDWP7#LT M .7C?KN'3\,'&G]I+*/VAOB#>_'%?ASX%\,:+J,UUX>MM;AO]8N M)88;0.Q#M,4W%E^Z%5%!);DX%-_FD9B!SC QZQ>'O\ A";: MQAU$VSBU,JW&?*$N-I8+SMSG%:[1M/=7_0CKIL-^'_[3>JVD?Q/TWXGZ/8:) MKWP_@2]OY=$F>:TN[9XRZ/%Y@# G;C:W6QVD-L'./3G&-XD^#&O?$;XL_M)Z4;"[TZQ\3> M'].L]-U2YMW2UGF6%N$D(VMM; ;:3C-3:/\ &WXIV7PPT;P%HGPE\4:=\2[2 MWM]+.HZCIZG0H#'M1KDW6[:Z;5+!1SDX^IRQW273\@N^IUVL?'?Q]X\^)>O> M#?A+X+OV8?B_P#$ M"^U3P5XA\<>&/&5Q!JL6J>$;#[9+!>",)-'+ &#*I.2K)-)U#P)\-/AUH-AKOC2^T"#4[BXUBX>&PTZT"*HDE* NQ9N J\ MU=\%_M%:]H7CK6O _P 6M&TWP_K]AI,FNVVI:)((!;WUW/<@AY3!DLB*# M_%UX]\3RQMKMW\QW9:'[2/QHU3X:7_Q5TKX?>'F\ K;RWEIIMQJ$W]L26J@[ M;D@+Y6,#>8\ABN<'H:WO"?[3?B*\U7X(S:YI>F6WA_XB:6WF75NL@:VU()O2 M(%G(V.. ",Y[UYK_ ,+6\,? M]I X_&J<8]5UL)-]SW'3OBYJGB#]H_5? &EV=I)H.@Z-'>ZM?N&,R74S?N84 M(;:/D!8Y!/TKU>ODWX">+Y?AG^SYXJ^.'B?0]4U/4O%NH/X@O++2H!-AI%W/F7 MP)*8?V]OBY(!DIX5TY@#[8K \$?M+_''XF?"B[\>^'O!'A%=)TK[3]JCU"]N M(Y]0\EFW_9D4,$ 5<9D;E@< "NQ\(^%-;MOVTOBIKDVCW\6BWGABQM[;4GM7 M%M/(N-R)(1M9AW .15;]E[PCKGA_]CRZT75-%U#3=8:'5P-/N[62*X)>28I^ M[8!OF!&..H>#?#0UGQ?\ $)0-)TB[ MN?*AM]J[II)I "=D?? R?:NC^'/Q ^*L'Q#'A/XC^#=-2"ZLVN[3Q+X4:XFT MY64X,$QE4&-^X).#V%> ^%_AIXW\%_"K]G3Q[8^$M4U35? ]M&1"8M0 M-OX^!_BUX\^*/Q-MIM.\%:YX0^'>G6,K7[^*M,^R7 MU_='_5QP1%MP5>26/!Z>E*48I/E7<:;>Y[G17+_#7QVWQ&\*0ZV_AW7/"S22 MR1_V;XBL_LMVFQBNXQY.%;&0<\@UU-<_SQ?*I!*YR&.0:]BHK3VDKW M)Y4<]J?@#0=8\&IX4N[ /X?2&*W^PI(\:&*/;MC.T@E?E *G@C((()%;Z(L: M*JJ%51@ # IU%1,[\^4S0_,+0'O_O?RI-V/1P& K9C75"@M>K>R75M]$CT]/C)X2?X MA'P4-6A_M[RC)Y&>,_W,]-V.=O7%=M7QHW[']BWA;[,GBDZ-I,MK#8:I<6BHT@F#DB-USG8O7TJXQ3O MM>0_#G]ECP1\+O%5OXAT1M:.H0(Z M)]MUFZN8\.I4Y220J>#W'%4?BO>W$'[27P5MXYY8X)K?6S+$KD+)A+3;N'0X MR<9]31RINR87=M3VZF22I",R.J#U8XI]?.W[77AZ#QCJ?PG\.WMQ>0:;JGB8 MP72V5U);NZ"TN&QO0@]5!Z]J45S.PV[(^@_MMN?^6\7_ 'V*D+JI4%@"W0$] M:^?[?]AWX:6MQ%,C>)-\;!UW>(KTC(.1D>;S5S]K"WOO#'@'0/&^DS7$E9.H> M*+*P\)S^('E0V,5H;SS-W!0+NZUY?^RA8:C-\,YO$^KSS3:AXJU"?6=L[$F& M!VVP1C/0"-5/']XU-M&QWUL>S,ZKC<0,\#)IU?)_[3VJ^+_B#\0%\->!=1EL M)/!-B/$6H/ Q'VB?.8;9O4% Q/\ O"OHCX9>.+7XE> -#\26G$6HVJRLG38_ M1U_!@1^%4X6BF).[L=#]MM_^>\7_ 'V*!;_0_%&FOKC: MK% LJF[UJZGB+/'ALQO(5/4]13<8J-[_ ("3=[6/<=Z[MNX;L9QGFG5X=KE] M&O O@B>*R\7 M>*IVABU":,2#3[9%+37 0\,RJ#@'C..M3R7:0[GL#W4,;[6E16]"P!J0'(R. M17@5I^Q7X#GM%?7[_P 4>)M<(R^LWWB.^6^(_@' M\6-(\ ZWKU[XG\&>(ED&AZEJK^9=V=P@W&VDEZR @?*3S[T^5/X6%WU/HIF5 M<9(&3@9/6EKYS_;;M-=U+PC\/=/\-ZW/X>UB\\96D,%_ Q&QOLUTRA@"-R%E M&5/!%=S\"?BQ=^/M+O=&\26B:5XYT)Q;:O8*?E+?PS1YZQOU'UHY/=Y@OK8] M15U?.U@V#@X/2G5X=^RY?7-Z_P 5?M%Q+<>5XUNXX_-<1QZ3^R?X;-Y?LOB3XL:XN4CSYC1,WZXR>O;6-3V^)_B]KZGR8F/FM 7_ %ZGD]6/ XK3\#>"(_AI'-\4OBA*=7\<:@?- MLM/F(8PD]..Q'MPHX%<]2K&E%U*CLE^!^F4,/AL)AE1I)RI-VTTE7FNB[4H] M7U.=/[/7Q1@TD?$]-9F;XAB3[;_9@/S>1C_5X[G'\'IQUK7FBT?]K7PRNJZ4 MR^'?BKHB@R1@[&D9?U()'![=#6O,_P 3[:1?BB=VTM@Z=S@6WH4_N?KWK.\< M>#4\>>5\6?A7(=+\7V1\W4=,B.#,?XOE[D]^S=>M>=AS\6Z*!'=2-%M68#C<>P;CD=#U'6O73Z'R.+P\.24/XE/\ E;^U'O!].Q[K7RGJ'PQ;XD_M;_$E%\2ZUX<^QZ)H[;M' MN!$9=WG\/P6]R MD3,8V*2J<, [#(([>^=X.U];'PDE+-$1' M$NEC0;6T\QBI"GS(U##!P>.N*TOC-\&;KXF:CX9US1?$UYX2\4>'7N&L-1MH MHYE"S*JRH\4BLK@^6G4<8JKVEJQ=-CU"OG/]KOP\?%6M_!_21?W>EFZ\4E/M MEB^R:+_0[@Y4]CQC\:T=%^%'QSL]8M)]0^.2:A81RJTUI_PC-E'YJ \KN5,C M([BNX^-'PC'Q8TC2%MM:N_#FMZ+J":GINJ6:H[03*K(GXC>,;OR)!)Y%Q?AHY,=F&WD5ZOXET"T\5^'-4T6_3S M++4;66TG7U21"K?H37AT/PB^/<=W&[_'I)8%<%HSX6L067/(R$].]>_P*Z0Q MK(_F2!0&?&-QQR<4I-Z.]QKT/B:'QKJNM?L^:/\ "2>9E\72:]_PAUTH.6\F M%_G767[-6F6?[1E[\ M5/[0D9I[<*NDE?W4=QL"-..<;BJCG&?>NS^,G@"X^*?PRU_PE;:HVC-K%O\ M9)+Q$WE8F($J@9_B3+O'WP[U_1Y?#UU!<_V]ING3 M7$<[):W#$. T;,N!(.@/&ZOHO0]'M?#VC6.F642PVEG"D$4:]%51@ ?E7'ZW M\+1J/Q@\-^/+2_\ L5QIMG6XCR+V"4 JK'/&UU5A]#ZTW-2NK!RM6.(_ M;7_Y-XU__KO:_P#H]*]B\,_\BWI/_7I%_P"@"N8^-?PR_P"%O_#R_P#"YOO[ M.^U/$_VCR]^W8X?ID=<8KL=,L_[.TVTM-V_R(4BW8QG: ,_I6;:Y4AVUN>(: M]_R>MX4_[$R\_P#2I*B^*EW%X7_:B^%6NZB1#I=Y:7NBQW#\(ES(-T:Y]6V[ M1]:] OOA@;WXVZ7X_-^%%CHLVDBQ\O[QDE$A?=GM@#&*T_B7\,] ^+7A*[\. M^([,7=A/@AE.V2%QRLD;#E6!Y!%6I*Z]!6>IU5> _':\BU_XV_!SPW9,LVJ6 MVK/K$\8Y,5M'&=S'TR>*=:_!OXPZ#:C3-'^-4TNE1C9!)K&BV]U>HG;,V!O/ MNP)KKOA)\"--^&-]J&M76IWWBCQ;J0 O=>U:0//(HZ(@ "QH.RJ *2M'6]P= MWHMWDO]% AUJTA_P"7W3R? MGR.[)]X5Z!\5/AG_ ,+*/A$_;OL/]@:]#K7^KW>=Y<4T?E]>,^;G/M7:7MG# MJ%I-:W$:RP3(8Y$89#*1@@T*5DAVO<\ _8XUBT\0:5\3=4L)EN+*]\97-Q!* MO1T:UM64C\"*^A:\J_9W^ EC^SUX;U_0],O#=:?J.M3ZK!&8]OV9)%11"/4+ MLX/I7JM*HTY-H(Z+4****S*"BBB@ HHHH **** "BDHH 6BDHH 6BDHH 6BD MHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BD MHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BD MHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BD MHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BD MHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BD MHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BD MHH 6BDHH 6O-OC;\$-'^,WAUK6[46NJP M9Z@@^>)^V?4>U>DT4;G3AL36P= M6->A+EE'9GR+X)^$EG\!8)O'/Q*O5U[Q6"8-,M6E\W:%&%8$]3C!S_"#ZFN@ MT;26U=I?B7\2Y?)L4^>PTU^X_A 7^0[U['\5?A9IOQ0T(VMR!#?P@M:W8'S1 M-Z>ZG R/\*\2T3X7>*O%NJHOQ"OI4\/Z /+42/Q.!Z'N".YYKY/,EB/K"3AS M0^S_ "WZN?INNA^B8;,:>84I8FO6Y:FTNZATC26ROL^H'XV>,EU'_A,7T>4^ M!"_V,VI0;?+/&[Z]L].U2:]H;[3HL_P ]Y81\A!_$"OI[=0:[ M#_A:]F+L:>VCQ_\ "%%#9;/*^4C&,^F,=O2N>^'.C7'AWXD7]GX-O#?>&+A\ MSVERA:-5(YPV>W0'N.M>!'&X>O.--5G-N5D_M1E_-%=8,W7[J$JBHJG:.V\) MP_ED^DUT9P%OI$?Q3^-&E^(OA[97/A[4T19=1NE;;"&S\Q91P1VQWR.]?8EG MI=O9S2W"P1+=SA?/G2,*TI P":I^&_".D>$8)X=(L8K&.>0RR",8W,?\]*V* M^\PE*O2@WB)\TG\DO0^,S;-%CY0A2BU""Y5=WDUOJ_R70*HZOK>G:!:?:M3O MK?3[;<%\ZYE6-,GH,DXJ]7RU^TQHNG+\;O!VN^.O"UQXN^'%OI%Q;_9([/[9 M%;Z@T@(DDA/!S& <<$5Z4(\SL?.MV1]0074-S;K/%*DL#KN61&!4CU!]*HP M>)M(N19&'4[247S.EJ4F4^>5SN"<_,1@YQTQ7AO[)OA[4=$^&OB<'3+O1?#M MWJ5S/H.DW@(DMK0CY5V_P@GD+VKY<^ OPI\?>"/BI\"S>6M]<^$KK4M4U8+- M&V=,N&CFBEC;^ZC!(7&>[M6BIIWUV(YGIH?HSK&O:;X>MA<:I?VVG6Y.T2W4 MJQKGTR35B*]MY[-;N.>.2U9/,696!0KC.0>F,=Z^6?VA=%TJV^/N@Z]\0_"U MSXP\ +I;V]I;K9?;;>TO"W+R0G(.5Z,0<5UO[0^AS^*?V:(;7P7H]PFC;[&: M?1+*+[/+)IJRJTT"1C&TE!]T8X!%3R+37M3P:C:W-W<6L5S%+PM5( M!FN9!&@)ZC#;@9P<8K=_9%\.ZGHW@KQ@;73KGPYX MH5>T@*+R$).U"^2$Z#FER+EYKCOK8]R_X2;2!JXTK^T[3^TR, M_8_/7S<>NS.:EEUW3H+R>TDO[:.Z@A^T2PM*H>.+^^PSD+[]*^ _@/9:EX-^ M)W@?2KWP%;3>,7U29?$>LZKHC37RN6=FN8[\M]P\ #'%>S?MG?"FY\8ZGX$N M]&:_M+S5]5B\,:Q<::/F;2KH[9Q)Q]T Y/2J=-*2CWMXAA8XU 55 [ M 5>K T"BBB@ HHHH **** "BBDH 6BDHH 6BDHH 6BDHH 6BDHH 6BBB@ MHHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "B MBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH *** M* "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH M **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ MHHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "B MBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "L3Q=X4M_&&DFP MN9I88RP;=$?3L?6MNBL:U&G7IRI55>+T:-*=2=&:J4W9K8P9?!&CS>'/[$-H MHL=N H'S _WL^OO3_"GA&P\'Z8MG8Q^[RM]YSZFMNBL8X/#PJ1JQII2BK)VV M78U>)K2@Z;F[-W:OU[A11178W5A:WX6TWQ!=PW%] \DMLLBQ,DSQE0Z[6^Z1G(XYZ=L$HS MXF#VLP*1J,ECE.A'3^]VS4I^%7A/["MJ-$MQ!'*DD:Y;]VRAD4J$'VI+H5K.F>4GW2*?G+@%6)! 8L<$8&YL?>.0#KX;M+F".:*4&* G10Z/U# \@C\**K:?IT&D6-O9V48M[6"-8XHDZ(H& ![ =J* /__9 end GRAPHIC 7 elev-20230417xex99d2g002.jpg GRAPHIC begin 644 elev-20230417xex99d2g002.jpg M_]C_X 02D9)1@ ! 0 0 ! #_VP!# ," @," @,# P,$ P,$!0@%!00$ M!0H'!P8(# H,# L*"PL-#A(0#0X1#@L+$!80$1,4%145# \7&!84&!(4%13_ MVP!# 0,$! 4$!0D%!0D4#0L-%!04%!04%!04%!04%!04%!04%!04%!04%!04 M%!04%!04%!04%!04%!04%!04%!04%!3_P 1" +M!34# 2( A$! Q$!_\0 M'P 04! 0$! 0$ $" P0%!@<("0H+_\0 M1 @$# P($ P4% M! 0 %] 0(# 01!1(A,4$&$U%A!R)Q%#*!D:$((T*QP152T? D,V)R@@D* M%A<8&1HE)B7J#A(6&AXB)BI*3E)66EYB9FJ*CI*6FIZBIJK*SM+6VM[BYNL+#Q,7& MQ\C)RM+3U-76U]C9VN'BX^3EYN?HZ>KQ\O/T]?;W^/GZ_\0 'P$ P$! 0$! M 0$! 0 $" P0%!@<("0H+_\0 M1$ @$"! 0#! <%! 0 0)W $" M Q$$!2$Q!A)!40=A<1,B,H$(%$*1H;'!"2,S4O 58G+1"A8D-.$E\1<8&1HF M)R@I*C4V-S@Y.D-$149'2$E*4U155E=865IC9&5F9VAI:G-T=79W>'EZ@H.$ MA8:'B(F*DI.4E9:7F)F:HJ.DI::GJ*FJLK.TM;:WN+FZPL/$Q<;'R,G*TM/4 MU=;7V-G:XN/DY>;GZ.GJ\O/T]?;W^/GZ_]H # ,! (1 Q$ /P#]4Z*3CTHX M]* %HI./2CCTH 6BDX]*./2@!:*3CTHX]* %HI./2CCTH 6BDX]*./2@!:*3 MCTHX]* %HI./2CCTH 6BDX]*./2@!:*3CTHX]* %HI./2CCTH 6BDX]*./2@ M!:*3CTHX]* %HI./2CCTH 6BDX]*./2@!:*3CTHX]* %HI./2CCTH 6BDX]* M./2@!:*3CTHX]* %HI./2CCTH 6BDX]*./2@!:*3CTHX]* %HI./2CCTH 6B MDX]*./2@!:*3CTHX]* %HI./2CCTH 6BDX]*./2@!:*3CTHX]* %HI./2CCT MH 6BDX]*./2@!:*3CTHX]* %HI./2CCTH 6BDX]*./2@!:*3CTHX]* %HI./ M2CCTH 6BDX]*./2@!:*3CTHX]* %HI./2CCTH 6BDX]*./2@!:*3CTHX]* % MHI./2CCTH 6BDX]*./2@!:*3CTHX]* %HI./2CCTH 6BDX]*./2@!:*3CTHX M]* %HI./2CCTH 6BDX]*./2@!:*3CTHX]* %HI./2CCTH 6BDX]*./2@!:*3 MCTHX]* %HI./2CCTH 6BDX]*./2@!:*3CTHX]* %HI./2CCTH 6BDX]*./2@ M!:*3CTHX]* %HI./2CCTH 6BDX]*./2@!:*3CTHX]* %HI./2CCTH 6BDX]* M./2@!:*3CTHX]* %HI./2CCTH 6BDX]*.* %HIF?I36;GB@"6BH=QHW&E<1- M14.XT;C1<":BH=QHW&BX$U%0[C1N- $U%0[C1N-%P)J*AW&@.0:!DU%1@YYI MR]*8#J*3CTHX]* %HI./2CCTH 6BDX]*./2@!:*3CTHX]* %HI./2CCTH 6B MDX]*./2@!:*3CTHX]* %HI./2CCTH 6BDX]*./2@!:*3CTHH **6B@!**6B@ M!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@ M!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@ M!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@ M!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@ M!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@ M!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@ M!**6B@!**6B@!**6B@!*1\[#@_ARX_\"%_PKYO\2_\ (R:K_P!?Q_Z%RY_\"!_A1_PV-8_]"Y<_^! _PKQ3 M0?@QXN\3Z)#J^GZ4TUA,I:-_,4%@"0>"?4'%<5)&T+M&XPRDJP]"#@U<\TS& MFE*;LGY(N>;9G2BI3T3VNEJ?4'_#8]C_ -"Y<_\ @0/\*/\ AL:Q_P"AM=QJWP6\7Z'H4NKWNDM'8Q1B5Y!(I*K@;9E63=/6V^B/:O^&QK'_H7+G_P(7_"C_AL:Q_Z%RY_\"%_PKY= MJ]HNAW_B*_CLM-LYKZZ?I%"A8G_#ZFLXYQCI/EC*_HD9+.L?)VC*_P D?2G_ M V-8_\ 0N7/_@0O^%'_ V/8_\ 0N7/_@0/\*\Q3]F?QX]J)O[.A4[<^6;E M-_TQ7GVO^&]4\+7S66K6,]AH/0CZ9K>KF&:45S5$TO-(Z*N99M0 MCS5%9>:1]'_\-CV/_0N7/_@0/\*/^&QK'_H7+G_P('^%>%>#_A7XE\=V,MWH MUA]K@CD\IF\Q5PV >Y]ZV+K]GSQ[:0M*VA22*HR5BE1C^6[FJCC\TFN:-VO1 M%PS#-IQYHIM>B/7?^&QK'_H7+G_P(7_"E'[8EDQ 'AVY&3C/VA?\*^9+RQN= M-NI;:[@DMKF)MKQ2J593[@U''_K%^HKF_MC&J5G+\$221@D:*69B M< =37Z-!WBF^Q^FQ=TCP3]IG]MSX.2:WM])M5F=40 M@%GW.H ); ZYP?2O5_AM\1]%^+'@+1/&'AZ9[C1M8M4NK=W7#A6'W6 )PP.0 M1D\@U^,'Q$\/:_\ \%'?VQ?B"WA^>0Z/HNGW0TZ0+N40VR,MN@]YIB#_ ,#/ MI7TU_P $$O$WPDU69DU#0I6U'3X9>&%O(X69 #S\DI!Q_TUK0H^Q_ MVF?VK_!?[*/A_1]8\:0:M/::K=-:0#2K9)F#JFX[@SK@8]S76_!KXS^%OCU\ M/M.\9>$;QKS1[T$*)5V2Q.IPTHS^E?"?_ 6VR/A)\.,?]!R;_P!) MS7RM^Q+^T/XD_8G^*6E:1XTMYK?P#XQM;:[FW@LD<#O%UMKLVK:O:1WENVF6D?\ P5NU M"VU;]JGX5WUG.EU:7'AVREAGB8,DB&^N"K CJ""#FM3_ (+80&X^+_PRA3&^ M31YD&3@9-QB@#]8/!OC71_'_ (7TKQ%H-XFH:/JENEU:W,?1XV&0?8^H['BO M$_$?[=7PY\+_ +24'P0O+;76\937=K9K+%:1FSWSQ)+'F3S V-LBY^7@YZU\ M#?\ !._]I[6OV8_B?=_ OXH;]*TBYNREE)>-A;"Z;H-QX\J7((/3)![FJ_QC M._\ X+0Z0WKKVAG_ ,D+:@#] M7_ &Z?ASHG[1UM\$[BVUT^,9[N*S25+2,V MF^1 ZYD\S=C!Y^6OHKR$G'_3,>M 'UC^S/ M^VU\.?VK;S6[/P8=5@O-)CCEGM]6MDA=D:;\+O M /B'Q?K"7#Z5H=C-J%TMJ@>4Q1H6;8I(!. < D5^+OPWT?6_^"O413IG_MF#WK]7_VR'63]DGXNLC!D;PKJ!# Y M!'V=Z %_9F_:M\%_M7^'M8UGP7!JL-II5TMG.-5MTA)Q:I=&W?TNS\APV&>*Q:I=+Z^ESUW4_'>F_#GQ7X/\%Q( MB6EQ$8F8GF/ VQ?FP/Z5\X_M$^"O^$0^(5S-#'LL=3!NHL= Q)#C_OKG_@0K MJ-,\.0_'KQ[XCUV;7TTA;6>-;5BJL#&,[2,D?W0?QKT_]H#P6/%_PS^U6\J7 MVHZ2HF$\//F "0<9ZCG'L*^EQ$)X[#5?=TB_=].I]9BH5,PPU7W=(N\/1:- M'SW\!_!?_"9_$:PBE3?969^V7 (ZJN"%/U8@?3-?3]E\0]-\8>/O$G@>:..2 MW@M0@SSYC6'CN7Q.EGJ#W4DLEM(J_/EB&R2P/.3V[U&!C4PU.G3@M9OFE_AV M2(P$)X6E3IP6LWS27]WL>)>-_"\W@SQ7J>BW&XO:S%59NKIU5OQ!!_&OICPE M;Z=\ /@W'X@GM4GUB_1'8G 9Y'&4CW=@!U_&N>_:R\%+(--\56BAD;%K=.G( M(ZQM_P"A#/N*Z+XCZ9+\5?@'H]SHJ_:);9(;DV\9R24C*2(,=QN/Y5E0PSPE M?$J:G^U7XCTB2*/4/",5HTL8E1)VD3: MVN5GDDC$D95LB(8(!'K7%_#_ .)GQ2U7QEIMM*MW?6LEPBSQW%GM01EAN.[: M,8&3GVKV;X5?%FY^(7@[5]:FT^*SDL6=5BB8L&VH&Y)^M$:[BNEOM>I MP'[7FGVEOXJT6XB1$O+BU83A0 6"L-I/_CWY5X/%_K$^HKTG]H31-9T?XBWT MFKSO>1W7[RTN'&!Y70(!VVGC]>]>:Q\/?\ ("T[_KVC_P#017S7_P %'?CN?@7^S-XAFL[GR-=\0@Z)IVTX=6E1 MO,<=QMC#D'L2M?2GAX_\2+3O^O:/_P!!%?.W[6_[#6D_M>ZUX?N]?\8ZMHUA MHT3I#IUC!$T;.[ NY+#.2 H_"OU&G\*]$?K$=D?E_P#LH6G[5'P<\.W7B#X3 M_#V]N=,\3QQ3'4GTA+D7$2%MFQF/"Y9CP.:PO 'B_P")'[)O[7?ASQ[\1/#E MYX1N]7U!KK4K22V^S)<6D\FVX*(IQCYF8#ID"OWD\*>&+#P9X;TO0M,B\C3M M-M8K.VB'1(XT"J/R%>(_M=_L8^%_VOM%T*SUS5+W0KS1[AY8+^PC1Y"CKAXR M&&-I(4_5?>M2SY6_X+4ZA;ZG\%_AC=VLJS6\^L2RQ2(>'5K8D$>Q!%=1XR_9 M%L?VI?V!OADMC"D'C;1O#EO<:/=@ &5O+R;=V_NOV]&P?6O5?B[_ ,$_=(^, MWP+^'_PTUWQQK)MO!QQ;:HEO$9[A!&8T60$8^5,#(Z[:^@_A9\.[;X5_#CPY MX/L[N:^M-$L8K&*XG4!Y%1 M ?C_ /%B#X@/K&H^%]7)C>\CTV&-H[R1&R)&##AB 2.N!WZ[W[6?[!GAW]K M7Q?X:\0:SXGU30I]#MVMHH;&&-UE!DWY;<,]>.* /'O^"B/[%K?&SX4Z;\0O M"%B?^$ZT'3XVFAMU ?4;54!*\188TAC+'N=D:@GOBOZ![&Q2RTVWLPQ=(8EB#$K"PUJQP)H >2A!X=">=I_ BOC.Q_X(BV*:P6O/BK<2Z7D8BAT=4FQW M!$/ _[.NM_"3P9>7GABQUJW:"^UB$+->3EP%D=BPP2R@KT / %+^R/\ ML=>&/V0_#FM:;H.I7FM7.KW*W%S?WR*LC!5PB87C RQ_X$: /R9_:QL?VH_B MYHUIXI^+GP_O;+3O#<3XU1-(2V$$3LN0[+R5SCKTR:^WOAI\>A\=_P#@EKX^ MN+RY-QXAT/PKJ.D:GO;+EX[=O+.=(?2[V"YMXAY)* MLJS)@??578<\'//2@#Y[_P""//Q9\%?#OX4^/;7Q1XKT;P]<7&M120Q:G>QP M-(H@4%E#$9&>*_0[0?C_ /#3Q3K%KI.C^/?#NJ:G=/Y<%I::G#)+*V,X50V2 M< ]*^%3_ ,$2O 1_YJ/XCX];6W']*[WX$?\ !*3P=\"_BSX:\>Z=XYUS4[S1 M+@W$5KZ^5S\ MAHXFIAZE25-V;NGZ7,A9"GW6(^AKUSX*?&ZU^'.FZGINKVL^HV%RPDCCB(.U ML88$,>A&/RKS,ZM;YYT>R_[ZG_\ CE']KVV?^019?]]S?_'*BA7J8::G3?WZ MF6'KSPTU4I2U\T^IZK\6_CGIWC3PA8^'=!T^?3+&)U\Q)=H&Q1A$&#TS_(5X MT)64<.1]#6K/>QVS!9=%LD)4/C?,?E(R#_K/2HSJML#SI%E_WW-_\JG M'Y"N;^%'QIU/X83R0*HO](E;?):.Q&UN[(>QX'UXKCEU.!V"KHUDSDX #3') M_"2I;ZY&FW4MM=:%:V]Q$,K&I#J?4N;&$R _[^&/3X;&P MMF+19 :8GDRR>!\TW/\ MY$K2OF->O#V]HVN>G?"7XTZ=\/O!6L:-=6=Q/-> MN[*\6W:N4"\Y->2VM[-8WD-U;RM#/#()8Y$."K Y!_,5H3WD=M])FIS=WMM86(Q$\ M5-3F[O;:Q^COA[_D!:=_U[1_^@BORJ_X*Y?&SXB?#7X\>%K#PAX]\3>%;&;0 M$FDM=%UBXLXGD\^4;V2-U!. !DC. *_57P]_R M._P"O:/\ ]!%?D3_P6 A2 MX_:N^'44J!XY-'ME96'!!NY00:_5Z?PKT1^O1V1]J_L!_M>6G[07P&^V>(M3 M2+Q3X6B%MKTMQ)MWHJDK=$GLRJ2Q[,&]J_,;]J_]OSXC?%+XSZSJ7@GQWXG\ M)>$;9_LFFV6C:O<6221(<>]:EGV5_P5#^*OC7X?\ [.WP?U+POXPU_P - MZC?3HMW>:1J<]K-<#[(&Q(\; M\W/)//->+_ Y_94_;3^*'@30O%NC_ !VU M./2]9M([VV2[\<:JDH1QD;@%(!^A->@?\%%OB MSKWQ3^)]YXGLCX1OAIH3Q-?7SVMTL3.LJ"95",,<,IR.*^+/V8="_:J_:R@U M^3P9\;O$ULNBM"MS_:_C'4H[[]ECXR-^T DB> M(5TW41IWF16^@FNK<^-]4D\ MV%9 778R8;*@C!X.:Y+XV?LW?MF^"+/QSXWD^+>N6WA;2UO=7,-MXVO@\=I' MOEVI&"!D(,!1QQBO:?V7]8_;AN?CCX9C^+<-PG@!I)O[2+VND(/]2_EY,"^9 M]_9T_&OK/]K[_DU+XQ?]BCJO_I))0!^1'[-WA?\ :U_:IT/6-5\$?&+Q2;72 MKE+6X_M+QI?P-O9=PV@.I?MM^(/CC^S;^SI\ -!UOXC^);'QPTNO#6=2 MTOQ'=&2]'VF)X/,F#AI=D4J@;L[>0,"O5?\ @B*,_"[XE_\ 89MC_P"037/_ M /!ZG#Z=,[AY48,VY@&.3R0">:P?\ @ES^W5??$$M\*OB+KESJ7B1- MT^C:QJERTT]\F2SP22.26=>2I))*\?PU7_X*0?\ *-KX/?\ 7SH7_ILGKYH\ M4?LHZII?[(7PF_:%^'0GM-?TRU:;6_L8)D7R[J017B=<% H5N.@!['(![E_P M5G^,_C_X<_'WX?Z?X1\=>)/"^GW6BI+/:Z+J]Q:12O\ :I5W.D;J&. !DC. M!7LO_!2']N?5/V=K33O W@>11XXUB$SR7;)YGV" L50HIX:1R#C(. ,]Q7YQ M?M:?M.Q_M3:_\+?$5Q!]F\0:;HT>FZQ$HPC7*W#MYB?[+JRMCL21VKVO]L!X M+3_@JSH\WBIHQX>75M"<>><(+01P!\YXQO$M &WX7_X)W?M-?&O0;3QIXI^) M4VD:S>I]J@M-8U2ZEND#?,NXJ2(B<_='W>.!T'TU_P $^?AK^TI\.?%WBG1_ MBQX@N;OPAIFV"SAU*Y-\]U*W/F6T[-N6(+C(/G/-?$GP&_;,_:3?]L?PE\)/BEJ%G M8RS7ZPZKI:Z=:"15:W:9!YD0.,J4;@]#0!^KU%%% !1110 44F:,T +129HS M0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F: M,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%) MFC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +1 M29HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- " MT4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:, MT +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)F MC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +12 M9HS0 M-?[C?2ES39#\C?2D]A,_-[Q.N?$FJ@]/MB[KD+ M#;PR+,W^J-PK%GPFW/.]DSGLOI7*^)N?$NJ\9_TN7_T,UU&H^"=,6#3G@U#[ M)$UK;&>>5&1O=S[PUNJG]V%D="2W3JA/TK2U30]/&MMH M%I:7(OHI1$]ZSEPY&=[; O3TP>G)SFM?:5;--:FJJXBTHM*_^9>/B"PETN6. MUOX=/NO(A6:5[4L9P( K(#M.#OW=< YSGBM:Z\4^'[&RC-G=03744,T<$AMV M+A6A4*'R@&X/Z<#KGK6"GPTTS3+$/EQCC,@Z].OK6_:>+=#NM56]FN&@^T62VUTUU'YL MP9&P)$8(02RA1R.<')%'K&2>?4(V?SO*BA",'D^1')_V<"3D'D' K M5@\%6)-'>STX"]@@OX[62"*1;4^5;MM4*[#9D,<,#M+#)W8%0ZAX@TR>SO(K&_ MM;.9I,W#M9_\?J^4B_+\IQ\ZN<''WLU!/\++BWO3;27Z(^V4A3$P>1T90RHA MY;[P(/< ^E5&^&]X+"UG,OSS&-O*\EON/G!4_P 1&,D#IGV-5)5VM8%R>*:U MIFU)XC\/KINIM#56E#ZC"IW6R6V5.9S-OVXQ]W M'EMDGTINF^#]*O8+Q$U=9'2>W@CN! X =S("FWJ?NJ<^AIJ6(VY$BE/%/3D2 M_P" :DGC+38)HHXY(71YU%[,+48G40*K, 5S@L&X !Z' KSY.9EZGYN]7=92 MTBNA#:P20&%1%-ODW[Y 2&8<# /I5*+_ %B_45Q5*DJC49=#S:M:=22C+H?H M[X>_Y 6G?]>T?_H(K\U/^"F'[.?Q*^+G[27@?7?"'@S5/$.CV.FV\-Q>6489 M(W6Z=B#D]0I!K]*_#Q_XD6G?]>T?_H(K1$@''ZU^M4_A7HC]ACLC'U7PGH_B M2[TRYU;2[;4+C2KC[98RW,0=K>;:5WH3T;#,,^_M7Y[?\%:/V?/B'\:M>^'T MG@7P?J7B:'3[>Z6Y:P0,(BS(5!R>^#7Z1[A1N%:EGYZ_\%*O@5\0/BU\ /A- MHWA'PGJ'B'5-+G1KRTLT!> "U"'=R/XN*\+\#>/?V^_ASX/T?PQH?@._@TC2 M;9+2UCDT.WD98T&%!8G)X[FOU^W"C<* /S]^ WB[]JOXF>'/BKHGQA\+W5G8 M7'A.]BTI#I<5L9[QXV144IR20W0U\@?L^^ /VR/V88]8C\ _#C5[!=7:-KO[ M5ID-QN\O<%QN)Q]X]*_<'<*-PH _+/PA\:/V_;GQ;HD.L^"[J+2)+Z!+R4Z# M;+L@,BB0Y'(^7/-??O[3/A_5/%W[.GQ.T/2+.74-5U+PUJ-G:6D(R\TLENZH MB^Y) _&O3]PHW"@#X*_X)-_!3QU\$OA]X\L?&_AB_P##-W?:G!-;Q7T>TRH( MB"PP>@-8O_!6WX$?$#XX67PN3P-X4U'Q.^FR:F;L6"!O($@M=F[)[[&_[Y-? MH<9 ,]Z^?O$7[96C1>*M7T'P9X)\6_$RXT67R-4N?"]DDEM:2]3&99'17<=U M3)!R.HH \(_;H^"?COXD?L*?#'P?X:\+ZAK/B339](:[TRV0&6$16$L*&UGDM+^TOXC!WGA'X>^./'GA>QD>.?Q+H&F+)9'9]\Q%W5I@"""8U/(^E 'YO_M3_P#! M-/Q]X%^-DD_PQ\)W_B;P7J$PO;;["H/-(A,'D3N(TU"#.X)O_A=3G:3QR0<<&OJ'PQ\=_!'B[X8 MM\0=/UZV/A.*%YI[^9O+%N$_UBR@\HR\@J>&B+I2^)?\ A6_CX?#X M_/\ \)@VD 60BSCSMA?S?*[[]F,4 ?"OA3]I_P#;8^".B6?@JX^'6HZ\]F/L MUO>:GX?N;R957Y0/.B8*X'&&;)/J:Z_]DS]DWX[?$G]JO3/C[\5[)?#S078O M)EO8UBN;MEA\E$6!?]6JJ%&6QPHZDU^@_C_XXS>&?#/A_7?"W@G7_B78ZR@F MB;PP('\N(HKI(QED0;6##&,]#7EZ_MQS67Q!\(^#]<^#/CWP[JOB>Z^S6(OH M[,Y (WR%4G9@B Y9L8 H ^HJ*:KAB1C!%+F@!:*3-% "T444 %%%% !1110 M4444 87COQEI_P ._!>N>*-6\W^R]&LI;^Z\A-\GEQH6;:N1DX!XS7QU_P / MB/@!Z>*O_!4O_P =KZ*_:R_Y-B^*O_8LZA_Z3O7Y*?\ !+']FOX<_M(>,?'E MC\1/#Q\06NF6%M-:(+ZXM?+=I&#',,B$Y '7- 'Z >$?^"L'[/'BK58;&;Q# MJ?A]I6"K/J^F2)"">FYTWA1[M@#N:^N-)U:RU[3+74=-O(-0T^ZC6:"ZMI!) M%*C#(96&001W%?G;^UG_ ,$H_A=:?"+Q%XB^&%A?>&O$>C6[2 M-2SQL)F=@Q4':0PYQD'-^/>J:FOBKX3ZK=R7-E8P#5](65B3 I<)/& MOHI+HP'8EO6@#ZYU7]OWX6Z/^T OPQT2RD6-G13@R22'(C3/&<,2 M>@.#@ ^C**_*O3_^"WMY'?Q2:K\&_)TF5N)+?7&,@7U&ZW"N1Z8WAG4+/;3+]^*103AAD="00002"* /0J*^(?VK M_P#@J=X)_9U\77?@_0="F\>>*+)ME\D-V+:TM)/^>;2[7+..ZJN!T+ Y \X^ M$'_!9[P[XD\76FB_$+P'/X+M;F58O[7M;_[5% 6Z&6-HT94]6!;Z4 ?;/[0? M[0GA3]F?P"OC#QC]N_L@W<=D/[/@$TGF.&*_*6''RGG-3_ 3X\>&/VC_ (=V M_C3PC]M_L:>XEMD^WP"&7?&<-E03QGWKY:_X+!W,5[^QY:W%O*DT$NOV,D%_%E MA$)Y]%NYEF#Q9 ,D,H"[U!(!RJD9'&#FN4_:2_X*1:3^SG\=[;X9W7@>\UNY MFCM)!J,.H)"@\\X V&,GCZ\T ?95%$KKPP=!6W9S;OQC"+ MC&SWZT ?4-%?!?B7_@K=X-\$_&#Q9X)\0>#K^PMO#UQ>VTFJI?))]HD@W!52 M+8#F1E"C+<;LDX%;7[&'_!1^X_:W^*6K>$A\.G\.VMI92:@-335!W[0G_!8#PE\,_&EYX7\!>%)?B!=64IM[C4C??9; M3S0<,L6(W:4 \;OE&>A(YKK?V3O^"I7@S]HOQ?;>#=?T&;P'XJO#LLHYKL7- MI=O_ ,\UDVH5<]E9<'H&)P" ?;E^'NN^,]?\ M']C:-;FZNOL ML?F2[ 0/E7(R>?6NKKY__;\_Y,X^*_\ V!G_ /0UH T?V:?VP/ /[5T>O/X' M_M3;HIB6Z_M.T$'^LW;=N&;/W#7M]?EC_P $._\ CR^+/_733OY3UZ_?OB/R=F?]G=C_:KZP^+/[7&B6T)MXI%.'0/+*F]E.0=H(R.M?1OP"^.6@_M& M?#'3?'7AFUU&ST>_>1(HM4A6*<%'*-D*S#&0>0QZ5^ ?P!^-7A'X:_'*Z\<> M./ EO\0M)E%TXT2_,;1^=*V5D82(RL5R>J]3GM7[;VW[2_PN^"7[*WACXD7N MEVO@;PGJ-C%=:?X=TJ",.9)@9/(@B0(I8DL20%'4D@4 ?1-%?E?J?_!;]O[6 MD?2_@\\^AQOM,MSKFR9E[$A;=E0^V6^M?:O[*/[9O@3]K?P_5@+M4DKOR!W)XH _0.BO@"U_X+!> ['QQXLT+Q)X1U'0[; M0?M2+>1WB7#WLT,OEK%'%L7YG.3RV Q- 'Z?45^=7QT_X+(^$/ _B*72_AWX3E^(% MM;A3<:S+>&SMQ_V M?9":/RW=D&6+CG*'C%?0UG=)?6D%S%GRYHUD7(P<$9'\Z_-?_@H]\3/@3X/^ M/>A6/Q*^#=[X_P#$$FCP20:K;^(KG3UBA,TH6/RXV"G#!CGJ=V.U??7C+XG^ M%OA)\,)O&'B6_CT/PWI]G'-))*2Q52HV1J.KL20H Y)H [2BORZ\7?\ !;JU MCUN>/PE\*+G4]'A8G[7J>K?9YI$SU,:1.$_%VKZ@_9#_ ."@_@+]K.>;1K2U MN/"OC*",S/H=_*LGG(/O-!* !(!W!56'7&.: /J6BOE+]L[]OC3/V.O$'AK2 M[_P?=^)FUNVEN5EM[Y;<1!'"X(*-G.:\-^,/_!9OPQX2U?[!X$\#S^,HH%3[ M7J=QJ'V6V60@%DCQ&YD .1O.T$C@$8- 'Z/T5\S?L9?MU^%OVP].U2"RTJX\ M,^*-*19;S1[F83@Q,<"2*4!=ZYX.54@D<<@U],T %%%% !1110 4444 %%%% M !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 M%%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4 M444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4U^4/TIU-? 0Y MZ8I/8#\W?$W/B35N_P#IR?]^D_PH_M^]_Y[)_W[3_"CVEMIB53E=U-_A_F3S>+M5GN M89VN0)(9(Y(@D:JJ,@PF% P,#I3T\9ZM&EJHG0FW&U',*%BF"NQFQEEP2-IX MYJK_ &_>_P#/9/\ OTG^%']OWO\ SV3_ +])_A1[3^\5[9WOSO\ #_,CU#5[ MK5 !.R!!(T@CBC6-%8A5.%4 #A5_*I(]>OXU*)R?]^T_PH_M^]_Y[)_WZ3_"DIJ]^;4GVBYN93=_Z\RZ/&VKK?)>++ MR MH_U@MH\L6SSN/.:9%XRU>#[,5N5\RW8-',T2&08SP7QDKR>"<>*M4OF!DN=H4QE5 MB14"^7NV8 QC>V,>M+<^*M1NI [2QH=\>5Y)&W.[%F/J3UHC/[ MQ?J*N'7KT_\ +5/^_:?X525BTP8G)+9./K6:<;JS,?=NN5W/T=\/?\@+3O\ MKVC_ /0165KGA"ZUC4&N8O$VM:6A 'V>Q>$1C'?YHF.3]:UO#_\ R ]/'I;Q M_P#H(K3'2OV"G\"]$?M4-D<3_P *[OO^AX\3?]_+;_XQ1_PKN^_Z'?Q-_P!_ M+;_XS7;T5J6<1_PKN^_Z'?Q-_P!_+;_XS1_PKN^_Z'?Q-_W\MO\ XS7;T4 < M1_PKN^_Z'?Q-_P!_+;_XS1_PKN^_Z'?Q-_W\MO\ XS7;T4 <1_PKN^_Z'?Q- M_P!_+;_XS1_PKN^_Z'?Q-_W\MO\ XS7;T4 :;Q#JVK(R[?)U! MXBH]QLC4Y_&L;Q-JG@;]GSP!JFM7,>G^%?#EH\EY<"VA6-7E=BS;44#=(['@ M $DFN\E8K$Y"[B%)P.]?GW&_QR\=?%R3QM\2OV?]=\1V.E3[_#'AFUU[3$L= M-]+B4--F:<_WF&%_A% %7QK9^*_"/[('[0WQ*NK"?PS>_$75!J=KI1^6:SL) M?)MT,@'W97CW,P[;N>:^ZO 7A+2/ W@S1=!T2&*WTK3K.*WMTA "[%4 $8]> MOXUYI8#6?VD_AOXR\)_$3X:ZG\/+*_MOL2Q7VH6MVTZR*W[Q&@=@IC(4X;N1 M[UY]X0\2_M"_"+PO;>";KX8Q?$JZTV,6FF^+K+7;>T@N8E&(WN8I/G1@-H;: M&S@F@"#X*>$=$7]I+]I#X>S:;::AX+OIM-UB?2;B)9+875S!F?Y",?,RJQ]Q MFN\_:E^)NG>!OA]-X)TG3DUKQGXKM)M)T'PW;1J3,S(4+NO1(8PP9F/ P*Y M;PO\//B/\!?A)X]\86&DP?$;XV>*KT:C=6=O.EO;I(P6.*!'D*CR8$R<$@MA MO45YC\#I?B[\,[[4?%?B;]GOQ1XR^)6L@#4_$EQK^E)A 3M@MX_/(AA4' 5> MN,GM@ ^IO@QX&O\ X.? CPKX5.-5U30=&BM6 ? GF2/E5)Z MP"?8U\R?!/Q MSJOP_P#C//XB^/G@_6/#WC[QG>?V9H^M7 BNM(L(,GR;""2-V,);JQ8#>W?B MO;_&WB'XU7WAWPEXL\'>&["TO4WG6_ 6O74:SRJ3A?+O(RR*ZXZ8*G=[5Y]X MTT'XK_M47_A?P_XB^'/_ K'P;INL6VL:K=ZGJUO>W=V;=]\<-ND&=H9@,NS M @=O4 ^MXCDFI:CC39].E24 %%%% "9HS1FC- !FC-&:,T &:,T9HS0 9HS1 MFC- 'E'[61_XQB^*O_8LZA_Z3O7YP_\ !$#_ )*#\4/^P79_^C7K]'OVLC_Q MC%\5?^Q9U#_TG>OPO_9$_;&\0_L?:WXBU/P_H6F:Y+K5O%;2IJ32!8PC%@5V M,.3GO0!^_P#\5-2MM(^&/BZ^O'6.UM](NY96<\!1"Y.?PK\=/^"-5C<7/[5. MK742G[/;^';DS$= &EA"Y_&J?Q6_X*&_'O\ :_\ "US\.O#G@ZWM;35P(+NW M\+V%S<7=RA/,9//#?Q2\'Z-=^)M.L-/6RO;2Q@-Q-:-'*\BR&( EHR'.2 0-O/!KP_Q]_P I M@8O^QVL?_08J^J/^"DWQ,_:5^!?B?3?%WP]U^Z_X5B\<9N[:STRWF^Q7"'YA M-)Y1D$<@Q\V[&2PR.,@'S$?^"IMSX[\%2> /CA\(]$\:>'65(+F/3II=,N$V M$88+\VUQC^ Q^@Q7WO\ L>?$'X(W7[/7BS7/@/H[^';.RBFNM1T6YDE:YM[I M8"5\S?(^+]-N=)L?%RPV]EIU MVACDEMT63=,R'D!O,PN>H!/0C(!\R?\ !)?PGIOQ2_:TUSQ#XG@BU>_T[3;C M5H#=J)/]+>9%\W!ZL-[$'L3GJ*_4#]H?]C#X7?M0:KHVI>.-*N)K[2U>..XL M+C[-)*C8.R1E&YE!&0,C&3ZU^4<5MX\_X)9?M97.MW'AV;6?"TYGMK:9B8K? M5+"1@P"2@$+*NU"002"O(P0:[CXU?\%#?BS^UYXY\)^%?@7I/B/P;<12,6BT MJ^9KF\D? S,8P%6)!D_-D#))(H ^F/\ @JQX1TWP#^PQH?AO1UE32M*UC3[. MU2>9IG6)(I54%V)9L 9)KC_ -DOQIJ'P\_X)+>-/$&DR-%J5G'JWD2H<-&[ M.$#CW&[/X5N_\%,O#VN^$_\ @GUX5TCQ1K,OB'Q'::IIT>HZI. K'XI_P#!.Z^\(:D2EEK<^JV$KJ,E!(=NX>X)!_"@#P/_ M ((L?"O0/$WBGQ[XXU:R@U#6=%%M:Z>]PHJ#2YKN) KW,#Q.X5R/O;3'P3T#&OF+X/?$?XE? M\$KOCAK^F>+?",^J:!JBBWGC#&&&_1&)BN;:;:5) 8\$=&*G:>E_]I']ICQ] M_P %,O&WA?P%\/O UW9:18SF=+/S?/=I6&TW%Q(%"11HI(&>!D\DD 'OV@? M#SQI^V!_P2?\-Z/I#MJ'B?1;LFUMY9-K7L5K+(BQ!B<;O+;"Y/)0"OFWX$?M MZ?%;]BKP_P#\*S\0?#S3[C1[:65Y-+URPEL+X;V)<%^C Y/+HW&!G K]!_B M/\%OBU^SG^Q1X>\+? ;6WB\6^&(UFOTMK&"XDU-6W-<^4LR/AM[%E &XA<#G M KY ^'7_ 5:^P?#V3P=\=OAI_PLC6K*616NK]($,V6)V3P21%59?NY Z ?+ MD<@'M/\ P3_^,'[+OQ%^++7'A#XN_'3]LN#XI>'_"7_ AW M@#2-3GU5DME86=MD,([.%R '.6 ( X4$X P*Z?\ X+"_"WQ)X9^/N@_$ZVL) MIM O;"W@%^D9:*"Z@9L1N1]TE=I&>O..AH _3']KIU3]EGXJDD ?\(U??^B6 MKX"_X(=_\?OQ:_ZYZ=_.>LWXB?\ !1SQG^UM\$M<^'/@/X7W5OK-YI$A\0:P MUWYUM9VJ)NG=<(-H958 N1C. &)%:7_!#O\ X_?BU_UST[^<] 'S7_PK/3?C M#_P4UU7PAK,9FTC4O'%XMY$&(\R%)9)'3(Y&X(1QZU^J'[0WPW\$_LW?LW?% MOQ7\.?"&C^#]:?PY):-P:3&?++H0&_ X/X4 ?B#_P M3P_:9^&'[+WBKQ+XG\=>&->\0:Y<0Q6^E7.C64%P;1,L9B3+-'M9OD&5SP". M,\Y'[9_[0/@KXT?'_1_B5\*_#VN^&+N.*&:^;4K.*VDEO8I"RS*(99 25" L M2"2OXUVW[/?QT\=?\$P/B_XL\+^./!=QJ&F:EM2XMA(8#+Y9;RKFVE*E9%(9 MN.^>H(KU_P $_MJ_M&?MD?M+V=G\()KOP/X,!ABO(6L[>^@LK=3F2>>26$@. MP)PHQG"@9Y- 'ZK>$-8;Q#X3T757&U[ZR@N6'3!>-6_K7BW[?A_XPX^*_P#V M!G_]#6O?8U*1JK.9& +D8+'UXKP+]OP_P#&''Q7_P"P,_\ Z&M 'QC_ ,$. M_P#CR^+/_733OY3U\Y_"OP'I'Q)_X*CWFAZ[9Q:CI4GC+4YYK2=0TE?1G_!#O\ X\OBS_UTT[^4]>+?LU_\I:;O_L:=;_\ 0;F@#Z^_ MX+&^$M)N/V6M*U4V%NM_I6N6T-I.L8#0QNDBLBD=%.%XZ?*/2MG_ ()3:?9^ M(/V)-.M-4M+?4;6/5[_;#=1+*@PX(X8$=2?SH_X+"G_C$%O^P_9?RDJ?_@D< M?^,,++_L+W__ *$M 'PU_P $O=&T[6/VX=8M+^QMKZT&GZF1!"O!4.VTT'2=%2>WM8@%B62:5U9@HX&%C0?A6+_P2K_Y M/MUG_L':I_Z-2OIK_@K3^R)XD^+VFZ'\2O!6FS:SJVA6S66I:;:(7N);7<72 M6-1RY1B^5'.&R!P: /LKX/\ P3\'?#_X(:+X$L-#L'\/G38XKJVD@5TO&9!Y MCR@CYV'1U\47.A>0K$AK24LHC;U"Y4\]T M!KT_X:_\%D]6\!?"*T\,^(? $FK^--)M!80ZB;WR89BB[$>>,H6## W 'YB# M]W/$_P#P37_9C\;_ !6^/-Q^T)\0;&XLM/6YGU&RDNXC&VHWLV[]Y&IY\I-[ M$-T)V@9P< 'D7_!4_2SKG[=EUIRMM-Y::7;@CMO15_K7ZX?"S]E'X4?" ^'[ MSPSX&T73-X!)(';)]:\:_8 M'_Y2:WW_ %_Z[_*:O=/^"X?_ "+GPH_Z^[__ - AH ^AOV-/A1X9T?\ X)^: M-8+I-H\?B+P[/>ZH6B4F[DE1R3(_EBM8+HKTE+NR-(,CA8FVG M'((P/DG]N+]J?XB_M1:%X:U3Q1\+4\$>&;*YD&F:DUG<&2X=URT7VF0*KC # M;54>M2>-=2UW]BC]OS5?%WC'PF?$,,&MWFIVT5X-J7UO.SE)X9&4C4VJ7,GF^?>3+M +[57@* M1M7=C/)Y H ^UO!.GVNK?\$CH9;ZU@NY;;P3>O \\:N8B/- *DCY3@#D5X7_ M ,$3= TO6KGXJ/J.G6E^\']G-"UU LAC.9^5+ X/ Z>E?0?[-D+?%O\ X)7C M0= 'VW4W\,:EI*V\?+&Y4R@1X]3E?^^A7Y__ /!/O]L6U_8_\3^*M+UKPK>: MO)XBFM+4A+@6[6DD/2[V.74+E%.!+)%'$D8/KCS'/XUY9_P6-<2?M5>% MF4Y!\.VI!_[>)Z^RO^"B_P"RIK/[27[/?AJ_\)VIOO%GA>-;JWL5X>\@>)1+ M$G^W\J,!WVD=2* /2/\ @G[\(_#7PX_90\#C3-.M16I>[EF7< M=Y_B"AMH!X 'UK\Q/VG-$M/V7O\ @I%;7/@6)=)MH-6T[4X;.T&Q(O/"&6)5 M'1&W.-O3#8Z5WW[-/_!4S6/V9OA=#\-/'7P_OM8U#PZ&M;%S<_8YXT!)$$\; MH2-I. PYQ@;>,FA^RU\&O'_[>7[61^-?C/27TWP?;ZE'J5QW M<]S+9W1EFN9HS7%]2PW_/M?< M /\ GQN__ R3_&O7,T9H^HX;_GVON#ZAA?\ GTON1Y'_ ,,M> /^?&[_ / R M3_&C_AEKP!_SXW?_ (&2?XUZYFL#7?B#X9\,:WH^C:OKMAINK:Q(T6G65U<* MDMXZXW+$I.7(R.E'U'#?\^U]P?4,+_SZ7W(X$_LL^ /^?*[_ / Q_P#&@?LM M> 0019W8(_Z>W_QKJOB%\:? 7PF-@/&GC#1O"WV_S/LG]K7J6_G[-N_9N(SM MWKG'3<*IZE^T#\--'\'67BR^\>>'[7PQ>S_9;;5Y=1B%K--M9O+63.TMA6., MYP#1]1PR_P"7:^X/J&%_Y]K[CN;6TCL[>.&/(CC4(H)[ 8%3# KB/"'QR^'G MQ TW4=0\->-="UZRTZ,S7D^GW\\$>(+W0;/3/ M%>DW]UKUJ][I4-O=H[7T"??EB /SJO==FC-(TBH/F.*YCPM\4_ M!WCC5]3TKP]XGTG7-1TP(U[:Z?=I.]N&SM+A2=N=IQGT-,#J,T9K L/B!X:U M7Q7J/ABSUVPNO$6G1+/>:7#<*UQ;QMC:SH#E0$_AMIBZCXK\ M1Z7XH@- M9MJ-]'#]H!Q@IN(W#D.ZM9D$D4T3!D=2,A@1P0?6@"?- M&:3S%YYZ5D>(_&6A>#X;2;7-6M-)BN[J.RMWO)1&)9Y#B.)<]78\!1R: -@X M((/>F)&J=R?J:R]"\8Z'XH?45TC5;34FTV[DL+P6LH?[/<)C?$^/NNN1D'D9 MJMX/^(/AGX@Z?<7WAG7;#7[*WN'M9;C3KA9DCF3[Z$J2 PR,CWH W3&I8G)S M]:7RUK!D^(7AF'QG'X1?7;!?%,MH;Y-'-POVIK<-M,HCSNVY!&<=JJ^./BOX M,^&=M!<>+?%.D^&X9\B)]4O$MQ)C&=NXC/4=/6@#IS"I[GIBE**RX[5P7B+] MH#X:>$= TO7-:\>>'],T;5&9;&_N=1B2"Y*XW"-R<,1D9Q5_P?\ &/P+\0=& MN]6\,^+M&U[3+0$W%YI]['-%" "27920HX/)]#0!UHB4'.>:4(!WKC_#'QG\ M!^-=/U2_\/\ C#1=:L]+#-?3V-['*EL%!+&0J3M )R?2L?P;^TO\*/B)X@M M]"\,?$7PWK^LW 9H;#3M2BFFD"CEHH YNT^&GA"PU,:C M:^%=$MM0#;Q=Q:="LH/KO"YS^-=)110!4U32;'7+*2SU*RM]0M)/OV]U$LL; M?56!!JIH'A+0O"D4D6B:+I^C1R'+II]K' &^H0#-:U% !1110!2U?1=/U^R> MSU2PMM2LW^];W<*RQM]58$&HM"\,Z/X7M3:Z-I5CI%LQW&&PMD@0GUPH K2H MH *Y_6_A]X6\2WBW>K^&M'U6[7 $][813.,=/F92:Z"B@"&TM(+"VCM[:&.W MMXUVI%$H55'H . *2^L+;4[26UO+>*[M95VR03H'1QZ%3P14]% &;H?AO2/# M%H;71M+LM)MB=QAL;=(4)]=J@#-:5%% !1110!FZYX;TCQ/:"UUG2K+5K8'< M(;ZW29 ?7:P(J31]"TWP[9+9Z5I]KIEHIR+>S@6*,'V50!5ZB@ HHHH **** M "BBB@ HHHH P+_P!X7U755U.]\-Z1>:DI!%Y<6,3S CH=Y7/ZUO 8&!TI:* M "BBB@ HHHH **** ,S7?#&C>*;9+?6M)L=7@1MRQ7]LDZJ?4!@0#5VSLK?3 MK6*VM((K6VB7;'#"@1$'H . *FHH *PY? OAN;6_[9D\/:5)J^=W]H-91&XS MZ^9MW?K6Y10 4444 8>N>!?#?B:ZCN=8\/:5JUQ%PDU]91S.GT+*2*V888[> M)(HD6*) %5$&%4#H !T%/HH **** "BBB@ HHHH **** "BBB@ HHHH **** M "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH M**** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ H MHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BB MB@ HHHH **** "ORH_:2N?'7[1'Q@\<>-_!'@;6/$EAX&DBTCPQKNG7D44%C M>VD:G:^"M+EQH]M MFWN42UW% LC8#D+M / X-?J!:>#M L)+*2VT33K=[$R-:M%:1J;5*N=LBY!VL,G!'(S0!^;?PZM M=0\1_''XX:CXC\*>'_A/XA\-^ [O2I/"6A'"ZFLB/(+W<$5)5& H91D94'%< M]\&?B!X;^&/C+]C_ %[Q7K%IH&C0> =41[Z]?9&K,Q"@GMDG%?J!<>&-'N]0 M>_GTFRFOGA-NUS);HTIB/5"Q&=IRTM[OPOHUU!:)Y=O%-I M\3K"F<[4!7"C/84 0^ _B'X:^*WA]-;\*ZU::]I#2-&M[82"2(NI^9<^H[_6 MO@Z--?\ @E^T7^U7!\&? \.I:['IGAZ/3M(T^)(XXI)K9B\Y3*AMK,SD9&XG MGK7Z%:-H.F>'+(6>DZ=::7:!BP@LX%ACR>IVJ ,TZ'1=/MM2NM1AL+:+4+H* MMQ=)"JRS!1A0[ 9; X&3Q0!^9?[%T'BCP=^UO\0M-C\*^(HO%NJ>$HKB]O/% MLD>1J!W2?:+GRW8K#+)A5"9(! Q7I7[9'AKQ_P"(_P!CCXF:I\9=#\"R:SHT M$$V@W'AEKF?[,7GB65BUPBE6(P/E[$U]TQZ'IT6IRZDEA;)J,J"*2[6%1*Z# MHK/C) ]":?J>D6.M6,MEJ-E;W]G*,26]U$LD;C.<%6!!Y - 'YN_M%_V+\// MBCH_B^Z\0?#_ %"[U'P):6DGA[XA65Q=?9HE4XELQ&C!G8@@QDJ6Y^8 YKZD M_P""?.A>(?#7[(/PZL/$ZSQZJEG(_E7*E9(X7FD:%2#R,1&,5CILR/E_"M-5"# &!Z"@#YP^%7ASX^6'[2WQ"U'QKK6 MFWGPHN#)_8%E 5,D?S@Q#: &4JF0^[.6((KPW_@HE)+K_P 8O@[X<71?&^IP M1W$^K3Q^%M2%MY\5NC,3$#(H6>-S&_F'&U2=ISFOT V+SP.:IW6AZ=>W<5U< M6%K<74*-''-+"K.BL,,JL1D CJ!UH _,KX'>-M5^$/[$GC+Q-H^G^*QXS^(. MNR6.@P:W>_:FOKFZD=8I[<%R20CL9)#R[1;CD8)W/V--0U7]EKXS2^"/%?A' M4OAWX3\7Z,ES8)K%]%.KZE8PK]JD5U.!YJ'>5Z@^U?HE_P (KHIM[&#^R+#R M+!@]I%]F3;;L.AC&,(?<8J35/#FDZXT!U'3+/4# 2T)NH%D\LD8)7<#C(XXH M _)76?&/Q!U'QY>?M06OP[UVXLK7Q)_:%EXA2[B^SCPW&IMVM_(SO)92SEAQ MD_C7ME]XK^'6G?MH>-/%7QK:PO/"FNZ#ITW@'5=;M_/TP6WDC[4B%E9%D+MG MUP6_O 5^@"Z#IJ:3_9:Z?:KIGE^3]B$*B'9TV[,8V^V,5!=^$=#U#3(=-NM& MT^YTZ$ 16DUJCQ1@=-J$8&/84 ?G9^T'=>#?$$?[-4OP4\)Z-K&A2^+=2_L_ M1+ZW:QL+V;R\R!@Z'Y"37<:Q7$EQ:1R-,@(95X% 'P1 M^R%XK^&_CWXO^-OB=HP\/>%M#3PFVEVG@+2 LETVFP2AY+V\@C4J96RB!1N. M#@Y)YQ/V=/$OA.?]NC3M7\&W'AOQ]IGB^SO)$ETW2'L;GPA;PINCB9!B-?,+ M;&.W>2,DXZ_H=HG@+PSX:NVNM(\.Z3I5RR&)IK*RBA:VMTC>4^K$ %OQH TJ*** "BBB@#S[_ (7YX"_Z M&.U_)O\ "C_A?G@+_H8[7\F_PJI_PSA\//\ H75_\"Y__BZ/^&1_P *7:'WO_(M_P#"_/ 7_0QVOY-_A1_POSP%_P!# M':_DW^%5/^&_\ M(/\ A2[0^]_Y%O\ X7YX"_Z&.U_)O\*/^%^> O\ H8[7\F_PJI_PSA\//^A= M7_P+G_\ BZ/^&_\BW_POSP% M_P!#':_DW^%'_"_/ 7_0QVOY-_A53_AG#X>?]"ZO_@7/_P#%T?\ #.'P\_Z% MU?\ P+G_ /BZ+YAVA][_ ,A?\*7:'WO_ "+?_"_/ 7_0QVOY-_A1_P +\\!? M]#':_DW^%5/^&_ M\A_\*7:'WO\ R+?_ OSP%_T,=K^3?X4?\+\\!?]#':_DW^%5/\ AG#X>?\ M0NK_ .!<_P#\71_PSA\//^A=7_P+G_\ BZ+YAVA][_R%_P *7:'WO_(M_P#" M_/ 7_0QVOY-_A1_POSP%_P!#':_DW^%5/^&_\ (?\ PI=H?>_\BW_POSP%_P!#':_DW^%'_"_/ M 7_0QVOY-_A53_AG#X>?]"ZO_@7/_P#%T?\ #.'P\_Z%U?\ P+G_ /BZ+YAV MA][_ ,A?\*7:'WO_ "+?_"_/ 7_0QVOY-_A1_P +\\!?]#':_DW^%5/^&_\A_\*7:'WO\ R+?_ M OSP%_T,=K^3?X4?\+\\!?]#':_DW^%5/\ AG#X>?\ 0NK_ .!<_P#\71_P MSA\//^A=7_P+G_\ BZ+YAVA][_R%_P *7:'WO_(M_P#"_/ 7_0QVOY-_A1_P MOSP%_P!#':_DW^%5/^&_\ (?\ PI=H?>_\BW_POSP%_P!#':_DW^%'_"_/ 7_0QVOY-_A53_AG M#X>?]"ZO_@7/_P#%T?\ #.'P\_Z%U?\ P+G_ /BZ+YAVA][_ ,A?\*7:'WO_ M "+?_"_/ 7_0QVOY-_A1_P +\\!?]#':_DW^%5/^&_\A_\*7:'WO\ R+?_ OSP%_T,=K^3?X4 M?\+\\!?]#':_DW^%5/\ AG#X>?\ 0NK_ .!<_P#\71_PSA\//^A=7_P+G_\ MBZ+YAVA][_R%_P *7:'WO_(M_P#"_/ 7_0QVOY-_A1_POSP%_P!#':_DW^%5 M/^&_\ (?\ PI=H M?>_\BW_POSP%_P!#':_DW^%'_"_/ 7_0QVOY-_A53_AG#X>?]"ZO_@7/_P#% MT?\ #.'P\_Z%U?\ P+G_ /BZ+YAVA][_ ,A?\*7:'WO_ "+?_"_/ 7_0QVOY M-_A1_P +\\!?]#':_DW^%5/^&_\A_\*7:'WO\ R+?_ OSP%_T,=K^3?X4?\+\\!?]#':_DW^% M5/\ AG#X>?\ 0NK_ .!<_P#\71_PSA\//^A=7_P+G_\ BZ+YAVA][_R%_P * M7:'WO_(M_P#"_/ 7_0QVOY-_A1_POSP%_P!#':_DW^%5/^&_\ (?\ PI=H?>_\BW_POSP%_P!# M':_DW^%'_"_/ 7_0QVOY-_A53_AG#X>?]"ZO_@7/_P#%T?\ #.'P\_Z%U?\ MP+G_ /BZ+YAVA][_ ,A?\*7:'WO_ "+?_"_/ 7_0QVOY-_A1_P +\\!?]#': M_DW^%5/^&_\A_\ M*7:'WO\ R+?_ OSP%_T,=K^3?X4?\+\\!?]#':_DW^%5/\ AG#X>?\ 0NK_ M .!<_P#\71_PSA\//^A=7_P+G_\ BZ+YAVA][_R#_A2[0^]_Y%O_ (7YX"_Z M&.U_)O\ "C_A?G@+_H8[7\F_PJI_PSA\//\ H75_\"Y__BZ/^&?]"ZO_@7/_\ %T?\,X?#S_H75_\ N?_ .+HOF':'WO_ "#_ M (4NT/O?^1;_ .%^> O^ACM?R;_"C_A?G@+_ *&.U_)O\*J?\,X?#S_H75_\ M"Y__ (NC_AG#X>?]"ZO_ (%S_P#Q=%\P[0^]_P"0?\*7:'WO_(M_\+\\!?\ M0QVOY-_A1_POSP%_T,=K^3?X54_X9P^'G_0NK_X%S_\ Q='_ SA\//^A=7_ M ,"Y_P#XNB^8=H?>_P#(/^%+M#[W_D6_^%^> O\ H8[7\F_PH_X7YX"_Z&.U M_)O\*J?\,X?#S_H75_\ N?_ .+H_P"& O^ACM?R;_"C_ (7YX"_Z&.U_)O\ "JG_ SA\//^ MA=7_ ,"Y_P#XNC_AG#X>?]"ZO_@7/_\ %T7S#M#[W_D/_A2[0^]_Y%O_ (7Y MX"_Z&.U_)O\ "C_A?G@+_H8[7\F_PJI_PSA\//\ H75_\"Y__BZ/^& O\ MH8[7\F_PJI_PSA\//^A=7_P+G_\ BZ/^& O\ H8[7\F_PH_X7YX"_Z&.U_)O\*J?\,X?#S_H7 M5_\ N?_ .+H_P"& O^ACM?R;_"C_ (7YX"_Z&.U_)O\ "JG_ SA\//^A=7_ ,"Y_P#XNC_A MG#X>?]"ZO_@7/_\ %T7S#M#[W_D/_A2[0^]_Y%O_ (7YX"_Z&.U_)O\ "C_A M?G@+_H8[7\F_PJI_PSA\//\ H75_\"Y__BZ/^& O\ H8[7\F_PJI_PSA\/ M/^A=7_P+G_\ BZ/^& O\ H8[7\F_PH_X7YX"_Z&.U_)O\*J?\,X?#S_H75_\ N?_ .+H_P"& M O^ACM?R;_"C_ M (7YX"_Z&.U_)O\ "JG_ SA\//^A=7_ ,"Y_P#XNC_AG#X>?]"ZO_@7/_\ M%T7S#M#[W_D/_A2[0^]_Y%O_ (7YX"_Z&.U_)O\ "C_A?G@+_H8[7\F_PJI_ MPSA\//\ H75_\"Y__BZ/^& O\ H8[7\F_PJI_PSA\//^A=7_P+G_\ BZ/^ M& O\ H8[7\F_P MH_X7YX"_Z&.U_)O\*J?\,X?#S_H75_\ N?_ .+H_P"& O^ACM?R;_"C_ (7YX"_Z&.U_)O\ M"JG_ SA\//^A=7_ ,"Y_P#XNC_AG#X>?]"ZO_@7/_\ %T7S#M#[W_D/_A2[ M0^]_Y%O_ (7YX"_Z&.U_)O\ "C_A?G@+_H8[7\F_PJI_PSA\//\ H75_\"Y_ M_BZ/^& O\ H8[7\F_PJI_PSA\//^A=7_P+G_\ BZ/^& O\ H8[7\F_PH_X7YX"_Z&.U_)O\ M*J?\,X?#S_H75_\ N?_ .+H_P"& O^ACM?R;_"C_ (7YX"_Z&.U_)O\ "JG_ SA\//^A=7_ M ,"Y_P#XNC_AG#X>?]"ZO_@7/_\ %T7S#M#[W_D/_A2[0^]_Y%O_ (7YX"_Z M&.U_)O\ "C_A?G@+_H8[7\F_PJI_PSA\//\ H75_\"Y__BZ/^&?]"ZO_@7/_\ %T?\,X?#S_H75_\ N?_ .+HOF':'WO_ "#_ M (4NT/O?^1;_ .%^> O^ACM?R;_"C_A?G@+_ *&.U_)O\*J?\,X?#S_H75_\ M"Y__ (NC_AG#X>?]"ZO_ (%S_P#Q=%\P[0^]_P"0?\*7:'WO_(M_\+\\!?\ M0QVOY-_A1_POSP%_T,=K^3?X54_X9P^'G_0NK_X%S_\ Q='_ SA\//^A=7_ M ,"Y_P#XNB^8=H?>_P#(7_"EVA][_P BW_POSP%_T,=K^3?X4?\ "_/ 7_0Q MVOY-_A53_AG#X>?]"ZO_ (%S_P#Q='_#.'P\_P"A=7_P+G_^+HOF':'WO_(? M_"EVA][_ ,BW_P +\\!?]#':_DW^%'_"_/ 7_0QVOY-_A53_ (9P^'G_ $+J M_P#@7/\ _%T?\,X?#S_H75_\"Y__ (NB^8=H?>_\A?\ "EVA][_R+?\ POSP M%_T,=K^3?X4?\+\\!?\ 0QVOY-_A53_AG#X>?]"ZO_@7/_\ %T?\,X?#S_H7 M5_\ N?_ .+HOF':'WO_ "'_ ,*7:'WO_(M_\+\\!?\ 0QVOY-_A1_POSP%_ MT,=K^3?X54_X9P^'G_0NK_X%S_\ Q='_ SA\//^A=7_ ,"Y_P#XNB^8=H?> M_P#(7_"EVA][_P BW_POSP%_T,=K^3?X4?\ "_/ 7_0QVOY-_A53_AG#X>?] M"ZO_ (%S_P#Q='_#.'P\_P"A=7_P+G_^+HOF':'WO_(?_"EVA][_ ,BW_P + M\\!?]#':_DW^%'_"_/ 7_0QVOY-_A53_ (9P^'G_ $+J_P#@7/\ _%T?\,X? M#S_H75_\"Y__ (NB^8=H?>_\A?\ "EVA][_R+?\ POSP%_T,=K^3?X4?\+\\ M!?\ 0QVOY-_A53_AG#X>?]"ZO_@7/_\ %T?\,X?#S_H75_\ N?_ .+HOF': M'WO_ "'_ ,*7:'WO_(M_\+\\!?\ 0QVOY-_A1_POSP%_T,=K^3?X54_X9P^' MG_0NK_X%S_\ Q='_ SA\//^A=7_ ,"Y_P#XNB^8=H?>_P#(7_"EVA][_P B MW_POSP%_T,=K^3?X4?\ "_/ 7_0QVOY-_A53_AG#X>?]"ZO_ (%S_P#Q='_# M.'P\_P"A=7_P+G_^+HOF':'WO_(?_"EVA][_ ,BW_P +\\!?]#':_DW^%'_" M_/ 7_0QVOY-_A53_ (9P^'G_ $+J_P#@7/\ _%T?\,X?#S_H75_\"Y__ (NB M^8=H?>_\A?\ "EVA][_R+?\ POSP%_T,=K^3?X4?\+\\!?\ 0QVOY-_A53_A MG#X>?]"ZO_@7/_\ %T?\,X?#S_H75_\ N?_ .+HOF':'WO_ "'_ ,*7:'WO M_(M_\+\\!?\ 0QVOY-_A1_POSP%_T,=K^3?X54_X9P^'G_0NK_X%S_\ Q='_ M SA\//^A=7_ ,"Y_P#XNB^8=H?>_P#(7_"EVA][_P BW_POOP%_T,=K^3?X M4O\ POOP%_T,EI_X]_A5,_LX?#S_ *%U?_ N?_XND_X9R^'W_0NK_P"!<_\ M\73OF':'WO\ R*7]H]5#[W_D7?\ A?7@/_H8[3_Q[_"@?'KP&?\ F8[3_P > M_P *I_\ #.?P^_Z%Y?\ P*G_ /BZ/^&=/A__ -"\O_@5/_\ %T7S#M#[W_D' M_"A_<^]_Y%W_ (7QX$_Z&.U_\>_PIW_"]O O_0Q6OY-_A5'_ (9U^'__ $+R M?^!4_P#\72_\,[^ /^A>7_P*G_\ BZ+YAVA][_R'?,.T/O?^1=_X7IX&_P"A MBM?R;_"E'QQ\#G_F8;7\F_PJE_PSUX!'_,OJ/^WJ?_XNE'[/W@(=- 7_ ,"I MO_BZ+YAVA][_ ,A_[?VC][_R+P^-_@@]/$%K^3?X4O\ PNWP2?\ F/VWY-_A M5(? #P&/^8"O_@3-_P#%T?\ "@_ PZ:$O_@3-_\ %T[X_M#[W_D-/'=5'[W_ M )%[_A=?@K_H/6Y_!O\ "E'QI\&'_F.V_P"3?X52'P%\#C_F!+_X$S?_ !=. M'P)\$#_F!K_X$R__ !5'^W]H_>_\BO\ ;?[OXEX?&3P:?^8[;_DW^%'_ N/ MP=_T';?\F_PJD/@5X)'31%_\")?_ (JG#X'>"P,#1%_\")?_ (JJ_P!N[1^] M_P"0[XO^[^)<_P"%Q>#^VN6_Y-_A1_PN'PA_T&[?\F_PJG_PH_P6/^8*/_ F M;_XJC_A2/@S_ * H_P# B7_XJG_MO]W\1WQ?]W\2Y_PN#PA_T&X/R;_"E_X7 M!X0_Z#<'Y-_A5/\ X4EX,'_,%'_@1+_\51_PI/P;_P! 8?\ @1+_ /%4?[;_ M '?Q#_:_[OXES_A<'A#_ *#EO^3?X4?\+@\(?]!RW_)O\*I_\*3\&_\ 0%'_ M ($2_P#Q5'_"D_!O_0%'_@1+_P#%4?[;_=_$?^U]H_>RW_PN#PA_T&X/R;_" ME_X7!X1_Z#<'Y-_A5/\ X4GX-_Z P_\ B7_ .*H_P"%)^#3_P P4?\ @1+_ M /%4?[;_ '?Q%_M?]W\2Y_PN#PC_ -!N#\F_PI/^%P^$/^@W!^3?X54_X4EX M,_Z H_\ B7_ .*I/^%(^#/^@*/_ (E_P#BJ/\ ;?[OXA?%_P!W\2X/C#X0 M_P"@W!^3?X4?\+A\'_\ 0"?^@(O_@3-_\ %4A^!7@G_H!K_P"!$O\ \51? M'=H_>_\ (+XS^[^)=_X7-X,_Z#UO^3?X4?\ "Y?!O_0=M_R;_"J/_"B/!'_0 M#7_P(E_^+I1\"?! _P"8&O\ X$2__%47QW:/WO\ R"^,Z\OXE[_A_P#(+XO^ M[^)<_P"%R>#?^@[;_DW^%'_"X_!O_0=M_P F_P *I_\ "C?!7_0$7_P)E_\ MBJ/^%&^"O^@(O_@3+_\ %4[X[M'[W_D%\7_=_$N'XR>#1_S';?\ )O\ "C_A M"#_P P-?\ P)E_^+H_V_M'[W_D*^,_N_B6_P#A=?@K_H/6 M_P"3?X4?\+L\%#_F/VWY-_A5(_ 7P,>NA+_X$S?_ !='_"@O O\ T 5_\"9O M_BZ7^W]H_>_\A7QO:/WLN?\ "[O!/_0P6WY-_A15+_A0'@/_ * *?^!,W_Q= M%%\?VA][_P A7QW:/WO_ "/1J***]4],**** "BBB@ HHHH **** "BBB@ H MHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BB MB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** M "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH M**** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ H MHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BB MB@!,48I:* $Q2T44 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 M4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4F*6B@!,44M% M "9HS110 9HS110 9HS110 9HS110 9HS110 9HS110 9HS110 9HS110 9H MS110 9HS110 9HS110 9HS110 9HS110 9HS110 9HS110 9HS110 9HS110 M 9HS110 9HS110 9HS110 9HS110 9HS110 9HS110 9HS110 9HS110 9HS M110 9HS110 9HS110 9HS110 9HS110 9HS110 9HS110 9HS110 9HS110 M9HS110 9HS110 9HS110 9HS110 9HS110 9HS110 9HS110 9HS110 9HS1 M10 9HS110 9HS110 9HS110 9HS110 9HS110 9HS110 9HS110 9HS110 9 MHS110 9HS110 9HS110 9HS110 9HS110 9HS110 9HS110 9HS110 9HS11 M0 9HS110 9HS110 9HS110 9HS110 9HS110 9HS110 9HS110 9HS110 9H MS110 9HS110 9HS110 9HS110 9HS110 9HS110 9HS110 9HS110 9HS110 M 9HS110 9HS110 9HS110 9HS110 9HS110 9HS110 9HHHH 6BBB@ HHHH M**** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ H MHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BB MB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** M "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH M**** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ H MHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BB MB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** M "BBB@ HHHH **** "BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6 MBDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6 MBDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6 MBDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6 MBDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6 MBDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6 MBDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6 MBDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6 MBDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BBB@ HHHH **** "BB MB@#$\2^./#G@Q8&\0:_I>A+.2(3J5[';B0C&=N]AG&1T]:PU^.7PX=@%^('A M9B>PUJV_^+KX!_X+/V,6IS_!.SG!,%QJ=W%( <$JQMP>?H:]A'_!(K]GB2$? M\2K7E)'4:Q)Q^8H ^R=+U:QURR2\TZ]M]0M'^Y/:RK)&WT920:MU^3W[0'[- M_BK_ ()HZOI7Q=^"WB?5KSP6+N.WUO0-4F$BX8_*)-H59(VY4,5W(Q4@G.1^ MF_PL^(FF_%KX<>&_&6D$_P!G:W8Q7L2LIPL4FM8;@W$D3#JKB(-L/LV#7:?#'XT^!/C/IDM_X'\6: M5XGMH2!-_9]RLCPD]!(GWDSVW 9H [6BN \+_'KP#XS^(VN> M'\26]YXPT1 M6;4-(\N1)8 K!23N4 C++]TGJ#TKKO$/B#3O">@ZAK6KW<=AI6GV[W5U=3'" M11(I9F/L #0 NN>(-+\,:=)J&LZE9Z381D![J^G2&)23@ LQ &3[U8L-0M=5 MLH+RRN8;RSG020W%O('CD4C(96'!!'<5\V_'?QE\"_VE/V6]6U+Q+XWFM_A9 M<7D44^O::LD+":.5=JKOA8GY\ G81UYKV7X*:;X#K'PA?RZIX5MM*M MXM+O9SEY[81@1NQVKR5P?NCZ"@#M:R/^$OT'_A(O^$?_ +;T[^WMGF?V7]KC M^U;<9W>5G=C'.<=*\K\3_MI_ SP;XH?P]K'Q0\/6FKQR>5+ +KS%B?."LCH" MB$=PQ&.]?)6D:G9ZU_P63BO]/NX+ZQN?"XE@N;:021RH; $,K D$$=Q0!^D% M9?B'Q3HOA&Q6]UW5[#1;-G$8N-1N4@C+'.%W.0,\'CVK4KX._P""RW_)JFF_ M]C':_P#HJ:@#ZY'QS^&Y.!\0?"Q/_8:MO_BZZ?0_$>D^)K0W6CZI9:M; X,U MC<),F?3,/A9X/UW4=+UMM0U/1[2]N&CU:15,DD*NQ QP M,D\5YC^TE^P5J/[&^@R?&;]GSQ9KVEW7A_%QJ>DW=R)0]N#\S*0J[T'\4<@8 M%V1D9[,* MM?%+]J'X3_!6_6P\:^/=%T'464-]AFN-]R%/0F) S@'L2,&@#U&BN(^%_P ; M_ /QIT^:]\#>+M*\3PPX\X:?F^/[R9[;@,T>/OC7X(^%VN^&]&\4^( M+?1M3\1W'V72K>9')NI&_B3H$.N>%-=T_ MQ%I$Q(2]TVY2>(D=5RI.".X/([T ;]%>&)/&&FVNM^&+?[ M5K,%V[0+8Q?+\\DC@(!\Z_Q=ZYKPC^VI\#/'7B2/0-$^)_A^\U:5_*BMVN/* M\Y\X"QLX57)[!2<]J /:Z*** "BBB@ HHHH **** "BBB@ HHHH **** "BB MB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** M "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH M**** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ H MHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BB MB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** M "BBB@ HHHH 3-&:** #-&:** #-&:** #-&:** /S2_X+'_ /(6^!7_ &%[ MC_T*WK]*X3^Z3_=%?FC_ ,%EIX[:_P#@=-,ZQ11ZK(K^);^\TY&-NL:,&6)7( 8;@&9 MQ\JJG7KCU#]KC0?$W[*7_!-^T\+>"+JX@N]+M[/2]1U*Q)62.*1C]IE5ARH: M1L9[!Z *GPM_9T_90_9D^'=MH/Q1U;X;Z]XUC5CJ]]KUU;SSR3$G(CAE)=% MP %4'C)Y-?/W[/\ KOPS\-?\%1=%@^!.J*_@+6[":"ZM[03+;B7[/(\D:"4 ME \:..H!/!P*]+_92^ _[&7_ H[PUXK\2:GX5USQ!+9)<:O<^)M="20W)&9 M(VMFE55"MD %,D8.6SFO*?AG\0_A_P".O^"J?@:]^&>CV6C>!K2&33=..G6* MV=O=%+6D_P#!5GXJW'A/]G>V\%:,S2:_X\U"+2;>&(_.\(8-+CZG MRT_[:5W?_!17X+'XU_LL>*;6T@,NM:&@UO3BHR_F0 EU'^]&9!]2*^+/V9/& MNH_MX?M6?";4=6BDFT3X8>&(+B^$H^674$PN\^[2^6WN(C0![3^VC\)[;X'? M\$O8O!%LJ@Z3'IL4[*/]9.;A&F?\79C6=^T/\:-6^#?_ 2V^';:#=26.K^( M-&TS1H[J%BKQ1O;[I2I'()1&7(Z;J]7_ ."K?_)E?BS_ *_+'_TH2O(_VCO@ MWJ_Q?_X);?#EM"M9+[5/#NCZ9K*VL*[GEB2WV2A0.I".6Q_LF@#UC]FS_@GE M\&_"WP/T"U\3>!]*\5>(-4T^*ZU/4]5A\Z8RR(&98F/,2KG:-F#QDDGFOF+] MGOX%VG[.W_!5X>#M+N+B?08M(NKK2UN9#(\-M+;,RQ;CU"-N4?3-?6?[+W[= M?PF^(/P-T"_UGQSH7AC6],T^*VU73=9OXK2:*6- K,JR,"Z-MR"N>H'7BOE? MX'_';2/VA_\ @K3_ ,)3X>9YO#\>CW6GV%PZ%#<116S*9 #R S%R,\XQTH _ M5/-?!W_!9;_DU33?^QCM?_14U?>-?!W_ 66_P"35--_[&.U_P#14U 'UG^S MZ?\ BP_PY_[%W3__ $FCJ;XZP6UU\$_'\5X ;5] OQ*&'&W[.^:\H^!_[4_P M8T;X+> [&_\ BSX(L[VUT&QAGMI_$-HDD3K;H&1E,F0P(((/((KP7]NS]O[P M/K/PLU3X9_"?6H_'7C7Q6O\ 92_V&&GB@BD.U\2*-KNP)150G[V3C R >9_L M"?%S4O@Q_P $Y?C!XOM>;C1=2N7T[>,JL[P0(AQW =U.*]"_X)Y_L8^!?'_P M@M?BW\4-%M_B!XP\7S37IFU]?M4<47F,H^1\JSL5+%F!/( QCGN?!/[&.K>% M_P#@G!K?PD,2CQEK&F3:A M3';:V(5^BS6@'\J /L#X7_L@_"#X/3Z#?^&? FD6&MZ- 8K?6%@S>,638[O+ MU=F!/+9QDXQ7YS_\$Y_V9O"GQ\^+/Q6U;QY9'Q#H/AO6)/L6AW,C&T:ZFDDW M321@X%/#/BVU\(17TD5SJLURCE;FW";C%E#\J[B&.<@[0*^??^ M"SW_ "1+P#_V,Z?^B)*R?^"M/C3Q'HGPE^%6@6]_>Z1X*URZ$6O7=GG+*J1E M(VQU&UI&VGAB@]* .\_X5U^PS\'?!$'AS7[CX:WLUM (;JYN[J"\U*5P,.Y9 M"TRL3D_+C';%>,_\$J];T'3?VHOC?X9\ ZI/?_#=X3>Z4)/, 9$N D3[9 &! MV2%[2-ES M_<6,<\;17C'_ 3%\8Z5XU_;=^-&MZ+I2Z%H^JZ=+=:=IRP+ (;8W41C C M4;"IP..: ,Q/@9I/[0O_ 57^)OACQ*]Q-X5MU&I:EIT,S1+?"*& 1Q2%2"5 MWNK'Z5Z__P %'OV.?A+X4_9?USQ=X3\%:5X3U_PZ]O+;W>CVXMS(C3)&R2!< M!^'SELD$#GK5']G[_E+I\:_^P._\K2O>O^"F7_)E'Q'_ .N-K_Z514 >@?L? M>+-1\;_LO?#'6]6N'N]2N]"MS//(\T &:,T44 &:,T44 &:,T44 &:,T44 &:,T44 &:,T44 &:,T44 M&:,T44 &:,T44 &:,T44 &:,T44 &:,T44 &:,T44 &:,T44 &:,T44 &:,T M44 &:,T44 &:,T44 &:,T44 &:,T44 &:,T44 &:,T44 &:,T44 &:,T44 & M:,T44 &:,T44 &:,T44 &:,T44 &:,T44 &:,T44 &:,T44 &:,T44 &:,T4 M4 &:,T44 &:,T44 &:,T44 &:,T44 &:,T44 &:,T44 &:,T44 &:,T44 &: M,T44 &:,T44 &:,T44 &:,T44 &:,T44 &:,T44 &:,T44 &:,T44 &:,T44 M &:,T44 &:,T44 &:,T44 &:,T44 &:,T44 &:,T44 &:,T44 &:,T44 &:, MT44 &:,T44 &:,T44 &:,T44 &:,T44 &:,T44 &:*** %HHHH **** "BBB M@ HHHH \M^./[,7PT_:1@TF'XC>&O^$BCTII'LU^WW-KY1<*'_U$B;L[5ZYZ M<5Y0O_!+K]F)6!'PR&1ZZ]J9_P#;FOJFB@#S;X2?LW_#'X$I+_P@?@K2O#DT MR[)+JWB+W,B_W6FX,I M7=MP99'V@;F^5<#GI7I]% ''_%?X2>$_C?X*N_"7C72O[:\/7;QR36?VF6#< MR,&4[XG5Q@@'@UL>$?"6D^!/"VE>'-#M/L.BZ7;1V=G:^8\GE1(H55W.2S8 M'))/O6Q10!\]^,O^"?W[/GCWQ-+X@UGX8Z9)JDTGFRR6D]Q:1R.3DLT4,B(Q M)Y)*\]ZZWPQ^RK\*?!?Q$TSQSH'@VTT;Q+IMA_9EGVQ*H8*VZ% MT;@,W&<<]*[VB@#Y5'_!+G]F(?\ -,O_ "O:G_\ )->F_";]D?X/? W4!J'@ MGP!I.C:D 574&5[FY0'J%FF9W7/?!&:]=HH *\5^+7[&/P5^.6M-K'C3X?Z= MJNK/CS+^"2:SGEQT\R2!T9_3YB:]JHH \W^$'[.7PT^ =K/!X!\':;X<,X"S M7$"M)<2J.BO-(6D8>Q;%+\5?V=_A]\;=8\,ZKXU\/_VU?^&[C[7I4WVVX@^S M2[D;=B*10_,:'#@CCW->CT4 %>E>CT4 >>?&C]G_P%^T+HFGZ1\0-!_M_3K"Z%Y;0 M_;+BV\N8*5W9AD0G@G@DCVK>\9_#;PO\1?",WA?Q/H5EKWA^5%1["_B$L>%^ MZ1GD,.S Y'K72T4 ?.?A;_@G=^SIX.UR/5M.^%VF->1OYB?;[FYO8@W4'RIY M73_QVO0M&_9Q^'7AWXO7WQ0TSPZ+'QQ?6_V2YU*"\N%26+:J;3!YGD]$3^#/ MR@]>:]*HH \X\/\ [._P^\+?%W6_BAI?A_[+XYUJ$V]_JOVVX?SD.SCRFD,: M_P"K3E5!X]S6_P#$WX9>&OC%X)U+PCXOTW^U_#VHA5NK/SY8/,"L'7YXF5QA ME!X(Z5U%% &!X#\"Z'\,O!VD^%?#5C_9N@Z5 +:SM/->7RHQT7?(S,W7J236 M_110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %% M%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 444 M4 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 M 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% ! M1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %% M%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% "9HS2T4 ) MFC-+10 F:,TM% "9HS2T4 +]5LI=1L].^SRGS; M>,D._F!=@P0>"P)["NBUG5[3P_I%]JE_+]GL;*![FXEVEMD:*69L $G !. " M:^4_B'_RDR^$W_8E:G_Z&U?1'QD_Y)%XX_[ =]_Z(>@#1\!^.]#^)O@_2?%/ MAJ^_M+0=5@%S9W?DR1>;&>C;'56'3H0#6]FOS:^#&I_M ^!_V%_#OQ*T#QOX M=TG0?#6AF[M/"$NA"X^WVD+,6:>[:0.DC@,0(U P,YR1]*>/OB;\4/''@OX M;ZKX$N]"\ >'?$6FIJFN>,]>,-PFD*\2O'#%;R2IYCL6(W'*@#G% 'TCFC-? M%7P:^/GCO6?CKXJ^#LGQ7\,?%!IO#$NK:3XPT"RMXI+"Z#>7Y,\43R1'!96P M><8SUQ6AHO[7^NV?[#FM^/-9,;?$S1))_#ES;"%5WZTLWD1CRP,?,S(^T#&, M\8H ^Q*?'/B2UA?_2' M M[6V+1Q%R*='\%Z%>:UKVIVNCZ19IYEQ>WLHBBB7 M.,LQX') ]R0*Q=3^+/A31_''AKPA=ZL(O$7B.WFNM*LQ!*WVF*)0TC;PI1< M@_,P)[9KY[_X*?:7J]_^R1XGFTW7/[*M+66WDOK7[(DWVV,SQJL>YN8\,5?< MO)VXZ&O)OBQH7Q-T?]H?]F72=)\5Z?KOCB;1M7C'B+5=+6&"")XT)D-M$P#& M.,X4;@&8#/4T ?H5FC-?*'P_^+GQ(^%7[0^L?#'XH^*=.\=:4WA:3Q38^(+3 M25TV>)(I-DL,D2,R$8!(.<\#GG \0T;]M;Q7\3_#=_X[L_V@/AI\-G+S2:3\ M/=5M(;B26%&(1;RX:59(Y)-O\"X&X4 ?H]FO)_C3^U'\//@%J>CZ7XMU6ZCU M?5E:2STW3K">]N)(U.&DV1(Q"@]SCOC.#5G]F;XV0?M$?!'PQX\BM%T^74X6 M%S:(^]89T=HY%5NZ[E)!]"*^8?'O@CQ[?_\ !2K018?$G^S7E\)SWMJW]A6\ MOV6R%T ]E\Q^;<7*@==RE3@C(R#R#[5S/Q&^* M7ACX3:19:IXKU/\ LJQO;^#3()?L\LV^XF;;$F(U8C)XR1@=R*^9_!/C_P". M'[5-_P"+_$?P_P#&VB?#3P1HVJW&CZ/#N M,GRGXT_'36/C;^S5HJ>*=.M=+\:>%_BGI>@:W!8DFV>XAN/];%NR0C@@@$G' M- 'W=H'Q2\,>*/''B7P?IFI_:O$?AQ8&U6R^SRI]G$REHOG90C;E!/RDX[XK MJLU\/:=\4;/X*?M%?M@>.;Z!KNWT/2M%N_LZ-M,S"U8(F>VYBHSVS5W4?$W[ M4'AWX,'XT7?C#PM>K%8#7;GX=+H.R!++;YC1)>^89?-$?/(QN&.>X!]J9HS7 MRQ\-?VG-4\0_'NRM]2O@OP]\8>!(/%GAZ&:"-'M)(\?:XC( "Y .[DG&..*\ MS_9Y_;@\5Z[\./CAXB\?2PK-X?LO^$D\/1"".+.FSK)]E3Y0-_SHHW')._K0 M!]DW_P 4O#&E_$?2O 5UJ?E>+-4LI=1L]/\ L\I\VWC.'?S NP8/8L">P-=5 MFOD'X7_%WXFI\;/@?X1\8:O#>3>(? MUKFMI]@@B9KO<&0 J@*!%8+M7 .,G M)KCO@WX\_:4^/_PO\3^+-+^(N@>%H="U34K.RAF\.QWU 'V;FC-<-\=?%&H^"?@MXZ\0Z1,+;5=+T2\O+ M69D5PDL<+,A*L"#@@<$8KY8\.?'[XL_#?]F#_AH#XC>+=+UW3;S089[+P;9Z M-':A;J9HTMY'NPVX[L[G4* -QVX H ^X,URMM\4O#%Y\2KWX?PZGO\76>G)J ML^G?9Y1LM7?8LGF%=ARW& V?:O@O6/VU?%GPR\,V/CR]_: ^&GQ&E$D,NK?# MO2;2&!XH78!UL[E96DDDC#9^=<':?Q]1L?'6F:-^W9X_\93.QT>V^%-KJS,! M\QA68R\#UVB@#[-S1FOS.O%_[27Q*T3PC$FJ^%O ?A^. M)]) AC_M+7)@9(XC.XR@5 ?F !/->%?%OX\?&GX*_#J7QYXB^.?P[C\5V@2 MYNOA6NGVO=P'M8[A;AIGD4$\@8)!YQR0#]!LT%@ 23@#N:^0?BG\;OBMK_[0 M'PM\#_#G5=+T&R\9>$I=7N9]5L5NUL"&5C.JC:TCJOR*A8*2P)Z5-X%\=_%V MV^+_ ,0?@?XN\;Z=K&K)X977M"\:6>AQV\L*N_E,LMKN,;%6Z<]N3SP ?47A M?Q?HGC;2O[3\/ZK::SIWFR0"[LI1+$SQL4=0PX.&!!QW%YF8$B...-69C@$],#O7SO_P2VT'Q%I_[.=O? M:EXH.K:/=7MXMEI/]GQP_8G2ZF$K^:IW2>8><-]WH*Q_V\_"?C#6/CC^S[)H M_CK^P[6[\3K;6%O_ &1!<_8+L1.3=;G.9!OBYJ\F MD>'-3N9=8BTZ#5IM/O-/N+6:&VF)$;MYB*,D@_+G([BO1\U\H6GQ>\AU.#PIX!M-4M+G^SX87>^,3EYCM7.&9<["2HZ 5Y=H?Q5_:8UO]D^ MU^/'_">>&[-+'2?[4/A5_#R2+J4$6?,DFN0ZF-W"LP6- H&!GJ: /T S1FOF M_P ?_$SXH>-_!GPWU3P)=Z%X \.^(M-35-<\9Z\8;A-(5XE>.&*WDE3S'8L1 MN.5 '.*X?X ?M%>+)OVC-<^%.M?$OPQ\8--'A]]:L_$N@6L%O);2I($>WF2" M1X\X(/7/3/7% 'V1FC-? GPC^(W[3/QI_9XO_B;9?$3P]X?_ +(%^UKILOAV M.Y?6!;R2;C/)N40@[=BB-,_+DG)KM=3_ &N?&OCWX:? FQ\"66E:7\0OBI"\ MANM0C::STJ*%-US,(P07((.Q2?KF@#Z[UC5[30-(O=3OY?(L;*![F>7:6V1H MI9FP 2< $X S69X"\=Z%\3O!VD^*O#5]_:>@ZK"+BSN_)DB\V,D@'8ZJPZ'@ M@&O [:;]H+X5W?B>W\5:[I/Q%\)#P[>7]MXKM]-@TRYTV]BC9DADM1(PEC;' M! /^UQ6#X3^*_P 9/'7[*OPCU[PS<:%9ZUXBMUE\1>,=92".TT>#YLS+;;XQ M([$!55?E'<7E_IR7BVWDA&\]4."S*NX!=P4EANR!7" M?%O]IGQ?\/OB-H7P8OOC!X3\(ZW9Z3_:GB#XB^(-,BB$I>0B&"ULC((_,*X+ M98C'(]P#[7UO6;/P[HU_JNH3?9["Q@DNKB;:S;(T4LS84$G !. ":SO OCG1 M/B7X/TGQ3X;O?[2T+58%N;.[\IXO-C/1MKJK#Z$ U\9> /VJ+[QS%\7?A7K? MC?PU\3I;/P?>:OI?C#PS&L*74/E.DD-Q"CLLKJ1T36-;W6CZ+;HMSJ,<"N+TMSMZ8\G!2@#[_\'^+M)\?> M%M*\1Z#=_;]%U6V2[L[KRWC\V)QE6VN PR#T(!]JU\U\4:3^T=\3_B3IOP3^ M'?@G4-*TOQOXK\)Q^)=>\4ZA8+-%I]L %+16RE4:1WR #A1Z)-*N=1\/^*K'31ITWFP#,MO/ K,GW>0RGZYSP ?4 MV:,U\"?"/XC?M,_&G]GB_P#B;9?$3P]X?_L@7[6NFR^'8[E]8%O))N,\FY1" M#MV*(TS\N2_M-&=(\[$ MBR 3(X;:9#@ '/<@ ^WKV\AT^SGNKA_+@@C:61\$[549)P.>@K!^'/Q'\._% MKP9IOBOPIJ/]JZ!J*L]K>>1)#Y@5BA^2158?,I'('2O"O@SXL^(>NZ3XX@U[ MQUX3^+'@A=):;2O&7AT003/,4;S+>>"&1T&!R&!'OUP/FO\ 9H/Q^T;]A[3? M&_A3QSX?\.:%X;T^]O+#PW/H0NVU.&&65Y#<7+2 QEB'"B-> %R%_"VKZG]DU[Q,\T>DVGV>5_M+1)OD&]5*IA3GYR,]LUU6:^2Y/ MVE/$GBKQI^RO8-,TKXA6EW=ZO8^0DN2MFLBJDC L@#D\J02.N:Y[X9>+O MVA_C[XO^+%EHGQ T?P5H'A7Q1>Z7I][-X?BOKB[*$;(&4LBK$@QE\,[%SSQ0 M!]JYHS7P3XG_ &Y?'-C\!K2ZO4TGPEXOL?&;>"O%'B1[.2\T[1S'G=>K"#EE M8;=JL< D^U>P?LW>-OB)X@\:S0W'Q.\'_&OX>36'GKXET2*WL[VQN]W$$D$, MCJ5*Y.3@@]: /HO5]8L/#^EW>I:G>0:=IUI$TUQ=W4@CBAC499F9L!0!U)HT M?6++Q!I-EJFFW,=YI]["EQ;W$1RDL; ,K*>X((->&?MY:9JVI_LG?$8:3K7] MBM!I4\]RWV5)_M,"QMO@^;[F_CYQR,<5XWHWQ2^)'PC^ OP*\!>'M"3EB>>F" ?<6:,U\F3_$;XO?LX?% MGX?Z)\2?%NE?$KP;XWO_ .QH]5MM%72KO3+\KF,%(W9)(FP1D_,/PY^C?BAX M]L_A;\.?$OB_4(VEL]#T^>_DB0X9Q&A;:#ZG&/QH N^,_&6C_#WPGJWB7Q!> M?V?HFE6[W=Y=>4\GE1*,LVU 6.!V )KG;?XY>"+K7O!FBQ:WNU/QC8OJ6AP? M99Q]LMTC$C/NV83"L#ARIYZ9KXO^+]S^T7X]_8Y\4_$C5_%?AM]&U_P_+>S^ M X-%V"TT^6/(:.]\S>TR(0Y#*5."*]&\$_%7Q'X9\:?LK>#=/N(_[ U[P5-< M7]J;>-I)G@L8FCVR$;DY/\)&>] 'V+FC-?G?X&_:B^*WQ?AUC5M#^,G@7PQX MYM-0G@@^$&NZ3';NPCE*+"]U+*LK2,HR608!...WN_QF^,WQ(O/B7\/OA#X$ M_LKPQXU\0Z5)K6M:SJ$/VZ+1[:/"N(HP5$KF3*C<<8 ]<@ ]_P#&WC31OAUX M2U;Q-XAO/[/T/2K=KJ\NO*>3RHE&6;:@+''H 35OP_KUAXIT'3M9TN?[5INH MVT=W:S[&3S(G4,C;6 (R"#@@'UKXW^.5O\;?#'P#^.?AWXCWVF>-O"R^%)[K M2_&=C:Q:=,TQ&'MIK19&P0/F#J,8ZG)P+,/Q@\>7=G\#O@Q\+[K3=#\0ZMX+ MM-:U3Q)JEJ;M--LDAC0&*#R^%G MQ+U33_B##X@TBZU3P[XBTW3AIUQ+-;KNEM9H%9D!(Y5E]1G.>/&?AC^T]\6O MC%HQ\1>'?C+X"@\*XA1V5) M48J?E."IH ^NLT9KC_A/I_C?2_!EO;_$/5M+UKQ.)93+=Z/ T-NT9<^6 KZ5=6UO%N"[Y'A957)( R2!DD"NDHH ^6_#7P6\9:?_ ,$[Q\,KC1O+ M\L:C\-[+XM> M'_"WA2+2-3\ WVK6]NMK?B-0;D>:WD38QM()/W>,\&OO>B@#XK^#'P0^(VC_ M +7FE?$/4?AAX>^'O@F3PO<:1%I'AV\M7&FOYJNHG$8C#O(0W,2LJC:"W>H? M$W[)'C'4OVQH;^WM8C\%-0U>W\:ZD/M$8QK$$+Q+%Y6[>0[E)"0I7CDY%?;5 M% 'R9\!_!FB_$VWU'2$T;7/">JW,-K*PC;=%<6\LP,88# M@AL<#WXZW]GGPQ\2KGQ[K_BKQGX,\-_#/P_);)::3X4TI+6ZO4;.9)Y[N% # MG 121Z],GZ&HH \6_;(^%>N_&G]F[QGX0\,QPSZ]?01-:0SRB))7CF2387/ M"Y"$ GC)&2*\PT?P+\4?'OQW^ OCWQ%\/F\'P>'-*U:QUJU;6+2\^R.\8C@( M:-\R"3;GY%.W.&Q7UQ10!\X>-?@IX@\6?MD6/BR;2R_@:3P'>>'[O4!<1 K/ M+.3Y?EEO,.4).X+M]Z\9\ ?"?XS_ !\!S_#;3?@;X1^):V#30Z'XXFU*RMD M$#LS1F[@F7S6:/=R$SD# /<_>M% '$_!CPKKW@OX9:#I'BB\T[4/$4$&;^XT MFR2TM6F8EF$<:*H"C.,X!.,D9->:ZU\+?$]W^W#X=^($6F;_ A:>#+C29M1 M^T1#;=-<[UC\O=YARO.X+M]Z^@** /C?P#X.^-W[)][XO\+>"OAQ8_%+P3JN MKW.LZ+>)X@@TR;3FG;<\%PDP^=5;D-'DX^N!RFN?L??$6S^ 5M9R06GB+XAZ M_P#$>S\:>((M/N(XK:V7SMTBQM*R[EC0#W)S@&OO.B@#Y$U;]EK7_B)\3/VG M+;7;0Z3X8^(&EZ;9:3JPFBDWR10,&?RU4TZV@7S_,,?\)&,G/M7VQ10!\4?M5?LG>, MV^"7PPTGX/P#4O%?@VU?0%>6>*W:73[FT:VN7+2.JY'ROC.<] :Q/CU^Q5XL MUSXA_":Q\%649\#MHUCX9\9R"XBCVV-G<13QG:S!G+%&7Y Q]< YK[RHH ^? M/%GPI\3:A^VI\/O'5EI0?PAI/A:_TRZOQ/$HAGD<&./RRPLZO=PVWVF*7=%/*S1-NC=E&X$<$Y'?%?1U% M'Y\Z#^SSXY^''P+_ &?KB)=%TGXQ>!M4OIK+PMK.K01+K$4\DAGM8Y5=E,AC M*L"I('.<59\>^+_BEX[_ &Q_V<&\;^![3X?6$-]J4EIHHUB+4KN1EM?WL\CP MCRU0 JJ@$G[Q..!7UW\:?@7X6^//AZSTOQ+'>12:?=+?:=J>EW3VM[87"\++ M#*O*M@GU'MTKF?A7^RCX4^&'C5_&4VL^)_''B\6QLX-<\8ZN^H7-K ?O1PY" MJ@/?"Y///)R =;\>?#.I>-/@GX\T#1K;[9JVIZ'>6=I;^8J>;*\+*B[F(49) M R2!ZFO'=5_9DU;XE_L):'\(]99/#_B:'0+&#=*RS):WMN$90Q0L&7>F"5)X M)QFOIVB@#XC7PU\??$F@Z1X2A^!7@7P1K220PZAX_FNM/O[/RD(\R6"S$9D+ M. <*XP,]>X[N]_9[UWQ%^U+X[U;5-.*>!->^'P-?4-% 'P5X*^&7QR^#WPU3X9V/P+\&>-=0TV-['2?B#-J-E%;>3DB*: MYMI4\YG0$9 SNQ^)]G^,O[/WB7QQ^R;#X0%S8ZC\1='AM]4T^\T^WBL8&U6! MQ*IB0!4C5FW)G@8;)QS7T=10!\E?#7]G+X@V7[('CK0KR]3P[\8?'9O]5U.\ M2<$07MPQVQ>;&6&T1A4W*3C)(S7A.M_LO?$;6OV<=1^'GAG]F?PAX%\2MI2V MUYXLN=8L+FZU!XP"P@= 9 \S+UF=%4,+[O0 M6M-%T'P!+HVJS/=V[&UO6"8AVK(2_0_,@9>.M=%#\*/%!_;?U?QZ^F;/"%SX M'31H]2^T1'-T+DN8_+W>9]WG=MV^^:^A:* /F/\ 87\$?$;X/^!=2^'?C?P8 MFCV&C7MS/IOBH+F+54FN)).(4/F1;0P^^!G/;%;G[2_PM\3_$#XE_ G5= M TS[?8>&?%7]I:M-]HBC^S6_DLN_#L"_) P@8^U?0%% 'RUJGP6\9W'[1GQT M\41Z-NT+Q+X'@T?2KO[5"/M-VL<@:/9OW)@L/F>M'ASX*^,[#_@G]?4M% 'P3\0OV9OB!-=_ O6= M1^&]E\6O#_A;PI%I&I^ ;[5K>W6UOQ&H-R/-;R)L8VD$G[O&>#6Y\)?@9\2- M,_:QL?B!??"_P]\/O!DWA2ZT:'1_#MY:N--?S%=!.$$8=Y#NYB5E4;06[U]M M44 ?,W[+WP=\7_#K]CNZ\#^(=(_L_P 4/#JZ+8?:8929HOWB.R?,'7^+C M/.*\RT#]F'XG>$/@M^SSXBT+2;+_ (6A\,89X[KPSJ%]&D5]!/N6: 7"%D5] MN"K9*\G)K[FHH ^5VT_X^_&76];U+Q'X<7X9>%;;PY?Z?;>$4UFVU"XUF^GB M94DFEC'EQHF1M&X')R>"<>/:[^RI\2V^"?[.5E?^![7QU:^"+>5/$?PXO-7@ MMX[N5@1')YI8P2&/DX9B#G'S?L9_"WQ1\*/!WCFQ\5: M9_9=UJ7C+5-6M(_M$4WF6LSJ8I,QLP&0#\IPP[@5] T4 ?/OQ-^%GBCQ#^V# M\'?&^GZ9]H\+Z!IFK6^I7WVB)?(DFC B'ELP=MQ'55('?%<=\!_!FB_$VWU'2$T;7/">JW,-K*PC;=%<6\LP,88#@AL<#WX^LZ* /E/P5 M\/\ XK>*['XF:KXB\#>&_AWI^I^'[C2M!\':5]CN+WSGB8&6>]C55^8X 0-M M&U\=6G@>U>/Q'\.+S5X+>.[E9,1R>:6,$A MC.3AF(.<$?@5\1I/VH_A3X]A^#?AOX8^!]$AO[*?1=!O;-KB MU\V @7%QY01&W,54+%YA4*23S5_P[\'_ (K^%6_:3\%?\()'?^'O',NK:QHW MB:#6;95DFN( D=JUNS!U8G^,X4$<\2=IXYKLO!_PQ^)_Q@_:$TKXK M_$CPQ9^ -.\+Z3=:=H/AF+5(]1NI9[@;99YY8OW8&W@*I/;/O]644 ?,W[+W MP=\7_#K]CNZ\#^(=(_L_Q0\.KHMA]IAER9Y)FB_>([)\P=?XN,\XKBO"/PQ^ M-OPR_9H^#V@Z9X1T3Q4-%LI+/Q9\/=9GM!]N5F8H8KIM\09"*=.^-'C#XB)\,M+^">B7_AJ71X_!^E:I#='4;IB6%Q*(,01@?= M 7USZUW/P2^#'C+PC^P.?AQJVC_9/&?_ C^IV/]F?:H7_?2F?RU\U7,?.]> M=V!GDCFOJ&B@#XO\)?L]?$#3+[]D62YT#RD\!Z?=0>(C]LMS]A=[18U'$G[S M+ C]WN_*N'_9S\<_&+P=XX^/H\#?#FR^(VA3^/=15(SKL.FSV-U\N6?S1AXF M4I]P[@5/'(K]"*XCX:?!_P /?">Y\53Z"ERC^)=7FUN_^T3>8#)KCQ'XQ\,W>Q;+5(KCA[.&:52$* M+AB "<]L9I?!3]G?Q-/^U'HOQ0'P?T?X"Z)I6FW=K?:7IFJV]U+KB@#SW]H;P'J'Q0^!GCOPEI)B&J:SH]S9VOG-M0RO&0H8 M]@3@9KYA?X,_&/Q3\+/@]XEA\%V7A'XI?">X6WM-#U+6(+FVUNS%M'#+B>$D M0F0+\H;[I!R>0:^X** /D>]\"?%[]I?XM?#K5O'_ ($L_A;X+\$:C_;?V!]; MAU2\U.]5<1 & ;(XU)).XY/IZ?1_Q3\ VGQ4^&_B;P??R-#::YIT]A)*@R8Q M(A7)O#'[4+_LSZE\#[;X9Z-?W,&COHD7C:+Q';I;7EHB M;5V6S8D69T 3Y\(".3BOK>B@#\_P#XJ_!SXP?%+PCK?A#QS^S]X.^(/BR; MSK6Q^*$>JV5BJ(Q/E3M$%%PC1J1E%R#M_/OM=_9U^)?PIU;X/^/_ 2+7XA> M+?!OAS_A&-XNF.3%_$'A&]U".U:[@\M"?)N.8Q(D@/).TX&">_ MV+10!\H>%?A?\5?C'\?].^*OC_0;+X9VWAC1[O3O#FA1ZA%JET+FX7:]U.\? M[K &,(">G/OY'\6/@?\ &#XS>"+_ ,(>-/V??!OB'QU,&M8OBQ!J]G:1K\WR M77E(@N057'[L#!(_"OT+HH ^+O&?[-?CWX9_$_PM\1?"OAK2/C#*GA:S\,^( M]!UFYBMI[I[=%"7D$TX*!R5^8,0?KG(](^ 'AKXFR^-_$?BSQ?X)\-?#?0WM M%M='\(Z6MI-O!Z^ M!=?>65)-&74HM0$:*Q"/YT7RG$_@AX+NO%GC75?[%\/VTD<4MY]FEGVL[!4 M&R)&8Y) X%>(_P##R[]G'_HH,_\ X3NJ_P#R+63_ ,%1)OL_[(NM2['EV:KI MK;(QEFQ=(< >M:%G^V[>QVD"_P##.OQP;:BC#/&.D?$' MPII7B30+HWVBZI;K=6ER87B,D;#(;8ZJR_1@#6SFOEC]J;XX?$;PKJWP-LOA MVL.CZCXYU-[*XL/$5H#Y(>W#*)U&64Q%BS*C DH5SBN,G\%OVB+7X*2 M>/O#?B&?Q%HIUNV\7W/AU;>32(HY&295M8Y=LQ) "[W_ (LD\$$ ^VLT9KXC MA_:&^*W@?PA^TGX6\3>(-/U[Q?\ #?2XM1TKQ1::8EM]H2:!I$\RWRT892HX M&1SWZU'J7Q#_ &E/!OP"T_XYZIXJ\.ZC9V^G6^KZAX!71%C5K%E4NPO ^_S] MAWD!0@)( P " ?6S?%+PPGQ,3X?'4\>+WTTZNNG?9Y>;02>69/,V^7][C;NW M>V*ZK-?%\'Q TN__ &[-,\;(S+HTOP@;6 Q'S" W(E_/;1X \6?M*?'WX9O\ M6_#/C+PUX/TV^66\T'P3%$J,.N",9&:[7Q_ M^T=K&A?M#>+;&TO-GP^^''A"36_$T44$;/=7D@+6]N)&!*$(I;Y2,YYH ^GL MT9K\V8/VU?&VI_#]_B4OQ_\ A=INK&!M1A^%!U6S^$^D^$_$OA[X;3>.=%_M^^\3^*]LL&D6WW?+CC9E669I Z@ M,0,+G'.0 ?;^:,U\:?L\_M8W]_\ 'ZV^%6L?$SPM\8K+5].EO]+\4^'(([6: M&6+F2VN8(W=!EV_M5?'.?]GOX.W_BC3]-CU?7)KF#3-*L9F*QS M7<[A(PY'.T$ECCD@8R,YH ]>S7D_QI_:C^'GP"U/1]+\6ZK=1ZOJRM)9Z;IU MA/>W$D:G#2;(D8A0>YQWQG!KPOXD>-?VA?V7O"%A\2_&GC7P]\0/#<-S;IXC M\-VF@K8-80RNJ%[2X5RTA1F _>#D?IS'C#PGXXU[_@H]X:N=*^)7V".\\'RZ ME8R?V%;R_9K#[2NZSPQ^;?R?-/S#.* /N^UN4N[:*>/=Y$_@AX+NO%GC75?[%\/VTD<4MY]FEGVL[!4&R)&8Y) X%1^ ].\= M67B#Q=+XMU?2M2T>XOM^@0:?;M'+:VN#\DY/WWSCD5\__P#!42;[/^R+K4NQ MY=FJZ:VR,99L72' 'K0!K?\ #R[]G'_HH,__ (3NJ_\ R+7K6G_M!^ -4N? M=O;:\7F\8YYC'EX4YQ)M/IS7C]G^V[>QVD"_\,Z_'!MJ M*-R^%H<'CM_I-97QQU0ZW^UK^REJ+6=UIQNUU>X-G?1B.>#=9*VR103M=.(=(C2XLM0LBZ MQM3DD"@#[RS1FOG[XC_%[Q%J'[3'PO^&W@K48X+.XL[CQ' MXEG6&.8G3D 2&,%@=GF2'&X8.!P:\I^('Q"^-MA9>)?$7B7XS^ O@?/:37#: M3X+U*ULKUY[=,^4;BY>XR'E '$:\9'&>* /L#Q+XPT3P;:VUSKNJVFDP75S' M9P/=RB/SIY&VQQ)G[SL>BCFLR3XI>%X?B9#\/GU/'B^;33JZ:=]GEYM0_EF3 MS-NS[W&W=N]L5\ ?'SXA>,?VC_V+-/M[BQM=.CN(EO_ M #Y(TNT9SNVH8V(B)(._D\5]$3?%WQ5X!_:ET[P3XA\0QZSX?T[X,@]22>>V.?3/VP M_'.I_#;]F#XD^(]&E>#5++1Y?LTT?WHG?$8<>Z[\_A0!@^/_ -O#X+?#KQ1> M^';[Q1-J>L6#%;ZWT/3+G4!9XZ^:\,;*I'.1G(QR*]0^%GQ@\&?&SPO'XB\# M^(;/Q%I#ML,]J2&C?NDB, T;=/E8 \]*XO\ 9 ^&.A?"S]G?P/I^B6<,+7FE M6VH7UTBCS+NYFB62261NK,2QY/8 =!7BITNW^#/_ 4=ALO"\2:=I?Q \(7. MH:MI]NH6$WEL[%+C8. Q"X)[EF]30!]G9HS7P)\(_B-^TS\:?V>+_P")ME\1 M/#WA_P#L@7[6NFR^'8[E]8%O))N,\FY1"#MV*(TS\N2([*PATF\L[F%2PMFMUD82+)C =0<'KBN*L M?$W[4.L?!!C=Q0!]5:Q\ M4O#&@?$#0/!%_J?D>*->@GN=.L/L\K>?'",RMO"E%V@]&8$]LUU6:^'D^*5C M\8_VJ?V6?'=E"UI9ZUX3UF^\B0Y,),*[T)[[6##/?%;'P[\=_'O]JK2]=\=^ M!?&^@_#CPA#J%S9>'])NM!749=36!RAENI6<&(.RD8C&0.QQR ?9.:,U\2)^ MV_XR\6_!SPG8Z%HFF:=\8_$'BJ;P5);W.^2PL;N _P"D7.,[FC";6"D]6P2< ME^(/CEX8^)NJ17&H^ +Z34H;WR(X/-T:2(RP/ MM0 $J%92<)_'OQS_9^^ M)?PNF\;^-M!\<>&O&VMQZ%?:39:$+ Z7-*I*-;RB1FE4$$9DY('3G(T!\1/B M_P#M$_%[XA^'_AMXNTGX;^$? UZND2ZKI7^S=(H1W5(XER!D?-^? M!]8YHS7G/P&U+XDW_@AX?BKI%AIOBJRNY;4W.ERJUMJ,*G]W=(H9C'O'5&P0 M1T&<#T>@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T9I: M* $S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3-&: M6B@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* $S1 MFEHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B@!, MT9I:* $S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* $S1FEHH M3-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* M $S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T4M% !1110 4444 %%% M% !1110 4444 %%%% !1110 4444 ?._[>OPN\6?&']G+5/#G@K1_P"WO$#Z MA8W,5C]JAM_,6*=7?YY65!P#U-8UO\??VC(+>*+_ (92NFV*%S_PL#2><"OJ M&B@#Y>^)O@CXB_%_QC^SCXNN?!#>'KG0->N-1\0Z6^JVUR=+C:%D7]XK 39X M/[L,>>G%;^O_ L\47O[$];65M(UFTDLKI8)-CF-QAMK= MC[U<\)^&;+P7X7TC0--#KI^EVD5E;B5MS".- BY/:6C#F:7/J[ZR?DC344=KKS5)Y51(, ]=M9G[(GP(_C MS?ZC]_'/]GW0_V@M-TW3/$6M> M)+#2+:1FN=.T/57L[?4HVVYANE4?O8_E''!&3@\UZ-I>F6FBZ;::?86\=I8V MD20001#"1QJ JJ!V H ^%_#'P^^/7@#X96OPVL_@5X(UO7=/@&F6/Q'EU" MR^Q&)?ECN9;1XS.SJN,K@@D9]CV'Q<_9K\=:3XO^&7Q*\,:/X>^(OB7PWHQT M+7O#=]%#I]MJL#?.9+;*^5"ZR%B 0!@CW!^PJ* /FKX)^&_BAKGQ:?Q/XE^' M?AGX1^#K*Q:WMO#]I]BO]2O+ECS,]S F(T"Y&Q6Y[UV/[67P-O?V@?@U?>&] M(U"'2_$%M=6^JZ3=W )B2[@R44 ?%OQ/\-_M"?M3> M"K'X9>*OAMI?PXT.[N;=O$7B8^(8+];F&*179;2"(;U+LHQYF,#@^M>F7GPB M\1Q?MJ^%?&UII6?!>F^")M%?4/M$7R7!N R1^66\P_*,[@NWWKZ&HH XSP+X ME\7Z[K_BVU\2>#%\,:7IU]Y&C:@-3BN_[6M\']^8TY@Y ^1^>:\J_;U^%WBS MXP_LY:IX<\%:/_;WB!]0L;F*Q^U0V_F+%.KO\\K*@X!ZFOHBB@#Y>M_C[^T9 M!;Q1?\,I73;%"Y_X6!I/.!2>*O _Q%^*/QK_ &=O'VH>!V\-IH)U63Q!8/JM MM='3#-!Y<2[U8>=N(',8;&><5]144 ?#?ASX*?$K]F[Q'XTTGP]\&/#WQG\( M:UJUQK.D7TVIV=C>:WRCY?"$_O%7:?7M7U510!\5?#G1OVDOV?_ (7'X2:%\-]'\:6VFI-9:#XV M/B&"TMH[=V8QMY32OV0?%/PWLOV8=$TF)?$,7@O7[O5/ M$FJ1S1Q)&T\;,\BK(RLZ^8Y4!06P 2!7VM10!\_?%CX6>*/$O[6GP4\9Z;IG MVGPUX=M=6CU2]^T1)]G::%5B&QF#MN((^53COBO8/B%X'TSXF>!M>\*:S&9= M*UFREL;E5Z['4J2/<9R/<"NAHH ^-OASXC_:#_9D\,6GP\U'X42_%[1]'3[) MH?BC0-8M[5YK5>(H[F&8@HZKA2PR..^,GJ/@=\$_'^O?%SQ'\:_BU:V&D^++ M_3/[%T/PQIUR+F/1K+.YE>8?*\KMU*\S:!>:2?#D.K6^J7.I74Z;1<2O$-BI%U50=[[ MC\H(&>2*S/AEX4^//[)^CZY\/_"'PVT[XF^%#J%S>^'M;'BFLHYW+^5=1 M2CK7US_ *^PA9\$DQ@!3CJI. #D4_C)XS^+'CO]HS]FM/&W@"T^'6EQ^*VD M@TO^VX=3O+J9(29)BT(V)$B\ 9W$MD@5]C_&7X*>%OCOX23P_P"*K:X>WAN4 MO;2[L;AK>ZLKA,[)H95.4<9//OR#7&_#3]DCPG\//','C.]UWQ7X]\56D#6U MCJOC/67U&6PB;AU@!"JFX<$XSUYY.0#YS_;]^%>K:[\/[OX;_%3X9?#?3?"L. M)B"R*^-P4E5) .#@>E $VH1-/87,:#<[Q,JCU)!KX#T?]EGXH6O[$O@GP#+X M8V^+=.\<0:Q=:?\ VA:GR[1;YY3)YGF[#\A!VABW;&>*_02B@#Y^_:P^%GBC MXEZQ\&Y_#>F?VE%X?\;6>KZFWVB*+[/:QJX>3YV7=C(^5:WK_VF?P_;:O#9VVAV,K?ZN*>10)!"H&1U8L<' M R?H>BB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHH MH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ M HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** " MBBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH ** M** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH 3-&:6B@!,T9I:* M $S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* (;J[@L;6:YN9D MM[>%#))-*P5$4#)9B> .\GT M^)\XP;A(BA'^TI(]ZQ/^"E.M7\/P'T;PU9W4EC;>+O$^FZ!?W$3%2MK+(3(N M>P;: ?8D=Z^D]#\!^'_#G@RV\)Z?I%G;^'+>T^Q)IJPKY/D[=I0KC!!&^(/C;1?B9X'US5K?1M62VT)=+N=)EG.V.6%D=A+&&X.\9QCIG( /L M'-&:^-]*\>?'3XQ?M$?&3P'X5\<:3X,\-^$[VT$&K7.AQZA.?#LVD?&CP1\<_!E^DG]M1V% ME!I>H:/\N4=(DE9G4M@%9%#8KT#]FKXK^)?B+\1?CEI6O7R7=CX7\5MI>E1K M D9AM_*5MI*@%N2>6R: /4OB5\4?#'P@\+OXB\7:G_9&C)/%;&Y,$LV))7"1 MKMC5FY8@9Q@=\5I2^,=#A\46WAM]6M%U^YM7O8M,\T?:&@4A6EV==@) W=,\ M5^>/QJ^+'B;XM_L<_$J[\3WR7T^D_$]-(M&2!(O+MH;Z$1H0@&2 3R>3W-=_ MXA\(^-;O_@III+V7C\V$3>#OMJ1?V-!)LL5NU#V62>=[ MYWWANP.E 'W-FC M-?''Q!\;?&A=0\4:KX@^,G@7X!V-G=3)HGA[5K:QOI;VV3_5SW$\EQ\GF?W4 M&0.V>#R.L?MG?$KQ!^R5\(_B#X0"(-979\V:(XW!F1'*( MQ*G< 3@T ?>N:R-,\8:)K6NZMHMAJMI>ZMI/E_VA9P2AY+4R F,2 ?=+ $@' MG'/>OER^\>?&OX#_ !P^%VC^.O&VB>/_ SX]OI=*E@M-"739-+N1'O0PLLC M&1,\?/S@=C7+_LD>$?&EE^V-^T#/?^/CJ5G8ZE9+J=K_ &-!%_:;/:L86WJ< MP^4,#"_?QS0!]C^-O&VB?#CPGJOB;Q)J$>E:%I<#7-W>3 E8D'4X ))Z D MD@ 5S/P6^.WA3X_>&[C7O"$FH3:;!/\ 9S+?Z=-9EVVA@4$JJ64A@-+>Y;1?$MGI2Z;<,ODD95!M4Y"$G)- 'V1FC-<;\*-.\=:9X:GA^(6KZ5K6N&]F>*XT> MW:&%;8D>4A5N=P&*?%O]LWX._ OQ>/"WC?Q"?%GCII_ 5M;_ &'PAIZWES'FYSYCHSIA M.,9SU(K%^('Q.N_V_P#XA^$?!G@SX=ZUX0OO!'B.UU?7=;\7K;V5_I,49R8H M[=9'E)DX]!D#/J #]$,T9KXH^.'[7&H7'[0&N_#'1OBIX3^"^E>&K:"34?$? MB*WBN[J]N95WK!;02NB;54C'O$OQ&\ M&6":AHOC#PU;QR66KPLI=0T#;T23*&-E!(!88Z9(!]PYKB%^-?@M_$7C+0AK M.=5\'VD=]KEO]EF_T.%XS(K;MFU\HI.$+'CIFOG_ .(/[5NMZ]^RU\-/$?@* MXAM_'WQ$N[#2-,W0I*+:Z=@+IC&P((C"2@Y&!Q3+GXF^)]>\?_M/^"-6U&.^ MT;PUX3MFL@+6*-P\MA*TK,RJ"VYAG!) [8H VX_^"F7[-TJ!T^(DC(1D./#V MJ;&O\ A(/ OB.S\2:2)#$\]J6!C<#.UT8!D;!!PP!P M:^%OV9_VY;#X%?LB^!H]<^$7Q/N](TG31')XBLM$B;2Y,R-AUG:=?DR<;B!S M7L_[#_P_U]_%WQ1^+NHZ%:^#M$^(=U:WFD>'K6ZBN-L"(W^DR-$3&'EW;L*> MYS0!['\:/VGOAK^SU/IQUXKS* M/_@IG^S;*6"?$25RIVMM\/:H<'T/^C5]05\C?L#_ /(T?M&?]E&O_P"2T ?0 MGACXR^#_ !EXQO?"NCZO]KU^RTZVU:XLS:S1E+6X&89-S(%.X?P@[AW KM,U M\(ZII7Q'\0_\%#_BAI7P]\0Z9X0>?PMI3ZAKM_IW]H26\:YVK# 75&=F/5S@ M!3P3BNB\*?M;>+OA5X+^/=M\49K#Q5KGPLD@\G5--MOL2ZLEPFZW#Q@E8VW% M0=O ![XR0#[,S1FOS[$QE:9%/&Y2"0>O?UKQO\:OBG\2_VE?"/@7X8^++#PKX:\1^"(O$K:C? MZ3'?26@:4D.B$KN=@43:S;0"QQG% 'V3FC-?+?Q&U/XW6'B"ST2[^)?A7X8> M$]-TJ$W'CW5K&TFFUN_(_>B*UDG58(UZG=SSP2.GF_@3]K?QQJGP2_:*67Q; MX?\ %WB+X<0,^E>,_#]O']EU!'A9XY#$"\>Y2I!"Y7MSC) /NS-&:^']2^(? M[2G@WX!:?\<]4\5>'=1L[?3K?5]0\ KHBQJUBRJ787@??Y^P[R H0$D 8 !G M^-?[:LFH?$CPSX&\*_$#PS\*=.OO#]OXCU#Q?XHB2X:..< PVUO [JCR%3N8 ML< ?3D ^V(M#\:>&H4CCN%1 M$"LZ)*C[3@'!4\BN[TKXX^,;K_@GF/BG)J4;>-O^$1DU7[?]FC"_:0A( M?RMNS&1TQCVH ^BM7\8:)H&K:1I>I:K:66I:O*T&GV*/#.CZG]LUSPQ+%!JUKY$J?9GE3?&-S*%?*\_(6QWQ7 MPO\ %RW^(/Q)^,O[(^NP?$$:+J6OZ7+/!*NBV\XLKDV*27$P4X$GFAMNP@!, M9%>H']JG7/AQK?[4.I^(Y8]9TGX>FP_LJSCMXX&=Y;?[C.J[FW2E>6)P"<4 M?86:,U\DZ1%^U?:^&_#GCT>(_#'BVXOWM[F_^'4&D1V,<%K*066&^>;<9(U; M/S\$@]> >3^)'[2OC#5_VC?&/P^/Q>\-? 6WT%+8:3%XAT:.Z?7#)'O:0S3R M)&B!CM 0[C[T ?<6:,UP/P*UGQMKWPRTF[^(-OI$/BA@ZSRZ%<":SN4#$1S1 MD$X#KAMN3@DUW] '(Z!\6/"GBCQ]XD\%:9JOVGQ/X<2"35+'[/*GV=9EW1'> MRA&R.?E8X[XKK"M8N_#O[7/[76JV$@BOK'P[IUS!(5#!9$LG93@\'! MX->&[-+'2?[4/A5_#R2+J4$6?,DFN0ZF-W"LP6- M H&!GJ: /T S1FOE7XC_ +27C/Q7)\&O!WPTCTW1O%WQ(TPZS+JFJPFYATBR M2%9)'6($>8^6VJ"<<<]"YK$7-GXOL[*' M3+F"Y#8-M+:K(VX$XYHS2T4 ?-&L_\%(?V=O#^H7EEJ'Q DMKF MTF:WF5M U,A'5BI&X6V#R",@XKL?A#^V'\(_CQXHD\.^!O%4FM:Q';M=-;MI M-[:@1*0"V^:%%ZL.,YYZ5YI_P4]_Y-,U;_L+Z9_Z51U?_:Z_:>O/@?;_ _\ M*:)J^A>&M>\7RO&/$7B9O] TFVB13+.ZY&]_F 120">M 'U#FC-?#OPJ_:]O M_#WQV\)^ ]8^,/A#XVZ%XK6:*#6- M(K*\TNZC3>$FBBD=&B< @-P<_3G9^' M?COX]_M5:7KOCOP+XWT'X<>$(=0N;+P_I-UH*ZC+J:P.4,MU*S@Q!V4C$8R! MV..0#[)S1FO@WQ;^VK\1M8_9\\&>(O#MAI^C_$,>/8O!NMZ7(HDLY;A2Z.BL MP++&YV-D'< 2 >]=Q>^//C7\!OCA\+M'\=>-M$^('AGQ[?RZ5+!::$NFR:7< MB/>AA99&,B9X^?G [&@#Z=\=^.M$^&GA'5/$_B.\.GZ'ID)GN[I8))C&F0,[ M(U9VZCA037SXW_!3/]FU9%C;XB2AV^ZI\/:ID_0?9J^H:^1OCM_RD$_9R_[! MNM_^B10!ZAX3_;)^#_CC3M'OM&\6M=6NKZRGA^R=]*O83-?,F]8Z^ S^&8K2;Q"/'MJ+!+_=]G\XQN$,FWG:"-=(^(?ASQZ+N!)+70UTR;3+J&+S,)L=O,C.<9'?"NHR:3:KK=E#?7^KSQ\2RLD MLB".'=\JE>3@_AEZW^WAXZUW]FBZU[PU>Z#/X^T'QQ9^%[N^TM5N-+U6.1CL MEBW;BJ2KCH#I<.T.F7%TYS%=MDY2+9N=AG^ X(SP ?<&:,U^>4 MW[:&N_"+4_#.LZG\?OA_\9=*U'4(+'6?#FBV,-G=Z>DK!3-:/'*S2K&2,B1< MD<\9X^D/A%\6?$OBW]J3XV>#=1ODN/#OAJ+27TNW6!%,)G@9YY:OK%AX?TN[U+4[R#3M.M(FFN+NZD$<4,:C+,S-@* .I-BS^ M*$T^Q\'ZE+:6:)IT,A>P%L6DMB< _.3_ *PY88XK8\&>-OB!\*/"G[)V@S^+ MXM>M/%U[%!=-)I%O"T=C]@1XK92 3E"/]8"&;O0!]QYHS7R/I'Q!^,_[3'C[ MXA1_#GQGHWPU\&>#]5DT*WN;G0UU2ZU6\B \TOO=5CB!( VC=SWKF?C%^TM\ M8OA?X'^&>E>.GT+X3:YX@U2[T[6O&TEJ-3T^SCA7,,T<2N54S@Y"R-\NUL@= M@#[>S1FOG[]F;Q9\0]=UK7(->\=>$_BQX(6WBFTKQEX=$$$SS$_O+>>"&1T& M!R&!'OUP/H*@#D_''Q5\+?#?4/#-CXCU3^SKKQ+J4>D:5']GEE^TW;_=CRBL M%S_>;"^]=7FOD[]N3_DH7[,O_92;#^1JKXG^(GQH\=?M>>-_A3X)\6:5X4\/ M:;HEAJ;:K?:0E]-9%P0RQ1DH)&D8CF1B%"' R: /KO-&:^-/"/[6?C'X8>"? MCY;?$V2P\4Z_\*Y(1#J>FVWV-=62XCW6X>($B-BQ4';P >^,G5TB+]J^U\-^ M'/'H\1^&/%MQ?O;W-_\ #J#2([&."UE(++#?/-N,D:MGY^"0>O (!];9HS2( M2R*2I0D9*GM[4Z@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B M@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* $S1FE MHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T9 MI:* $S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3- M&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* $S12T4 %%)FC- "T4F:,T +1 M29HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T >4?M0_ J+]HKX-ZQ MX/%Z-+U-VCO-,U$C/V6\B;?$Y YQD8..<,:\=T_X[_M-Z'X=3PYJ/[/1UKQG M#$+9-?L_$5JND7+@8%PVXAT4_>,9Y[<9X^N;S<2UFF>8X=IP" !NR< 'C0\=>#?C;^U?J/@SPYX MV^'5C\+/!6CZQ;:UK%S)K\&IW&HO =R06Z0CY%+&_CS<>%8M.T+Q-KOC>;7-$75F@N;;4[(A-T;[2_E>8H9?&?Q*^._P -_&'_ H;0/@1+X:U5=4U?7].UJTGFU1% M'S6R16@ 97/!>7!P3]#V.D^$/C5^S_\ &OXJWW@WX4?[*7Q>'[(WCGP9J&@P7WC75/ MB$->2*UO;=(KFW-S#(\Z,T@"KA7(5R'P/NYXKVOXI> /B1X?_:_\'_$WPEX. M3QCH$OAT^&]3$>JP6:%7G:N2<$<<9^HLT9H _/7X:?LX?$; MX<7'BC3M5^ 7A3XC>,]1U6ZN8/BEX@UBTEC996)CDDBE1[A-@(^2-1G&,CK4 MOA#]EGXJ:3^S)\(_!=[X:4^(/#'Q'BUC4$CO[7R_L*W,LAN4/FX*D.#L^_VV MU^@N:,T > ?M)_"WQ/X_^*?P'UC0=,^WZ=X8\4-J.K3?:(H_LUN82N_:[ OR M<80,?:L#X9^!/B-\,OVO_B=JA\&QZK\/_'#Q-!JT$9TYX+8IY;VS'S'W M-QE1@9!YYQ]/9HS0!XG^VE\.?$7Q:_9E\;^$_"FG_P!J^(-2@A2UL_/CA\PK M/&Y&^1E4?*I/)'2N*^-'P7\?V/C7X6?%CX=Z?8ZUXN\(Z:^DZCX:U"[6V74; M.5%#I'.B@DY'OQU?[$7PM\4?"#X,WNA>+=+_L MG59/$&IWRV_VB*;,,LY>-MT;,O*D'&\\; M>#5\#:NEY-#'IJZG%J'F0*1YL/]J;X$^,1\2_!OQJ^ M#^FI??$/0YELM4TD7,5JNMZ8QP\3O(RIN3D@L>_'*J*^ILT9H ^-_&GP6\>_ M#WX_^(OBAX3^&.D?%'0_&ME:G5O"^J7UI:W^F7D4>T212S;HF4CA@&Y/0X ) M]2_9J\)_$2TO_%7B+Q]X=\-^"8-4EC32?"FA0V\DFGP*/F^T742+YSL>< E1 MVZX'NV:,T ?$WP0_9)\9>"_VJ;Z]UFUC7X2^%+K4=6\'8N(WS=:@4,J^6&+( M(AY@&Y0/FR,UV,/P3\:)\9OVF-=.C8TKQCX?M+'0[C[5#_I-/AS$[:EX4UQKV%FLA(3X4UCP[I MMC8ZA]HB;SIHB?,3RPQ=<9ZLH![$UYOK?[)GB+XF>*?VI--URW&BZ'X_331H M>K&:*4/)!!]\QHQ=0LBJ"&"DC.,U]CYHS0!\-VOA/]H"X\%:9X'M_@5X$T'Q M)"L5E/\ $6:\L+JP\M" UPEEY9F+LH^ZPQD_@/5].^#OBK3OVT-%\:FP2;PG M9^ ?["DU6-X(E:\%R'V"!6#*"HSPNT=,]J^C1=Y0JS?-N12?Q)%<->?!GXA?##X4 M?MMB5M(UFTDLKI8)-CF-QAMK=C[T ?%.E6/[0_QL_9=\-?" MIO FC:3I.MZ'96=U\03KL%(/R[LD'!XZ[XA_LS>*/A; M\7] ^(7PY\%Z/\3=*C\-VWAC5?">KW,-M.T=N (+F":8&,. _7CZT\)^ M&K+P7X7TC0--#KI^EVD5E;B5MS".- BY//+[Q MIX1\-_"WP[K&CR:/I7AG2H[6[O83(A62XGNX4 .<\1JQ'KR,GQI?AO\ M)P? MLG:A\ 8?AEI"&TTF?28O&'_"1V[07MN-Q58K;B197&$!D**,[B1TK] LT9H M^,_B-\'?BCH&E_LS^*/"O@N+Q;KOP\LS;:MX<.KV]E(3)91PMLFD/EG:RMG! M.>,9!R'/^RKXG^)>I_M0Z=XDL#X;TOXB?V ;L1OHAO+RPL+S2?DQ M)%+]H3Y\M\PD0[A^@^MLT9H ^./A9HOC7]AG]D35]0N_#-GKVI)KDNJ?\(Q: M:QY=OI%G<2HOV>.>16\SRASA02S.0,]3]D51U?0]-U^WB@U2PM=1@BF2X2*[ MA654E1@R. P(#*P!!Z@C(J[F@#Y1TSX'^-K?X\?M+^(I-%VZ-XPT"ULM#N?M M]?4F:,T ?'FO_ 'XC^&-'^ GQ \'Z19:EX]^'^@IH^J M>%K^^2!;ZWDMT2:*.X&Y%D1E)#$E3Z\<][\.I_CIXS^)E]XR\7Z GP_\+:=I M,EIIW@6/6(+Z;4KPG=Y\\\8\M ,;5 /&?#S]G)/B%K M7PRCM?%4#H=1\)G7X&%I&;@Q[Q=*I20[-CA5!)+;1R*]SJCJ^AZ;K]O%!JEA M:ZC!%,EPD5W"LJI*C!DN00Q_'CF/AEX4^//[)^CZY\/ M_"'PVT[XF^%#J%S>^'M;'BFLHYW+^5=12C?B5;>-/$\UG/'#!#ND9IC&964LJ#:,#YCS@5[9^ MTG\+?$_C_P"*?P'UC0=,^WZ=X8\4-J.K3?:(H_LUN82N_:[ OR<80,?:O?\ M-&: %KYT^+/PF\5^)OVP_@KXXTW2OM/A?P[8ZI#JE_\ :(D^SO-%MB'ELX=L MG^ZIQWQ7T5FC- 'S_P#M4?"SQ1\2/%'P4N_#FF?VC;^'?&=MJVJ/]HBB^SVJ M(P:3#LI;!(^5_B1X_E\-?"#0/C1X-\5:K+KED9] M1M+&^TNXE_UL4AN5(>,D9&PY'ISBH_'W[/OQA\:?L_Z38ZMHF@2>+KCQSI^N MRZ'X#5\- M:5!XMT_1-=BU'6/!MU?BRCURV4']T93A00><.<'/L ?'+OX!_$77_BW\&O$V MA? ;PS\*O"?A7Q MQ?:3I-_8-?R(Z%6N93"$B*( $5W'?AIXA\9ZUHJ7"WWBW4O[5U(SS;U,^P)\@Q\HP.E=MF@#XWM M/#_QN\?ZOX9TD? [P9\);:WNXIM<\3S7&G:J)X4^_':6Z1EE+]FDQM]>]:NO M^"OBW\%_VGO'7Q \"^ +3XE>'?&]C8Q3VRZY!IEQIUQ;(4!8S##QL#GY.:^W,T9H ^0M!\%_&3]E_Q[\0X_ ?P\L_BCX,\7:Q+X@LP MFO0:9;'*)AAXR0""F2 .G-2WG@G]H[P]\//#EYJ2Z!\6K^ZO[NZ\4 M^!]1>"*"6WFYAM[6XF3:!!C^/AL]2*^N,T9H ^./V9?V=O$?AW]HO6_B=)\- M=+^"'AVXT7^R_P#A$=*U.&[-_<&0/]IE6W_]_ #XL:M\8/"6J MZGK?AE?"FI:=K5YH\M@E^MZN;=]A<2JH4Y.>!D @C)KTS@U2T;1--\.:='8: M386NF6,98I:V<*Q1*6)9B%4 #)))]R: /!_VJ_A5XI^)/C'X%WWAS2_[1M?# M7C>TUC59/M$47V:T0'=)AV4OC^ZF6]JF\#?"WQ/H_P"VC\3/'=YIGD^%-8\. MZ;8V.H?:(F\Z:(GS$\L,77&>K* >Q->_YHS0!\=:K^RAXC^(_BG]J;3=#CCK7;TF:,T +129HS0 MM%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T M +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC M- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129 MHS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4 MF:,T +129HS0 M%)FB@!:*2B@!:*2B@!:*2B@!:*2B@!:*2B@!:*2B@!:*2B M@!:*2B@#,\4>*-(\%>'K_7=>U&VTC1["(SW5[=R!(H4'4L37S]I?_!13X#ZI MJMK:?\)9=V-K=RB&VU;4-&O+:PF6UGK,DMO>6JWN?L]P\,JR"&7'\#[<'@]J^?O'_P"T_J-K\.=1\$?M&_L\ M^)_"WA2ZM/L&H:UX=$>JZ5"F !+OC_U*C *X+,N!C)% 'VGKGC30?#,>F/JN ML65@NJ7,=G8>?.J_:IY/N1Q<_.QZ@#/&3TK:K\^OVK?"TU_I7[*X^&WQ!:V\ M(-K^G6.ASM91WY1_+;R;TR28,A5 %\ML ]^:]/N?B'\7_B]\:?$/PN\ ^,=, M\)V'@2RLX_$'C&\T5+VZU"_ECW;(;8NL<:X!)YX/ H ^MJ*^-=/_ &P/%OP< MTCXS^'OBK;Z=KOB[X(O#'BVXOWM[F_^'4&DQV,<%K*066&^>7<9(U;/S\$@]> 0#Z- MT+XI>&/$OCOQ'X-TW5/M/B3PZD$FJ6/D2K]G692T1WLH1MP!/RL<=\4?$#XH M^&/A;!HTWB?4_P"S(]8U*'2+%O(EE\ZZE)$,O MS@=C2>'OB%\:/VH/&OCV;X=^,]'^&?@?PIJTVA6EQ<:&NJ76K74./-=_,=5C MB!( V\\T ?27Q*^*'ACX0>%W\1>+M3_LC1DGBMC=IZ$'UP/>O&WQ-^)WQ5_:&UCX4?#'Q%IG@73_"NEVU_KOB2]TL:E M.\TXS#;PPNRH!M&68G/ITY />M"^*7ACQ+X[\1^#=-U3[3XD\.I!)JECY$J_ M9UF4M$=[*$;< 3\K''?%=77Y[_!_XB>)?@A\:?VK?%_Q-^PZIK7AS1M*N+B; M2(S!#J"QPR"%U1BWEF0;,KDA6)QP*P)OVU?&^G_#Y?B4_P ?_A=?:L(!J,GP MJBM8@/)/S&V2\\[SC.5QOXH _2>BOBWQS^T#\3/B=\;?A'X7^%GB*R\+: M'XZ\'/KTUWJ.F1WK6(#!_,5#M+N%_=A2P7+9(XKZW\%:;K>C^%=,LO$>LQ^( MMJ16BVBW,G=Q$I(3Z F@#/^'OQ1\,?%2SU6Z\+:G_:EOI6HS:3>/Y$ ML7E74) DCQ(JDX)'S#*GL375U\!:[^U;\2M$_99^*7C:RU&VE\1Z%\1)=#L& M^Q0*IM%NXHQ$R[-I)5B-Y!;G.\6>'/%.O MVFB:IX:LM"%F-,-SG:UO<>8SR[",9DQG'3G@ ^RZQ/&OC/1OAWX2U;Q-XAO/ M[/T/2K=[J\NO*>3RHE&6;:@+''H 361::?XX3XKWU[<:MI;_ ];2UCM=,2! MA?)?;P6D:3&#&4R-O7)%<+^VQ_R:5\6/^Q>NO_0* .,7_@I?^S>ZAE^(4S*1 MD$>'=4(/_DK7H]E^U1\+]0^&^D^/8?$Q/A/5=232+._?3KM#+=.YC6/RVB$B MY8$;F4+[XKY^^!'[8]YX=^"G@/2E^ 7QDU5;+0[.W%]IWAN*2VN-L*CS(G-P M-R-C(.!D$5<_;8\8/X^_9O\ AOK\F@ZQX9>^\<:*YTG7[86][;XN67;+&&8* M>,]3P10!]FT5\3_'#]KC4+C]H#7?AEHWQ4\)_!?2?#5M!)J/B/Q%;Q7=U>W, MJ[U@MH)71-JJ1N8Y.2,5A^%OVLOB%\0OAI\9O#7ACQ?X=\4?$+P%:0ZMIGBO MPW;QRV6MV?WV5H6WJDNU71@IX)&,8R0#[THKY4^*W[3FL^(/@W\'[KX:WL5I MXN^)U_8VUA,T*3_9(B!)>2%'!4^6JLIR.":E^*_B/XOR^/==@G^)_A/X#^!= M.2)-*U76;>RO[O6VVYEE999T6&-6XQ@-_0 ^EO$'B'3/"FBWNL:UJ%MI6E64 M1FN;V\E6*&%!U9F8@ ?6N=U_XP>$/"^H^#K'4M96"Y\7S_9M#58)9!>2>7YF M R*0HV\YO@GX@?&KQI^T1^P)\9I-0\5Z1+?^$=4GTN^UC0;-);3Q!:1[ M"K)EB(M^]6WH?X!@8)KU_P#X3?X@_"6V_9;\-W7B^+Q$OBC5!:ZC=2:3;P,U MI]D5XH5 !VE.!O4AFQS0!]DT5\>>"?'_ ,"-&U6 MXT?1X;G0EU.XU:2 [7EG9W7RD+<#8,XSUQD\;XS_ &U/B./V:9]^)_'OQS_ &?OB7\+ MIO&_C70?''AKQMK<>A7VDV6A"P.ES2J2C6\HD9I5!!&9.2!TYR/J3Q[KLWA? MP-XBUFW3S)].TZXNXTZ[FCB9@/S% 'F/Q9_;*^$WP8\2GPWX@\2//XD""1]' MT>QGU"ZB7&7Q@X8@X(-=/\&OVA?A[\?]+NK[P)XEM];%HP2[MMCPW- MLQ[2PR*KIT."1@X.":\9_P"";G@ZPLOV;-&\;RQI=^+/&DMQK&M:O(-UQ=2M M/( &?J54 +T!SZFL#]HO1[7X5_MJ? /QQX=A33]4\7WUSX;UU+<;!J%N8U9 M&D ^\R$YW'GA?04 ?95%?$_PU\:?M"?M >*_BUIV@?$+1?!6C>$O%-YI=C>S M^'X[^XN=N"D!4LBI&BXR^&UA MPZV#WXF:/[0R@[@@5=Q4'KZ"@#[_VJM+UWQWX%\;:#\./"$.H M7-EX?TFZT)=1EU-8'*&6ZE9P8@[*1B,9 [''(!]/^/OBCX8^%\>B/XGU/^S% MUK4H=(L#Y$LOG7*=+^'/A7P+-%87^NW6D+JEW?WSIO:-(G=42-!P3US]> #ZOHKXI_P"&U?%W MPH\!?&'2/B%IVFZQ\1_A[-:6UM-IBM!::T+PA;24H23&22-Z@_3%8?Q]\8?M M2_L_?!;_ (3Z_P#B#X;U][F6UCU'3+;P]' =&,LJ#-O*6;SU!/EGS%SALCD4 M ?>5%?.WAOXO>*]!_:_U'X=^*-0CNO#/B+P[%K?A[M)VC601RK&"I*L"#SV(Q0! M^@U%?!GBSXM?M&^ OV>M$^/6H^,O#=UI@MK&^O? R:$%1K29HUS]LW[_ #B' M#'"JH)( P,'U#XC?&/XB?$CXZZ;\)?A9JFF^#WAT"+Q%KGB;4K#[?):Q2MMA MA@@+*C.>I+'&#QC'(!]1T5X_\"3\8M)U7Q-X?^*1TS7[*QDB?1O&&FQ1VG]I MQL,NLMJKL8G0X&0 ISQG&3Z_0 M%)10 M%)10 M%)10 M%)10 M%)10 M%)1 M0 M%)10 M%)10 M%)10 M%)10 M%)10 M%)10 M%)10 M%)10 M%)10 M%)1 M0 M%)10 M%)10 M%)10 M%)10 M%)10 M%)10 M%)10 M%)10 M%)10 M%)1 M0 M%)10 M%)10 M%)10 M%)10 M%)10 M%)10 M%)10 M%)10 M%)10 M%)1 M0 M%)10 M%)10 M%)10 M%)10 M%)10 M%)10 M%)10 M%)10 M%)10 M%)1 M0 M%)10 M%)10 M%)10 M%)10 M%)10 M%)FC- "T4F:,T +129HS0 M%)FC M- "T4F:,T +129HS0 M%)FC- "T4F:,T >0?M2?"#Q#\8_AK'8^#_$+>&?%V ME:A!J^DWC2.L#SPMD13A>3&P)!X/8X.,5Y%XB\>_M4>.?!FH>#9_@-X>TC4M M3M9-/N/%%SXNMYM,C#J4>86JJ9B,$D(<^^>E?7F:,T ?&/Q/_9<\9> ?@+\" MM!^'NG1^.]9^&>N6FJ3:?->QV)U ()#+YZ1J$,6TE+A_W,J8)!P>3R. ,_7^:, MT ?%UK^R+XS^-^E_&OQ)\3Q8>%?%/Q$TV#2M/TC3[C[9'HUO;X>#S90 )',B MJS;>, XZX&@MQ^U/XH\$Z'\.?^$,T[P%>VYMK34/B1:>((+F%K>$KODMK0+Y MHDD5<8< #<<]>/L'-&: /CR\_8[;XF?'#X_7/CC0(V\,^+=(TRPT?7GD@DN1 M)%#B22,*QDC99%C;D*&*CJ*Y[5_A/\=/'7P;^%WA?Q;X9^W>)/!'CS3YI]73 M4K0IJ6EV[-B^&9=P;85#(P#D\A3DX^Y,T9H \ _:4^%OB?Q_\4/@/J^@Z9]O MT_PSXI.I:M-]HBC^S6_DE=^'8%^3C"!C[5Y]X6\%?&;]ECQKX^L_ OP]L_BG MX&\4:Q-K]AY>O0:7=:7<38\V*43C#QY (*9..W.!]@9HS0!\#^+OV0OB9?\ M[./CO[7:66M_%'QUXPLO$NI:=IMU'';6D<3P,]3ZEXW^ M'/Q-^$'[1>M?%7X;>%+3XA:7XKTRVL-=\./JD6G74,]N,17$,LO[MEVG#*2# MZ5]39HS0!\/^"/VI:>7&ZK&2 MI#,T?[LL2JJQSM)%4]'\%?'_ $3XL+/[?:CSK$WD4@EWF78OR*QVL0W&,9KWK]L#X5^*?BEX5^'5GX8TO\ MM.YTGQEI6JWJ?:(H?*M868RR9D90V,CY5RQ[ U]!YHS0!Q]IXD\6R_%6^T.? MP[+@-:_91^\7"DMYA^4XQWKG_ -J+P7K/Q%_9W^(7 MACP]9_VAKFJZ-<6EG:^:D7FRLN%7#?AUHGQ=\/>,;:W74_#]_>6UG>6-U"FQ9H9+@&,HR]5R#GZ M"O2OV;O"'Q!BO/%FO_$'PWX:\%VVK2)%I?A+1(+>5["W4$-]HNHD7SG,T9H ^*/V9?V3?&GPY_:*U2^\36Z#X=^#4OX? 9^T1R%EOIS+*VQ6 M+(8U)C^8+G/&1S6-=_L^^./"OQ^^)'B;6_@5H7QW'B'41=Z'XBUG6+.-=+M] MN$MGAN58HJ?WHD)X[]OO#-&: /@GP+^RG\4T_9O_ &C_ +KNBZ5IOB+QAJD M^H:0VG7,0T^X\Q(V"18.Z-%9-@\Q4['&*ZZX^'?Q7^)$_P"S3J>N?#H^%;OP M1KC_ -M6AUJTNQ#;):K$EP'1QN#L#\BAF7N.]?9&:,T ?''@'P=\;OV3[WQ? MX6\%?#BQ^*7@G5=7N=9T6\3Q!!IDVG-.VYX+A)A\ZJW(:/)Q]<#E->_8^^(M MI^STMB\%IXB^(GB'XAV?C+7XM/N(XK>V7SPTB1M,R;EC0#W)S@&OO+-&: /G M_P#:P^%GBCXEZQ\&Y_#>F?VE%X?\;6>KZFWVB*+[/:QJX>3YV7=C(^5[RTAO[2>UN(UEMYD:.2-NC*1@@_4&I2?% M_P"%WVN6ZT&XTK4X;74=+25RYMIHYB!(H8G#*>,\]<#H/ /PJ^)?QN^/N@_% MKXM:#:>!](\*031^&/!L-\E[<)/*-LEUZOIK?:(I?/M9%0))\C-MS@_*V&]17A_A_] MD#XAW7[.#Z8+:T\/_$/P_P#$*[\9:##?W$)F"K(C'W!QD"OO# M-&: /F72K_\ :$^+WC[PBFN^#XO@YX/T>X-WK;1Z];:G/K>%*K;1K$#LB).6 M+X;&,8(YXSX9>%/CS^R?H^N?#_PA\-M.^)OA0ZAE1QV_B;Q:/B7;^-?%$]G/'# M!!O=FF,?FLI=4&T8&6/.%KN)_ /Q9_9V^.?Q \6?#SP3:?$[PAX\GBU&ZTE= M9ATR]TZ^1-C.&G^1XW'/!R/3CGZSS1F@#X1\1_LI>(?&WPP^-?B_XL:WH/@; MQEX[GL;BT1KY6L-#%HR_8XI;AL*[%\*S#CGC).*XS]L[Q_\ 'CQ+^S*-&\8_ M#?2?!NGK?:;#J.MQ^(8;X:L_VB,(MI#&"R!V <^81A5(&3S7Z!^/? NA?$[P M=JWA;Q-I\>J:%JD!M[NTD) =#[@@@@@$$$$$ BO$O#/[#'@?1==T*_U?Q+XW M\;66@3+<:1HOBKQ!)>Z?82I_JWCA( )0<+O+8H X+_@HUHNJ:!\*/!OQ&\,3 M):>-_"FJ16VG9X>X%XGV:2!>Y)+JP'^P:[OPX;_]D3X2_!/P1I?AI->MK[4[ M'P_JU\;]+=K2:Y.9+D(5+3$RLYVKCC)) &:[7QA^S5X7\??%O1?'VOZGX@U. M;1WCGLO#\VJ.=&AN8P0ER+7&WS1G[V>PXKTN_P!#TW5+RPN[VPM;NZL)#-:3 MSPJ[V[E2I:-B,H2I(R,'!(H O5\2Z#^SI\0[+X)_M4Z!-X>V:MXVUS5+S0+? M[;;G[;%-&!&VX2;8\GM(5([@5]LYHS0!\O?&[X+^,O%_[ Z_#C2-'^U^,QX? MTRR_LS[5"G[Z(P>8OFLXCXV-SNP<<$\52\:?"GXE_"_XV:1\7?AYX:M/&\M[ MX:@\.^(?"T^IQV%P?*(:.>":3]V2I^4JQ&0..N1]79HS0!\Z^ ;CX\Q1?$/X M@^)_#\)U&YM8X_#/PNM]9@9(#&.3+>;?+$LI/)!*@"O>/#%]J6I^&M)O-8TP M:+J]Q:137FFB=9_LD[(#)#YB_*^QB5W#@XR.M:6:,T +129HS0 M%)FC- "T M4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 MM%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T M +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC M- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129 MHS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4 MF:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M M%)FC- "T4F:* "BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH M 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH M 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH M 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH M 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH M 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH M 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH M 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH M 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH **** "BBB@ HHHH **** "B MBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH *** M* "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH M **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ MHHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "B MBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH *** M* "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH M **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ MHHHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2 MBEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2 MBEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2 MBEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2 MBEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2 MBEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2 MBEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2 MBEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2 MBEHH 2BEHH 2BEHH 2BEHH 2BEHH **** "BBB@ HHHH **** "BBB@ HHHH M **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ MHHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "B MBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH *** M* "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH M **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ MHHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "B MBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH 2BE MHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BE MHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BE MHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BE MHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BE MHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BE MHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BE MHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BE MHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BE MHH 2BEHH 2BEHH 2BEHH **3-&: %HI,T9H 6BDS1F@!:*3-&: %HKRG]J?X MKZM\#OV?O&GCK0[:SN]6T6S%Q;P:@CO [&1%PX1E8C#'HPKN/ >O3^*? WAW M6KI(X[K4=.MKR5(00BO)$KL%!).,DXR3]: -ZBLG3/%VA:W:7UUIVLZ??VMA M+)!=SVMTDB6\B??21E)",O<'!'>H(O'GAF?PJ?$\?B+2I/#:H93K*7L1LP@. M"WG;MF >,YZT ;M%>%>,_C'XI\,6?QAUBVU#P5JND>&M!75=#M+&YDGOP_V= MI";Z,. (V(!0IMW+GGO7(:)^U-XJU+7/V9[*73M'6+XFZ9<7NKLD,NZW=+19 M@+?]Y\HW,0=^_COWH ^I**3->(?M'_M(Z;\*OA#X^UOPKK7AW6/&/ANQ-T-& MGNUF9&#JI\V&.19 /F]10![A17D^A?$+Q1K/CCP';F^\(P:#K/AW^TK_ $^6 MXD766N2JLK6T6[!@&XAB02..:[*Y^)W@ZR\1KX?N/%FAP:\S!5TJ7485NB3T M B+;LGZ4 =-16?KOB'2O"^FRZCK.I6>D:?%CS+N_G6"),],NQ 'YUG0_$3PI M<^%Y?$L7B;1Y?#D()DU=+^(VB $ DS!M@Y(')[T =#165J_BS1/#^CKJ^J:Q M8:;I3;-M]>7*10'>0$Q(Q"_,2,<\Y&*@\4>.?#G@BTBN_$7B#2] M96VQSZI M>1VR.?0,[ $T ;E%4+'7M-U/24U6SU"UN],>,RK>P3*\+(.K!P=N/?-9GACX MC^$_&T]Q!X=\3Z-K\UO_ *Z/3-0BN6B[?,$8X_&@#HJ*S?$EYBQ:QIVIV=_I$T9FCO[6=9+=T'5Q(I*E> M#R#CB@#1HK#C\=>&Y?# \2)XATI_#I4N-76]C-H5SC/G;MF,C&<]:F\->+M" M\9Z=]O\ #^LZ?KMAN*?:M-NDN(MPZC)/^$=/BO0QX@W M;/[*_M&'[5N]/*W;L^V*\P\9_M7>&_!O[2?ACX47=YI%N=2TZ>]O-2NM4CB- MI*I40VQC/1Y-P(!()&, YS0![K17G_PX\5>(==\3>.[77-1\*7>GZ9J8M]-C M\/W+RW5O!L!*WZLQ"39YPN!CM6C#\8? 5S%=R0^-O#DL=I*D%RZ:M 1#(S;5 M1R'^5BW !Y)XH Z^BL3Q3XX\.>!K2.Z\2:_I?A^UD;:DVJ7D=LC'T#.P!-WBN/$?B#2_#\$S;(Y=4O8[97;T!=@"?I0!N45DW7BW0[ M+P\VOW&LZ?;Z$L8F.J2W2+:B,]'\TG;MY'.<52M_B1X2NO$*Z!!XHT6;764, M-+CU")KD@C(/E!MV,<].E '1T5C>)_&7A_P38K>^(MBT5PWP,\=7WQ.^#7@KQ;JD-O;ZCK>D6VH7$5HK+"DDD89@@8L0N3QD MD^]=/IWB72-8U'4=/L-4LKV_TUUCO;6VN$DEM689595!)0D<@-C(H TJ*R=. M\6:'JZ:B]AK.GWJ:;*]O?-;W22"UD499)<$[& ZAL$53\,?$?PGXVGN(/#OB M?1M?FM_]='IFH17+1=OF",PW?A6W;W$5W!'/!(DT,BATDC;001U!H DHK@/$_BCQ%IWQ;\': M+8ZAX5@\/:A;W;ZA9ZE>- M/#UI;M0 M01U%96K>-/#^@7IL]3UW3=.NQ;->&WN[N.*00*<-+M8@[ 2 6Z#/6@#9HKEX M_BGX+E\-/XB3Q=H3^'T?RVU9=2A-HK_W3+NV@^V:LR>/_#$5CI5Z_B/24L]6 ME6#3KAKZ(1WDC?=2%MV)&.#@+DF@#?HK-UKQ+I'AI+5]7U2RTI+J=+6W:]N$ MA$TS?=C3<1N:M9:5;^+="GU.]B6:ULH]2A::XC8;E>- VYE(Y! ((JSKWC[ MPQX5N6M]:\1Z3H]PMN;LQ7]]% PA#!3+AV!V!B 6Z9(% &]16#>>/?#.G^&X M_$-UXBTFVT"4!DU6:^B2U<'H1*6VG/UJ[H7B+2O%.F1:EHNIV>KZ=+GR[NPG M2>)\=<.I(/YT :-%B:GJ\.1)I]GJ,,MPF.NZ-6+#' MN*N^)_&6@>";%;WQ%KFFZ#9LVQ;C4[N.VC+>@9R!GVH V:*R3XMT,>'6\0?V MSI_]@K$9VU3[4GV41CJYESMV^^<5GQ?$WP?/KEMHL?BO1)-8N462#3TU&$W$ MJ,-RLL>[:1;G4M.GO;S4KK5(X MC:2J5$-L8ST>3<" 2"1C .><9B75=0BMC)_N MAV&?PH Z.BO%/VFOVG-%_9Z^$0\9QR:=K4MW-!!IUJVH)$MWYDBJ9$;G>J*V M\[0>!U'6MN7XE7^M_$'P)'X9\0^";_P;K-K=S76_4#)J5TR+\AL0C;)$5L^8 M2#@#M0!ZA17.>(?B1X2\(ZC;Z?KOBG1=%O[G!@M=0U"*"67)P-JNP+?A6EJO MB32=!6S;4]4L].6]G2VMC=W"1">9ONQIN(W,<'"C)- &C17/Z!\0O"WBO4;O M3]$\2Z1K%_:?\?-K87\4\L/./G5&)7GU%:EOK.GW>H7-A!?6TU]:A3/;1RJT ML0/*[U!RN>V: +E%>-?M??&76_@!^SYXH\=>';6PO=8TL0>1#J<;O;L7G2,[ M@CHQX<]&'->>Z9>?ME:KIMI>Q2_ M8KF%)D5X-9W ,H(!^?KS0!]3T5X;\3O MCWJW[.WP)T_Q'\1++3];\=7$D>G0Z/X5$JV^HZA*Q$4-OYV7"D8)+9(PW!X% M< =0_;*_LC_A)A8_"T2;//\ ^$*VWGVC9U\K[5OV>=CC/W,^U 'UC17E?[-_ MQ^TS]HOX<1^)+*PGT74;:YDT[5M%NSF;3[R(XDA8X&<9!!P,@C@'($_[0_Q; MU'X,_#B76]%\,W?B[7KBZAT_3=)M5;$MQ*VU#*X!V1CJS'TQWH ]-HKY;TSX M^?%[X8?%7P%X5^,FA>#Y-.\<3R6.FZEX-FNLV5VJ;Q%/'/G>".-Z$#/:K7BK MX\_%+Q]\9/%?@+X+Z-X4DC\'1PC7-<\827/D-=2KO2U@2WPVX*,L[' ]..0# MZ:HKY,O'&O^%9K;QGX/U"30M6\+67P'?WMO::A;^&+B[_M+1_/8*CR&7,

Q23(R MJ"4A7!+2' 4XR>*Z;]G7XCZC\7O@;X(\::O;VMKJ>N:7#?7$-DK+"CN,D(& M9B!]2: /1J*^0O$/[96O^%?A;X^\=#2;36X'\:-X2\&V S EPRL(?,GER?E, MJRG(QPH'?--\9^.?VK_@UX9N/'/B"S^'GC?1+$+/J?AKP[;7L%['!D;_ +-* M[,'90^$?COX9ZYJVEV*_!7QE%%:SZM+;2Q:AH M][*H:'[02^P1-D _("I#9/'/0?M0?M#ZM\*AX4\*> M.LO$7Q/\ &%ZMMHVF MWH=[>.$$&:ZG",K>4BYY##)[\&@#WNBOF;XN_'/XEQ?%SPW\&OAQ:>&9?'5W MH9US5]=U])UT^T@#>6?)@1C([,^< L=HQG/)%?PG\6OC=\,OC!X5\$_%K2?# MWB70_%)EAT_Q3X.MKF(6EPB[O+NXI"P56' 8$#GOS@ ^H:*\#_:^^/WB+X(> M$?#]KX&TNPUWX@>)M433='TW4DD>%\*7F=U1T8A47LPP6%=I^SK\8K;X]?!C MPOXW@C2WFU.U!N[6/.+>Z0E)HL')&UU8#/.,4 >D45\G?M)_MVZ9\*_&FA>" M?!5I%XI\2S:]8Z7K4YADDL='2:4*4FD0J//8;MJ;N,$L.,'TS]J'X\WOP)\& MZ--H>BQ^(/%?B/5[?0=%L+F8PV[74Q.UI7'(10"3CD\#CJ #V6BOF3P?\>?B MGX*^.7A;X;?&+1O"C/XNM;B;1=:\&R7(A6:!=\L$T=QEL[3D.#CIQR<4+K]H M#XQ?%GQSXYL?@MX>\'S>&_!EZVE76H^+9KD2:I?(NZ6&V$. @7(7>^1DCMT M/JJBO&O@Y^TWX=^)'P(/Q*UQHO!]IIYGM]=@U"8;=-N8'V31L_&0&QCC)#+Q MDXKB?V:_VPIOVC_C7\0/#^G:%)I?@_0K"SNM+O+ZVE@O+\3,^9RK' B8*"@V M@XY)YP #Z;HKR'XD_%+6=(^.?PO\ Z#]F_XG7VW4M9>>(NT5A;Q #;R-I:62 M-)_$

X;4KF,XD%K!$0 B MGCV.@ /K>BOG+X(_'3XB#XMZI\)OB]X?TRT\50:>-5TSQ!X;68Z9JEMN MVMQ)EHI%/52><' &!GR[X*?'+]JG]H3PSJ/B?PI;_!ZPT6#5KO3(H=8M]56X M/DR; MC3O+IUU8LA<7$6_YUP!]ULGD=#D#E_!_Q7_:3_:-T<>,OAWIO@GX?>!+IB^B MKXNAN;K4=2A!PLTBQ,%B1\9 Y;GN,$@'V!17SW^SU^T?XA\:>._$7PN^)OAV MT\*?$_0($O)(M-F:6PU2T8X6YM6;Y@N2 5;)&1SG(',_&']N?2O"WQG\#_#? MP3:Q^)M0U'Q39:%X@U/RI'LM*$TFUH?-4A3.?+K(JG<#G!% 'T MC17R;I7QX^/'QJO?%6K_ F\+^"K+P9H>HSZ7:R>,9;L7NL2P'$C1"'"PH3P MI?/\\>O_ +-7QS@_:'^$^G^+DTR31+TS36.H:9(_F?9;J%RDJ!\#<,C(..A% M 'J=%>?W'BKQ#%\;K?01J/A1?"K:(UY)8R7+C73<"7:)%BW;?LVW@MC.[O6C M+\8? <$6GRR>-O#L<>HDBR=]5@ N2&*D1G?\^&!'RYY!% '7T4@8, 0<@]"* M\+A_:N\-S?M17?P@:\TB!K;2%O/[0DU2/?+>M,(Q9+'_ ,] ,L5R6Y'RCN > MZT5\[_ #]JFT\<^&_%FH^/\ 5_#7A233?%NH^'[#S+H6:7$5NRA"?.E.Z0[N M=I Z8 KZ!-];"R^V&XB%IY?F^?O'E[,9W;NF,-VN%\.> M)-(U]K8XG&EWT5R8C_M;&.W\:=X[_P"$G/A'5/\ A##I*^*/)/\ 9YUT2FR\ MW(_UHB^?;C/W>: -ZBOAGQ=\2'XWZ_P##[2_$%Q+++8)X"2V MC0-(Q%VV]F7YBQ7@+C- 'J]%<\/B'X5;PQ_PD@\3:.?#O_07%_%]DZX_UV[9 MUXZU=\.^*-&\7Z:FHZ%JUCK6GN2JW>G7*7$3$=0'0D'\Z -2BN5U+XL>"-&U MY=#U#QCH%CK3,$&FW.IP1W)8]!Y98-D_2O./CU^U/H'P,\>_#GPQJ%QI2R^* M=2-M=SWVI1V_]FVH1F^T.K?PDKM!)5XT5S5_\3?!^E+=M>^*]$LU MLXHI[DW&HPH((Y.8G?+?*K_PD\'MFFWWQ1\&:7H=EK5YXMT*TT>].VUU&?4H M4MYSZ)(6VM^!- '3T55?5+./3CJ#W<"6 C\XW32 1"/&=^[.-N. M^&?',<\GAOQ%I/B!(&VS-I=[%9(JF1#R75%?>=H/ ZC.: /:**S?#OB+3/%>BVNK:/J-IJVFW* M[H;RPG6:&09P=KJ2#@@C@]JJ^*?'/AOP/;Q7'B/Q!I?A^"9MDX9I&_> ,G M'!'.<\4 ?0-%?/O[0/[1?B+PAX_\.?"WX9:!9>)_B;K\#WJKJLS1:?I=FAPU MS"\4_&']H;]F^;2?$'Q/L/"'CKP#=WL5GJ5QX.M+J"_T MHRL%641R%A+&&(!P-W3I0!]?T5X3K7QYUNQ_:_\ "7PKMK73I/#6L>%[C7); MMXI/M8E20JJJV\*$( R"A/N*]C\3:G)HWAS5=0A57FM+26=%D!*EE0L <8XR M* -.BOB3X'_&/]K?X\_"S1O'V@VOP8M]+U59'@L[^+5HK@!)&0ABLCJ"2AQR M>HKU'X)?M1:K\0M*^(6@>+/#4?A#XH^!HF;5-&$QGMI5,;/%<0OP6B?'3.1D M6FGQ:'X5L=.NK*XACD%S(UPA9Q(Q M K2+Q#I6J:K/IVM>)&AD:SBDC MA9S;VTH(5Y5(4L?F500,$GCN?VC_ (\^)?AYXJ\!^ O .BZ;K'CWQI<3I9/K MDSQ6%G# @>6:;R_G; (PJX)Y^A />**^=_@Q\>/'5S\:]:^$7Q5T;0;3Q;;: M2FNV&J>%I)C87UH9/+8;)LO&ZMQ@D@\^@SZ?\;OBM9?!'X5>(_&]_97&I0:1 M;&9;*V'[RXD)"I&O!QN9E&<<#)[4 =S17QQXH_:,_:"^#G@O3?B7\1?!W@=_ M $LMN=2TK0;J[_M?2X)V55=GD_=2E"Z[E4#GH<(RMV;K@\# R ?2=%)1X=?Q5HJ>("=HTEM0A%V3Z>5NW MY_"KWB3Q;H?@W3CJ'B#6=/T.P#!3=:E=);Q9/0;G(&?QH UJ*Y/6_&<.H_#K M6-?\(ZUH-ZT=E-+9:C=W8?31*J$JTTL;<1@XW$'(&:\7\9_M>V?PJ_X4UI/B MK4?"5UKGC.6--5O]-U=8]/L8O*+-=1%R6:%F!5&8@>YQB@#Z4HKRS2_BE<67 MCOQLWB/Q1X%M? ^FP64NGRV^I;;^W\U?F:]WOY:*[%?+(QN![UZ%J_B+2O#^ MC3:OJFIV>FZ3"@DEO[N=(H$0XPS2,0H!R.2>] &C16!XA\?^%_"6G6VH:[XC MTG1;"YQY%UJ%]%!%+D9&UG8!L@@\&M;3]1M-6L8+VQN8;VSG4/%<6\@DCD4] M"K#@CW% %FBDS1F@!:*3-&: %HI,T9H 6BDS1F@!:*3-% "T444 %%%% !11 M10 4444 ?.O_ 4,_P"3,/BG_P!@Q?\ T='7K?P>_P"21^"/^P'8_P#I.E1? M&7X4Z3\'= M*T6T>22UTZTBLXGF(+LD:!%+$ G &< ?2@#\^OC-XDNO@'XN_:6\ :<3#/\ M0[:PU;P[$O&ZYOY!8W03W#MNXKB]#T^XT7P!-^R,+B22\;XDQ:9M9LN=#(6_ M>3Z84C_@5?=WQ6_9?\&?&+XH> ?'NO&_36_!DYN+%+66-89SN5U6=61BRJRA M@%9><\FD3]EWP6G[2+_&[_3SXP;3?[-\DR1_9 NW;YH39O\ ,V?+G?C';O0! M\N^)H([7XJ?MMPPH(XH_!=BB(HX51I\H %0>$_\ D;OV"_\ L 7G_IMCKZHU M']F'PMJ?B+XJ:U+?ZPMU\1M,BTK5D2:()!%'"T2M;CRLJVUB27+C...U1Z?^ MRUX4TW4?A)>Q:AK+2_#.TELM'#S1%9T> 0DW'[KYCM4$;-G/;'% "?MC>*M9 M\$?LN_$S6_#TDL&L6FBS-!/"0O!<6TRADEC8%65@>H()%?+&M_\$V?AWKWAFY\+7'C'XACP6V\V M?A<>(=VG:>YR5:")XV.5))4.74'M0!S-H0/VR/@"6E\A?^%7W692<;/EC^;\ M.M>%77P-S=ZG)JGAC09/#MI;O)$;>6V< ,TJ^7N9_E M'(91_LUYC<_\$^_ _DZEI6F^,_B%H/@O49I)KKP7I7B$PZ0XD;=)&(_++JC$ MG*JX'- 'E<">$/VE?VLOA;HVLI)XF^&UA\.T\1:#I>NCS8[VX>41^=/&W$LB MQ@9# \@FH?VL_A3\*OA'\)?V@K3P/>IH?B+6/#5M?:CX+T^1([&&-;A%6[2V M5!Y;,OI/XC_LG>!/B'I?A2W@&J>#=1\)PBVT+6O"EZ;&^T^':%,2 M288%" 58,/S-5_!7[('@'PGX=\8Z9J#:QXTN_&$'V77M:\4W[7>H7T.TJL; M2@+M50> @7!P>PH \=_;FNX4_8/T,M*H\Z30%CY^^?-A.!Z\ G\*I_M&?"/Q M/K'[1=GXZ\.^#_!?QQBLO#L6GW7P_P#$E_#'=:>#(7^TP),&C7S!QN=<\8&: MZ^]_X)Q^ M9\,P>']9\;?$37]'L3$=)L]5U\3PZ3L=67[/&8M@X79EPY"D@$ M=:]#^*W[*/AGXH>,[/QA;^(/%/@7Q?;V8T]M=\'ZF+*YN+8'(BFW(Z.H/(RN M??@8 /E#1/#'A7XK?LV_&+X;>"["Y^"'B:/7[6;5?"GC"_5-.M[J5ED2UB=, M 03B(J%4<]A@C-_P6=(^&_QX^%B_$G]GB/X->)FOCI&B^)_ =W;MI.I3S)L$ M-RL*AMK3QDCZ1TS]BGX:6GPT\4>#-1M]5\1Q>)[E+W6-:UG4'GU2\ MN4_U4[7'!#I_#M YXY.:W@W]B_PSX<\8Z!XDUSQIX[^(=WX?D\_1[;QCKGV MRWT^7&!+'&L: N!P&?<1]0* /4_C%_R23QM_V!+W_P!$/7YUIX-TWX@_!+]A M7PYK$;3Z3J.H20W<"N4$T7DL6C8@@[6 *D=P2*_3'Q+H-OXI\.ZIHMV\D=KJ M-K+:2O"0'5)$*,5)! ."<9!^E>1:3^R-X/T;1OA#ID.I:XT'PPG:XT9I)X2U MPQ0H1BZS8:M9Z/:):V M]Y%'"K()(T 5B">I&>!Z"O*[GQQJWP1^"'Q;_9VTZ63_ (2J/Q/'X<\*(2=[ MV&K,7B9?9$,^3V(%?=/BSX)Z'XQ^+7@KXAWMUJ$6M>$HKN&Q@@D06T@N$"/Y MJE"Q( XVLOOFL+Q5^RWX)\8?M >&?C#J"7O_ E6@6IMK>&.1!:2\.$DE0H6 M9T\Q]I##&>AH ^0OC]X$U72OC_\ WX+Z%X/TGQUX6\.>$WOK/POKVI?8=/U M"ZC)C:63Y'$K(J[@C*1\S'USU/PK^&'CCP3^T[%J[^$_ _P3T/5_#UW;:QHG MASQ'%(+O:K&&]2T$<85HFX+J,8SD]<_4/QO_ &<_"7Q[AT>77'U/2=(=!O#9ZC8.>&,4H!P#@9!!''2L3X5_LE^$/ACXHU3Q1=:IXB\>^*]1M#I\ MVN^,]1^WW*VIZP)A%1$/?6@#X6G^$TGP<^#5Q8?$;X$:%\2? UO(^H/\ M%_X>:E;MJYC\XR?:F9QYQ8=V#A0 1[U[IJ_A[P7XZ_;M^"FLV^BZ?J^FZSX" MN=5CN=0LHY);HCRS;SR[ERTBKMPQY';%=^?^">O@5;"XT*W\9_$.S\!SRM)) MX&M_$3+HY5FW-%Y>SS!&3R5$F*[GXE_LH>%?B)XE\$^(+76/$?@G6/"%O]BT MRZ\)WZVC?9?E_P!&<,CAHL(!M '&1F@#X>^*.OZCHWAK]J:TLKR;3;36OB?I MFD:G>V[E&ALI@BS'<.@(^4GT8UZ3^WA^S-\*OAG\%?!VL>$_"VD^%=5TSQ%I M5E;7.EP+!)>Q/.H:.9EP9N%WY?<R\+6,;AIV;S(8D5MJB,;B[<8!Y&0#WWXM2^"O%O[5/B M9=&^$.L?'_QWI.F6UE?6&K3V,>A:#&P+HL9NAM65P=S<,?3'(KR?X/:!$/!/ M[:'AG5?!FD^%M/L(%OHO"-K<)?V6EW)LI6/E-L5-P*J:=\-? MV-OA_P#"I_'R:/)K,]CXWLTM-8LM1O\ [2LN(W1Y1(R^;YDGF.69G;).0!0! M\K^*O#NE:!^QY^RD^EZ99Z:U[XK\-W5TUI;I$;B9D.Z1]H&YS@98Y/%>C?!K MX>>%_CW^U;^T!J_Q)T6P\7:EX:U.VT31],URW2Z@L+$PE@T<,@*@R')W8SUY MY->E:'^PWX2T7P'X=\'R^,/&VKZ+X>\06OB#2DU34X9VM'MQB.V0F#Y;?_8 MSZ,*W?B?^R/X5^(_CQ_&]AX@\5_#_P 7SVZVEYK'@S5?L,U]"OW4G!1U?'8[ M<\#G@8 /BSXA:=;_ Z\"_MJ?#;PPS0^ =%M-/O]/T]'+0Z=<7 5IX8L_=7( MSM'3%=G^TW^S]X!^%_[%7A7Q;X<\,Z?IGC+29]$U"+Q+! JZE)<230^9))@KZ;M?V-/A[I_P2\5_#*S_M:WTWQ26DUG6FO!-JM[,S!C-)/* MK!G^7NN!DX S74?%+]G_ ,/?%SX/P_#?6+S4[;0XEM%%Q8RQI3.<_-QTP17C_PSMKSP]/^VCH4GA#3_AU;+X8BO&\):1?)=VEC,]G-NVLB MH@9A@D(H S@=*^QOB!^R'X;\:_$63QUIGBOQCX"\3W-G'87][X1U5;3^T(8^ M$$RO&X8J!@$ 'WK.\*_L.^ /!;?$ Z7J7B1?^$YT?^R-:-UJ*W3S<.&N1)*C M/Y[>8Q+,S+S]T4 =7^R-_P FN_"G_L6K#_T0M>7?LL,!^U5^U,A.&_MK2VQW MQ]D/-?17PZ\#6'PR\!>'_"6ES7-QINB6,.GV\MXRM,\<:A5+E54%L#G ]J\ MH^(7['7A;QU\2+_QS8>*?&?@77]4@CMM6D\(:R;%-31!A!.NQLD#C: M /E3P[X%E^+WP6_:B\.:7XGTKP[XU>Z\BSNV62)OLLC@YVR[2F! MDG/0UM>"SI'PW^/'PL7XD_L\1_!KQ,U\=(T7Q/X#N[=M)U*>9-@AN5A4-M;G M DW,#R>,D?1/A[]AKX6^'?ACXQ^'Z66H7GA?Q-J/]J3VUU=Y>TG"H%:"55#J M5,:L&8LV-/'?Q#N_#\GGZ/;>,=<^V6^GRXP) M8XUC0%P. S[B/J!0!\D_#30_&GQD^+GQL\37/P8\&?%V_A\476B>?XRUA8WT MRVA^6*WAMY()!&NWG>N"Q)]*^EOV"?"'BKX?^#?&GAWQ VC6VF6>OS-I&C:/ MK:ZJNCPN 6LVD !78^<*P!&3Q73>/OV-/"GC'Q[JGC+1?%'C/X<>(=714U:Y M\$ZQ]A&H[1@-,C(ZE@/X@ ??/->@_!CX)^%/@+X,3PUX2LY;>R,SW5Q<74S3 M7-W._P!^::1N7=L#)]@ * /#OC7_P G\_L\_P#8*UW_ -$K7F7[&G[.WP[^ M)F@?&C6O&'A/2_%.H7/C76=/275[9;DVL"R9VP;P?*)9V8LF"3CG@5]<>*/@ MGH?BWXO>#?B->76H1ZWX5M[NVLK>"1!;2+<*%HW4&N:S=:W7%S^R5 MX:MY[B2X2PO=0LH#*Q8I#'=2*B9/8 #VKCOC]\-] ^*?_!0CX2Z-XGTZ'6- M%C\)ZA=RZ==+OM[EHYLHLJ'AU#$-M;()49%?2?P/^"^B? +X?V_@_P /76H7 MFF07-Q=++JF7] MGX+$DRVI'E!\+@';QN;&,UQ/A3X./XN_9I_:+\)^%XC:W'@GX@ MWVJ^%;:'.+*6U\N9(XA_"" Z@#^]7W5X;^">A^%_C'XO^)5K=ZA)KOB>TM+* M\MYI(S;1I;J0AC4(&!.> M+)-$G\/W7C?6;C5[?3;M2LUII^]OLD+ \KA"6QVWU[1^TG;37G[/?Q)@MXGG MGE\.WZ)%&I9G8P/@ #DF@#X^L?V:?A3;?\$W8_$G]B:;_P ) GA-?$">+?+7 M^T4OUA$B.MS]\;7 0(&P -N*IZ;X/V%_"/BOX"_#M_$6N>.#H=SIEGJ%_X%EUN M1-&DN=BNY>W*[QE_F*;PN<\5]-7GP*\.WGQE\._$H37MMK.@Z/-H=I90/&MG M]GD8,=R;-VX8 && [&@#XM^,7AG5O$/[;EOX$T#X8^%_&_AGP=X2ANM$\&Z MW?+IVEVYEDQ)<)!Y3QR,.$P5P!SVJ?PI\&_&VC>,?C!I=Q%X*^!'AWQ3X/D2 MXT71?$TYV1W_DA8_(1E8HS*H'XU]9_&G]F+PG\;=;T;Q!>7VN>%O%VC MJT5CXF\+7YLM0AB;[T6_:RLAR?E93U.,9.&]) M\.ZA8M:?%;X8W]NQ>4,JQRW "B8QR$@MO8[L\#.!72^+[+Q=\6/VY?BI%_PK M'PS\6$\)V=A9Z9I'B_51;VVGP2Q!WFB@>*1)&D?.7(R, =Z^@-*_8$\%VK:1 M9ZMXT^(/BOPKI$\=Q8^$M>\0&XTF%HSF(>4(U9E3 VJSD#&.E=C\6_V4/"GQ M7\:6GC.+6?$O@;QI;V_V,^(?!^I?8;N>WZB*4E71U';#8;G7+R3QK$\>O>)-0OAEE*[VG="N5!.!LVC M)XYKI?&_[/'ASQ[\ Q\(]0O=4A\-C3[;3?M5M+&MYY/%/@WP]XC_;]^#UUJF@:5J%Q?\ @>[O[J2YLHI#/<(8]DKY7YG7 VL> M1@8Q7-O!X-\>_&3XHZAX)^ =_P#M ZO+JK6.K^(?&%WI\.FV,T:A3:6;W"%A M&G&=B$Y[D8KZ4^)W[*WASXF^*?!?B4^(O%'A;Q%X3@-K9:GX;U%;6:6 [=T, MVZ-@Z-MY SDBN>O_P!B+PH?%GB+6-#\9^/?!MEXBNFOM6T'PWKWV33[N=_] M8Y7RRZ%^^QU_"@#X1@TBUO\ _@GEXZMM1T>PC;0?B4UGI]IN%VFF1M>6^^"" M5ESL^9ER,;AU'-?6OQ/T73_"O[:O[..GZ'IEIIEA;:)KWD6-C L,*?N%.%10 M ,DD\#O7$O$FIG56@%XOFZ?-E"OV:3R]P"F-2 M/,WGKDG-=%X=_9;T30_%/P[\1WGBOQ9XDUKP/:WMI8WNN7T5Q+=)<\.;E_)! M)_P!AKP;K'B77]7T+Q7XY\ 0^(96GUG2?".N& MRL=0E;[[R1%&VLPR"4*YR?6NDU;]DGX?WW@#P-X+T^VO/#WA_P ':O;:WIUO MI%]*\'7EUXB MFT>Z?1;5+7[3:M;G*2[ /,^K9/)YKZST3X8^%_#GC;7_ !?INCPVGB37DB34 M]01F+W*Q#;&&!.!M'' %8_Q*^"FA_%+Q3X#U_5;K4+>\\&ZH=6T]+.1%CEE* M%-LH9&++@]%*GWJ[X=^&:>'?B+XG\7#Q-XCU%]>2!#HVH7_FZ;8>4NW-K#M' MEENK')R?2@#Q'_@I@"?V+OB =I(L\'T_P!+AK/\,_L^_M!3^&]*D@_:GOK: M%[2)DA'@72V\M2@PN3R<#C->Z?'/X,Z+^T!\+]9\">(;O4+'2=5$8FGTN1([ MA=DBR#:SHZCE!U4\9KQN#]A5[6".&']H;XZ111J$1$\6Q *H& /LW H XS] MM*QO_!=U^S+KGBO6#K>E>'?&-HFNZW+;I;I)*R!5N9(T^2,%E8X' W8K[2\Q M/+\S>OEXW;L\8]&ZNO%MV+N]N59RX+R MJJ'F^7YG ME8XV9Z<9H \O_9N^(^M^$'_:+^(7@?P-J7Q$T?6?B"T.FZ;HTJ1M,JHPFN$9 M@5*[BG(ZYKZ/^'/[2LFKZ!_:/Q*\'7WPF?#WX>^'OA5X.TSPMX5TN'1M"TZ/RK:T@!PHZDDG)9B226)))))-9/Q MD^#GAGX[^ [SPEXKMI9]-N&29);:4Q3VTR',0?P(()% 'R)^T'X" MUW]GOX_?#;XQ:KXMO/B587WB5="CT#Q"N1HXO68"6P"$*K(!M^96) '/IZ'^ MQ>/L?QD_:>L+GY=27QP;EU;[QADA!B;Z$ XKI_"/[&>G6'C70?$WC7X@>,/B MA=^''\W1+7Q/=Q-;6,F,";RXXT\R4#H[Y]<9P:TOBA^R;8>-_B%<^.O#/C;Q M/\-/%5_:I8ZG>^&;B-$U&%>$\Z.1&4NHX5Q@CWH \X_94UW3M"^+7[5_B>^O M8-/\-6_BQ#+?3N$@C,-M^_8L>!@D9K-"ZY_P4!\6:->_8;GP_P#L\Z#J"7\$ MEY&8[KQ;F:U^Q#X#U;]GJ7X/0:GXBTGP[=78OM0U M&QO8_P"T=1GW[W>XEDB<.7;!;Y1]U0, 8K#TG]A-=$BLX+/X_P#QNAM+0(D- MHOBJ%851& MK7QIX4UGP_>R3166JV4UC/);D"14E0HQ4D$!L,<9!&>QKS'4OV7_ _>? OP MO\)XM5U-/#&ARV/SRM&\]Y#:RK(L4I"*N&*+N*J.!QB@#R?5?!?PR^'/[)'P MQ^%GQ>MIY=-\2M::8\\:,/*U2?,QE:4$>4PE9R'/TY&17/>._@#\9OV8O!>L M^+OAI\?-8US0_#]I)?/X7^($,>H136\2EVB%UPR?*I VJO89%?6'Q3^%'A;X MT^"+_P )>,=)BUC0KP#S+=R5*,.5=&4AD93R&!!%>#1_\$\?!UU;P:9KGQ%^ M*7BKPG"RD>%-:\5/+IC*IRJ-&J*Q08X!>@#T+3K30_VQOV7--/B;2#;:7XST M.*XGLSRUL[H&#(3W1\,I]A7SS_P32^'\^O6/B3XD^+M:N/%7BW3+N7P3IUY> M*/\ 0]/LMJA4'8N3ECU..IR2?N'3=,M-&TVUT^PMHK.QM8E@@MX5"I%&HPJJ M!P *X3X&_ O0?@!X8U30O#UWJ-Y::AJUSK$KZG+')(LT[ NJE$0; 1P"" M?4F@#Q[XW?#OX6_M(?'4>#I=<\1^#/B_X5TM-1LO$'AZX:QNEM)6^ZDG(E0, M>5QD9.",FN)NM:^-/[('Q-^'.F>)OB4GQ>^'_C#6H] $6JZ>EOJUA+(#LD61 M"3,HQ\Q8].PSFO?/CE^RQX)^/>HZ3K&L-JV@^*=)!73_ !+X:OVL=1ME/)59 M5SE+_''[=6H^(/"/PSU+XGZ%\,-/;1(8M/U&VM([?4[ ME0T\A:=@&8)F/"YQCG'%:/[#OC37?A]\?OB;\*O%?A&\\ 1^()G\9>'M#O[J M&X:*.1MMS&DD3%"-P# #H%;(KZE^!OP(T#X!>']7TO0KO4M3DU?5+C6+_4=7 MECEN;BXF(+%F1$7 P !MX'K4'Q _9^\/?$/XJ>!/B'Z?&?X*:'\<]#T72M>NM0M+?2=9M=<@;3I$1VGMV+(K%T< M%"3R ?0BH/CE\!O#7Q^\,6FD^(&OK&XT^Z2_P!,UC2;C[/?:=*9G\*VMWXES]NT65TW>;;! M&$95^CDINQ_%S7H7_!.O_1/ /Q.T^X^74[/XA:RMVC?>#&12"?J,5V?P_P#V M1;#P[\0M+\;^,/'7BGXG^(]&C>+2)?$MQ$8-.WC#/%#%&B^81P7;)^AYJKX^ M_8UTWQ+XX\0>)_"WC_QA\-KKQ*%&OVWAB[BC@U$A=OF%9(V\N4KQYB$'VSDD M Y/]@C3-/\2?#?XL_:K.WU#1-1^).M3P17$2RPRQ!X<':001O0D>XJ?X0J%_ MX*$?'H >']" [?NVKZ ^%GPO\/?!KP%I/@_PM9FRT73(_+B1F+NY))9W8 M\L[,2Q/M>\?!WX2V/P=\.:CIEG? M7&ISZEJMWK%Y?784233W$I=B=HQ@ A1[**\O\?\ [%>A^(/B!J?CCP9XU\6? M"KQ-JV#JDWA2]6*WU!A_'- ZLK/_ +0QW)R230!Z?J/QJ\*:=\7]-^&,M[(W MC#4=.DU2*TB@9T2W0D%I' PF<'&[&>W45\+?L0>&OC]JOPEUJ;X=>-?!V@^& MSXFU15M=:T>:YN1)YQWMO5P,'C Q7V!\"OV6O"WP+U36=>@U'6?%OC/6@%U+ MQ3XFN_M5_.@Z1AL (@P/E4=ADG QT'P*^!F@_L^>#+CPSX=N]1O;"?4;G4VD MU22.242S/N< HB#:#T&,^I- 'R]\4OV3_$W@S]G3]H'Q3K?BN7Q_\5/%^B_Z M;J,%D+2%+: !A;00J3A=BL,YYP.!W^E/V7/$>D>*OV<_AOJ&AS13: M400C)$J.AQT*LK CU!KU!T61&1U#*PP5(R"*^8[[]A+2-&UO4[SX<_$CQS\* M=/U2=KB]T/PQJ*+8-(WWGBBD1O*8^JG'3 &* .+Q/_P5 \++HI$TGAOP M/1$)I3Y,;D=\LK 'L:U?VS=(L='U?]GV.PLK>QCE^*^DSR);1+&'D9 MI"SD #+$\DGDFO7/@7^SGX._9\TS4H?#<5[>ZIJLWVG5==UBY-UJ&HR\_/-, M>O4\ #).,DUI_%3X-:+\7;KP9<:Q=7]L_A77[;Q%9"QD1!)<09V++N1LQG< MH:;J^DS^ M1>Z==)]R:&3!PPR1R""#TKE/A/\ LKZ?\._'%UXXUWQAXC^(?C:6R.G0:UXC MGC9K&V)R8X(XT5$R>6."3^)R _!OX)VZ:O\0GC":QK\@S MI_AB%^#),XX:?'W8ADYY/3%>L? 'X*Z3^S]\*]&\%:1/+>162M)<7UQ_K;NX M=B\LS>[,2<=A@=J\,\._\$Y="\'7&K2^'OC3\8O#YU6\>_O5TOQ';VXN)W.6 MD?;:C$ET)_%GB;QH5G>;^U/%E^MY>G=CY#($0;1C@8 MXR: /GWQ%_RDCL?^R9W'_I97C/[)O[-?PW\:_L-^)/$'B+PEI>NZ]J,6LN=4 MU&W6:YMA%),(E@D8%H@NW< A'))[U]K7OP.T*^^-L7Q1DN]1'B"/0G\/BV62 M/[+]G:7S"VW9NWY[[\8[56^%W[/_ (>^$OP=E^&VD7FIW.A2)=H;B]EC>YQ< ML[2?,L:KP9#CY>PSF@#EOV%M7O-<_9#^%=Y?W$EW=-HL:--*VYF",R+DGKA5 M _"O+M(\">&I_P#@IIXBFD\/:5)-'X'MM221K*(LMW]LP;@';Q+C^/[WO7TM M\'_A=I7P4^&GA_P/H=Q>76DZ);?9;>;4'1YW7<6RY154G)/117(^-OV9- \9 M?&K0OBE#XA\3>&O%&EP1V)]2N_&VL6"S:M:I<&WA5P=L.\'RR2Y)9<'..>!7 MAC^(?$NH_L7? ;P/9Q_VQI&M>.;K1;K3[W46LX;VVAN)3!92W !*1L0!T/W0 M*_2SX/?!#0O@GI'B'3M#N]1NX-!_P!BWPIX5\ >H!KZ!H ^1OCM_RD$_9R_[!NM_^B16;^V5X'T?XC?M4?LS:!X@L MHM2T:YO=5>YLIUW17"QP1R!'7HRDJ,J>".#7T+XL^!>@^,OC%X*^)-[=ZC%K MGA."ZM[&W@EC%M(MPNUS*I0L2!TVLOOFI?&_P3T/Q[\3/ ?CG4+O4(=6\&O= M2:?#;21K!*9XQ&_FJR%FP!QM9>>N: /BSX_^#[N\_;)\(?#;PK\,?"_BCPGH M'A>36]-\$:E=)I>DO#;[PK<3ZWX=\,>(8[AB\6634(K41)L*J&4LJ$<=R:^F_C;^S5X3^.M MWHFIZI<:OH'B;1&9M,\2>&[XV6HV8;[RI( 05/=64C\S61\-?V0_!'P\O/$N MI7MWKOCOQ!XCLSINI:[XPU WUY-:$8-N&"JJ1X[*H[>@H ^'M7\*>&=<_99\ M4W7@C]F>36?"DVF7NH)\3O'NI:?;:K/P[_;051KAVSRH&P$8'&379:WX?TGQ MSH/["]_XATFPUR]U.2"UOI]0M8YWNH5LLB.0L"74')VG(R2:]]L_^"?/@>#P MS)X4NO&OQ#U3P-L>.#PE>>(B=-MU.2JJB1J[*A.55W9<@9!KH?$W[%O@_P 3 M_"?P#X%?Q#XKTQ? SI)H?B'2]0CM]5MV52H/FK%L^Z<<(.@[T >/:9\&_!WQ M*_X*,_$B+Q1X?T_7M,T;PGI4EII6H6ZS6:2,"@+OVBK'6O"&F:WIFC>++S2=)T_4K=;BWTRW9-[+;1OE826;ED /RKS MQ7UMX,^ FB>"OBGK/Q @U76-2\0:MI%GHUVVH3QO&\=L,))A8U;S&ZL2Q!)X M J?X9_ [0OA5JWCS4-)N]1N)O&6KR:UJ"WLD;+%,ZA2L6U%VI@=&+'WH _,Z MUUKQ+XA_9D_9E^']K8Q^(]$UCQ1JEI<:-J6I-96VHK:SN;:SFG 8B/G[N#G: MHKW/3OA+\0/"_P"T)\*_$]C\+OAW\$S#?FQOU\/^)(8SK5DZXDM_LRPQ"9UX M92,L"![8^AX/V*?AQ_PHRR^%=ZFJ:GH5A>R:E8ZA<72IJ%GG!S2_#W]CCPMX)\?Z=XTU?Q1XR^(WB/2HFBTN[\:ZQ]N&G!AAC"BHBA MB.-Q!/O0!X7^R7\ /A_\3O'O[0VL^,O"NE^*[O\ X3K4-.@&LVRW26T/RLWE M*X(C9BW++AC@<\5X?J>AV%W_ ,$UM8M+RTAOT\.>/I=-TI[N,2O:6XU.-?+C M9@2H*D@X/(XK]'?A/\$]#^#EUXQGT6ZU"Z?Q3K[UNY\.ZYJD^L37+W4:W<%Q),)MT3I&% 5U&W* MGWS0![+X:T'3/#.A6>F:/IUII6FP1@0V=C L,,8/)"HH '))X'>OCOX-?#SP MO\>_VK?V@-7^).BV'B[4O#6IVVB:/IFN6Z74%A8F$L&CAD!4&0Y.[&>O/)KZ MP^&O@8_#?P5IOAP^(-<\4BQ5E&J^([I;F^F!8L/,D55#8S@<= *\V^)_[(_A M7XC^/'\;V'B#Q7\/_%\]NMI>:QX,U7[#-?0K]U)P4=7QV.W/ YX& #Y$U'PA MHGAC2OVS/AKI=A;7G@#PWI<>L:/IUQ&)X-(OIK.1I5M]V?+(/("XV]L5]E_L MC^&-'\-_LY_#TZ1I-CI1O="L;JZ-E;)#Y\S6Z;I'V@;G/=CDFH?#?[)G@3PE M\(/%?P]TQ=3BLO%44Z:SK$UWY^IWLDRE7FDGD5MTF#QE=H_N]:])\">#[+X> M^"M"\,:=+/-8:-8PV%O)=,K2M'&@12Y4 %L 9P /84 ?+>D/'X9_X*A:_P#V MN1&WB/P) NBR2\"0PS#SHT/K\K,0.U?1OQ?^,'ACX%^!;SQ=XOO6L=&M9(XF M>.,RR,\CA%5$7ECD]!S@'TKG_CS^S=X1_:%TW2X]?;4=+UC2)CH?\ !2[X:74._P J?X>WDJ>8A1MK3DC* MGD'GH>17U%X\_P"1&\1?]@ZY_P#135Y)\:_V0M#^-7Q)TCQV_C?QOX)\1Z9I MS:7!=>$-3BLF,#.78,S0NW)/."!@#BI?AU^RO_P@&JWUW<_%WXH>,[>\L9K! M].\5:_'>6JK(,&14$"X<#H<\9/!H Y;_ ()K?\F6_#K_ *XW/_I5+7G=E,GB M;]N[X^ZII#"73='^'\6DZE/%RGVP@NJ$C^(*"/;::ZSPQ_P3KT?P7H%OH.A? M&_XT:1H5N&6+3+#Q1#;VZ*Q+,%6.V7 ))/&.IKV?X6?LZ>"?@S\/M2\(>%K& M>SLM3$K:A?33F:\O)9%*O-+*^2SX/?@=A0!\,?"WX3Z]%^QA\%OC;\.8-WQ' M\"6=Q,UK&,?VQIGVF8W%F^/O?+N9??..2*]1_8S^*NA_&[]KCXS^-?#LWFZ7 MJWA_0IE5OOQ/Y3!XG'9D8,I]Q7U7\%?A%H_P)^&&A^!-!N;Z\TC1XGB@FU)T M>=PSLYWE$13RQZ*.,5R'P9_9-\#? 7XC^.?&/A$7]I=>+Y$DO-.DEC-G;LK, MW[A!&&0%G8D%F'/&!Q0!YA^TQI-CH?[2?[*EGIME;Z?9Q^(-4*6]K$L4:YM M3A5 R23^-9?[76DWGQI_:4^%/PHT:[3PEK-K:7/BE?&L&_^T+".-O+,5IM= M06?&&W[EQ@XXKZ*^(/P4T/XD>// 'BW4[K4(-1\%WD][I\5I(BPRO+'Y;"8, MC%@!TVE3GN:Q?CE^S?H'QON]"U>75=8\*>+M =WTGQ-X>N1!>VH<8=,LK*\; M=T8'/MDT ?/OPE\*:G^SK^V['X;\2:Y-\2;_ .(&@S7%IXLU?/\ :EDMJ&Q$^;KG%?:6IZG::+IUUJ&H7,5E8VL333W,[A(XD499F8\ DDU MX_\ "']ES2?AEXWO?'&L>)_$'Q"\=75J+'^WO$LZ.]M;9R88(XT5(E)Y.!DG MOR:B\4?LHZ3XR^#WBWX)=3DU&ZOKG58YKV%7=&-K#(\+*EN"@ M CVG +<\T >-ZO>ZS_P4*\06FFZ5;W&B?L[Z3?I<7NKW"&.X\630OE8K=3RM ML&'+G[Q''(P/M"*)((DCC4)&@"JJC '05\MZ/\ L#P^'].L]/TWX^_&ZQT^ MSC6&WM+?Q3#'%%&HPJ*HM0 H Q@5]0V=O]DM((/-DG\I%3S9FW.^!CY/ACXM\)^'](7X@:BMS!K^E2W4KS9'S*R. %VX&, M=0:](\3?!#QS\&?!?Q@^.'BOQP/&WQ9;PG<66GW.GZ>+*UTJW12^V",$DG<- MVXX/'3DD_1?P@^!>@_!6Z\9W&AW>HW3^*M;FUZ]&H2QN(YY<;EBV(N$XX#;C M[FN_OK*WU*RN+2[ACN;6XC:*6&50R2(PPRD'J""1B@#X>\.?LJ_!W4/V#XM: MN?#^E3ZQ<^%3K\WC"2-3J0OC;F_&_P %?L]_ M$9=+\)_%CQ%IWA-_MWP]\8WJ1O>J[!1?Q+)E#(0J@O(,#(ZD\?0+?\$\OA[] MEET6/Q1X]@\!2SF=_ D7B)UT4Y;<8_*V^8$+<[?,Q7=_%+]E#P;\3+GPUJ%O M>:WX%UWPW;&QTK6O!U]]@N[:U( ^S@[64Q\?=93CG'4Y /EWP%KO@ZR^'G[3 M'AJP^&VL?!WQP_AJ?4]8\'7%Q'+IL:FVD19[/R@$"L?O;0 >,=.,6_\ !GA_ M7_"_[";:IH6FZDUZ\%I=&[LXY3/ ++<(GW [D#$G:' M/'-@^J^(_$&L>-+)M/UGQ/KNHB[U2: QE%19&38H4,< )C.,@X%0^,_V./!_ MC/X7> ?!3:YXGT9? QA;0]>T;4$MM3MVCC\L-YHC*Y*]<(/;% 'C&@?#+3/B ME^TO^UEX&NX8XM.U;0-&L%15 6'-JXC*@<#:0I'IM%>=Z?X]U+]H7X2_ _X" M:DSGQ$^O2:;XRB)^9+/1W!EW_P#73$'/? /1/AQ\1/%'C6TU76-3U MOQ):6-G?OJ<\W>O\A'W4F!1T<#L2N>!SP,=-\$/@!X4^ .B:A8 M^&UOKN\U2Y-[J>L:O=-=7^HSG_EI/*WWC[ #)XY- 'I-%%% !1110 4444 M%%%% !1110 44F:,T +129HS0 M%)FC- "T4F:,T +7BGAW]KCP)XF_:'U?X M-6@U)?$^FQR,UY+ @L9Y(T1Y8(I Y9I$60%E*#&#S7=_%_XCV'PA^%_BCQGJ M;!;/1-/EO&!XWLJG8@]V;:H]S7Y.Q?&OX:^"_@'\/OB!IOCS3=0^-^D>+'\8 M:K81B037/VN3;=VNXKM.(O+&,X^0XH _9*O/_$_QKT/PG\7?!OPYO+74)-<\ M56]W2NGF"VLFD1QE68J2.551@$9! /M&BO@ M+]FOXX0I^UKIW@;P7\6O%?Q5^'FMZ!+XI'EM;N%@08+B2&(R(5/.T%1 MGJ3BJG[/?@KXG?M!?!OQ;XJU?XX^-M"GTO6-6M=$M]&NT1%\F5R&NF=&><;O ME";E544 =:SI'C: M[%S?I/%$7B>TE2%0 Q4AD8@ 'C/& #Z?HK\K/#_[1&I>/?A\_CO5/C7\4]&^ M)E[$]]8:-H7AFY?PY:'DPVQA%JRSIC:#)OYSGG'/M,GQZ^(G[1,WP(\ 6.IZ MA\+]4\8Z-=:WXHU"P@\J^ACMB8VAM_-4^49)%)W8) *]><@'U5J_QKT/1?C7 MH'POGM=0;Q!K6EW&K6]Q'&AM5AA8*RNQ<,&)/ "D>XK4^*WQ)TSX/?#CQ#XU MUJ"[N=*T.T>]N8K%%>=T7J$#,JD_5A]:^/\ P[\,O$7PN_X*'_#[3M5\;ZQX MYT>3PCJ;Z9=^(6CEO[<;U\R*29%7S1N(96(R Q':O=_VZ#_QB!\6O^P!4TNQW,@_P!C M/5;;X"_$#7?"6H2BR\-^)_!VF>/=.9^$1UM4COP/^!*KGVKS/X,:9=:I^UI\ M#OB1JD31ZO\ $2X\2>(6#CYH[5HA':1_00HA'^\: /T[KS_XT_&O0_@5XI!)] :^2/BYXUTB#XD^+[?XH?M M2:KX-U-+UXM!\)_#.[=FLK8 >6+J..V>22 #1X?UZVDTNSAO#K5S9;--N1(?]7#-N^>1?XEP,>M=;7Q+\3_VB/$7P@^/ M?[1.IG4+O4=(\+>!M/U'3=%N)F:TCNY&*AQ'G W,R[B,$BN6^+7PU^,?@?\ M9/UCXL6_QW\7W'CA]$&JZE8/-$NE"*5 SQVT2H&@>-6RLBMG*],'@ _0.BOA M7Q;K?Q%\??'GX$^"=&^(FM^%-,\0_#XW^M75A('GD*A&>2,2!D$['"^:58J& M8CFNO^#.I^-?A5^U1XT^$5UXYU?QYX?/A6+Q'I-SXMG6:ZM)S*8FC>=$!:,G MGIP ,#KD ^NZ*_,+XB?%2ST/P9XBU35OVMO$.I_&FSBN+J+1O @13(6: M.W$$=J08P %9Y&7')/0Y]'\=_%;XE?%";]DN/0?&=WX.U#Q[IUR^LW6G*"C? MZ)&\CB)OD+CYRFX$*S XXH ^]JY+X>?%/PW\5(-;G\-7QU"WT?4YM'NY?*:- M1!C /.#@5G_\ !-;X=CP_8_%#5_\ A)O$>I>5XQU7 M2OL.HZAYMJ^R5#]I:/:,SMT:3/([4 ?4_P 7/BWX9^!_@/4/%_BV]:RT>SVJ M?*C,DLLC':D4:#EG8D #^0R:\)G_ &^;#PXMMJ7C7X1_$GP'X0N9$C7Q+K6C MH+6#>0%:X5)&>)3D_M:_!RU^.GPPM_#(\36_A37DU.VU'0[^YVLOV^ M%BT2E"1O!R05&3SG!Q@^#_$+XN?'WX=^"-6L/CK\%/#_ ,2_AV;+/B3J'QG^)?PK^$/PF\5W7@3P%J/A0>)KO6M%1 M5OC8*1%;VUNT@;RCP,M@D?@0;VAZOXS_ &=OVE=!^%VJ>.-:^(?@CQKHU]=: M=/XF=)]2TV[MDW.IG55\R-E[,.#]#D ]7\*?M4Z!XX^&/A7QUH7A;Q;JNE>( M=7_L>&WL].2:YM6\UXFGN%24JD*M&27#' (X[5[57YE?#'QIKW@O]BGX R:# MK%[H\E_\28[&[:RG:(SV[W]SOB?!^9&P,@\&O<;+_A,_VJ_C_P#%/2(_B1XE M^'O@GP#>0Z/9V?A*:.VN;R\:/?)-/*\;ED!X"8P>/?(!]"?#7XUZ'\4_%'CO M0=)M=0@O/!NJ#2=0>\C18Y)B@?=$5=BRX/5@I]JYCXP?M+M\(?$RZ/\ \*H^ M)GC1#;+V:Y)&PR&5,.-N2,< BO'OV -$U[PWX]_:*TSQ-JPU[7+ M;Q=''<:IY*Q&[_T==LI1>%9EVD@<9)KZ^U,_\2V[_P"N3_R- 'R[\/O^"A.B M_%&"PN_#?P9^,&IZ5>7/V5-5@\-0R6B,'V,6D2Y( 4YW>F#7U97R=_P3!/\ MQB1HO_85U/\ ]*I*V/V)?&^O^,_AW\2;O7M9OM8N;+QKK-G;37L[2M#!&ZB. M-23PJ]@.!0!],T5^9R?&/XGWW[%OPAUC2O'&JV_C#6/B&-*;6+FX>9WC:ZN( MU27)_>1@!?D;@A0*[_X@>$OBC\)_VBOAKX T#XX^+]2TWXB6U[#JMWKYM[N> MR:W597ELAY02%F4E5&U@N^(WAK M0/ H\8Z;_P )3.MQ>0SB0QF$S*JDHQP<8&.W'T7RO.6T-IY?*[,*7W9SS0!]R45^?>N_%[QS^T=X[_9E@ MT+QCK/P^T_QYX -6D3XL67Q@T6+4772M:0 7\-L0"L-Z J_O1UR5!(/TKWS- "T4 MF:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T M+129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- M "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129H MS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F M:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M% M)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T + M129HS0 M%)FC- "T4F:* %HHHH **** "BBB@ HHHH \+_:T^"'B7]H7PGX: M\'Z7?Z=8>&9-^'O$?AG4 M- N])LVTV^M)+*6)8%'[IT*$#CT-='10!\1>$?V*?B;X7^%_@&WM_%^@VOQ$ M^&FJW;^%=5/G7-I=:9-Q]DO%*(RY4E3LW;0!@GMU/A[X!?'#Q/\ M-^ _BK\ M1]?\%FQ\.VE]9?V%X:^U!(%FBVB2-IDS([,?FW% H5<;N:^M** /D_XY?L8Z ME\5/VF/"OCJQU:QL_!SM:2^+-(F9Q+J,ED[26A10A5N6"MN9>%&,UO\ [2'[ M/'C'QW\6_A]\3? EWX:N=>\*0W-K_8OC&.9M/G28?ZQ6B5FCE7L0I[>G/TC1 M0!\I>&?V>OC!J'[4?A#XO^./$7A.\2PTJ\TFYT31$N(8K**09C\AI%8SL7)+ MLYCP,8'%=O\ LP_ C7_@K\%];\(ZY>:;=:E?:KJ=]'+I\LCPA+F1FC#%T4[@ M",X!'H37NU% 'QMH/[$GBO2?V=/A;X?MO$NEZ/\ %+X=ZC-JNDZO;K)\D MDLC-#(&5',;HX5B%!!'&>_6Z3\!_BM\5?'MIKOQL\0>'(M#TW3KNPM?#'@>2 M[%K=M?:6PA(5,$ X.>.?IRB@#XY\+_ /]I7X4> '^&'@CQWX'E\% M0*]KI?B/5[>[76]-M6)PJQQ@PR.@)"L6'0>P'7?$;]ESQ;+#\,O%'@GQN)OB MCX$MWM$UCQ6KW$.M0RJ!/'=E#O4,>05R5SCT(^F** /E'P'\ OC1J/[4OA_X MN_$G7_"$]OI^BW>DC1?#?VE8[02%2AC,J9D+'<79BN,* ".GLO[2/PVU/XP_ M CQQX*T:>TMM5US3);*VFOW9($=AP7*JS ?13]*])HH ^/?VA?V,?%GQ5^&/ MPGTOPWX@TS0?%7A?3ET+5+^2241W&G36JP7D<;+&68G;E0P4 MHW7[0'P7\7:%-IMGX5\":9>Z;-9RR.MPRRPK%$(E"%2!MYW,OMFO?Z* /CKX M;?LV_&_X$ZGXSTGP'K/P\F\/^(M8N=47Q'KEK=OK5MYYR5:- (YRG\.Z0#/4 M8.*P=%_8;\?:1^SE8?#B77]!U#4K#X@Q>*$U.6>9%N+-9Q*V\"$E9SS\@RN3 M]^ON.B@#Y5^*'[/5D_Q$^.?CWQ]J=E:_#7Q/X-@TFX:V\Z2\M! &,DS1K&1A M>&7:6.5Y KYX_:!@^,NE_L.ZE8:E\2/ .K_#(:5!;Z9KVE07/]L:[ 2BVUNR M/B)&8;0Q4LV%(QU-?I9=6L-]:S6US#'<6\R&.2&50R.I&"K \$$<8->)>'OV M'_@5X5\66_B32_AMI-OJMO-]H@+&62""3.=\<#.8D(/(*J,=L4 <[X0^ ?B- M_C+\'/B$\]A!I'ASP(=!O;.62079N'2,@JNS:5&""2P/L:N>+_V:M:\8?M%> M+_&DNJVECX;U[P&_A,&WED^WPSO*S&4+LV;0K<'?G(Z=Z^B** /B/PQ^RU\? M-$^ MS\%K?7OAMH/A,V$VG'Q!I5E=MJ=W$P8?O(F"Q([YVO)N<@$D FNL\)? MLJ^--)NOV99[^_T+=\,;.ZM=8%OF@:#H-_I=U;22.+IY9R"A10A4J,L);8W"ZM%<3R*3'*I7RO+"@\ABNV\8D:RO(L[&*$C>"?$OC+X7Z/X>U&!K+4/$&AV-])JLMNPVR;89,0J[*2"0< M#/&*^NJ* /ESQE^R'K'A*^^&OB;X,:YI^A>+/ VD?\(_#;^(HI);'5-/(&8K M@Q_.K;LL&4'D].E7? /[/?Q"\1?&5/BK\7M<\/W7B#3-+FTG0="\+1SC3[!9 M?];,TDP$DDC#C[H 'X8^EJ* /B[1OV+?&^G?L[?"?P%)JF@-K'A/QI%XCOIU MN)_L\ELMS-*4B;R=QDVR*,,JC(/S=Z[7Q+\!?BG\._C+XL\>_!?6O"@M_&(A MDUS0/&,=R+=;J-=BW,$EN"VXKU0C!YYY&/IRB@#YU_9&^ /CGX*:E\3=3\>^ M(=+\2ZMXNUI-7%YIBR1C/E!75HV4; &R% +?*!D@\5]"7D)N+2>)2 SHR@GI MDC%344 >(_LO@;I_@SQ'=Z=>ZI;WMY:W:W3ZKI+W&/.$,:8BE MQ_#O8<@9':OKNB@#XJ\/?L2^-=#_ &>/A3\/VUC0Y]4\(^-X_$=W=-<3>5-: MIGQ:-X/74EOX+B21; MB7[1"$C\I0A4X(YW,O'3->V44 ?/7B;]F2Y\;_M#>.?%>MSV,W@OQ-X%'A.6 MTBE<7@D,Q=WVE-@7:>#N)S_#7G5K^SS^TEIOPL;X/VGC[P.? 8M3I,7BB6SN M_P"W8]/(V^7Y(_<%Q'\@;?T]^:^RJ* /FRP_90N/"/Q>^!FK^&KFRB\'_#O0 MK[1Y8+N5_MDQEB"(Z (4;)!+$LO7@&MOXK> ?C7:_$X>+OA?XLT&[TR[L%L; M[PCXU:Y&GHZG(N('@#,CD<,"N#^/'O%% '@7[+/[/&M?!K4?'_B?Q3>Z)+XI M\;:A#?7MCX9M6M],LA$C*B0J_P S$[V+.P!)/3N??:** "BBB@ HHHH **** M "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH M**** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ H MHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BB MB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** M "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HI,T9 MH 6BDS1F@!:*3-&: %HI,T9H 6BDS1F@!:*3-&: %HI,T9H 6BDS1F@!:*3- M&: %HI,T9H 6BDS1F@!:*3-&: %HI,T9H 6BDS1F@!:*3-&: %HI,T9H 6BD MS1F@!:*3-&: %HI,T9H 6BDS1F@!:*3-&: %HI,T9H 6BDS1F@!:*3-&: %H MI,T9H 6BDS1F@!:*3-&: %HI,T9H 6BDS1F@!:*3-&: %HI,T9H 6BDS1F@! M:*3-&: %HI,T9H 6BDS1F@!:*3-&: %HI,T9H 6BDS1F@!:*3-&: %HI,T9H M 6BDS1F@!:*3-&: %HI,T9H 6BDS1F@!:*3-&: %HI,T9H 6BDS1F@!:*3-& M: %HI,T9H 6BDS1F@!:*3-&: %HI,T9H 6BDS1F@!:*3-&: %HI,T9H 6BDS M1F@!:*3-&: %HI,T9H 6BDS1F@!:*3-&: %HI,T9H 6BDS1F@!:*3-&: %HI M,T9H 6BDS1F@!:*3-&: %HI,T9H 6BDS1F@!:*3-&: %HI,T9H 6BDS1F@!: M*3-&: %HI,T9H 6BDS1F@!:*3-&: %HI,T9H 6BDS1F@!:*3-&: %HI,T9H M6BDS1F@!:*3-&: %HI,T9H 6BDS1F@!:*3-% !12T4 )12T4 )12T4 )12T4 M )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 M )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 M )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 M )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 M )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 M )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 M )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 M )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 M )FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC M-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% M!FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC- M%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% ! MFC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-% M% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !F MC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% M !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC M-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% M!FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FBBB@ HI:* $HI:* M$HI:* $HI:* $HI:* $HI:* $HI:* $HI:* $HI:* $HI:* $HI:* $HI:* M$HI:* $HI:* $HI:* $HI:* $HI:* $HI:* $HI:* $HI:* $HI:* $HI:* M$HI:* $HI:* $HI:* $HI:* $HI:* $HI:* $HI:* $HI:* $HI:* $HI:* M$HI:* $HI:* $HI:* $HI:* $HI:* $HI:* $HI:* $HI:* $HI:* $HI:* M$HI:* $HI:* $HI:* $HI:* $HI:* $HI:* $HI:* $HI:* $HI:* $HI:* M$HI:* $HI:* $HI:* $HI:* $HI:* $HI:* $HI:* $HI:* $HI:* $HI:* M$HI:* $HI:* $HI:* $HI:* $HI:* $HI:* $HI:* $HI:* $HI:* $HI:* M$HI:* $HI:* $HI:* $HI:* $HI:* $HI:* $HI:* $HI:* $HI:* $HI:* M$HI:* $HI:* "BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH M6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH M6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH M6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH M6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH M6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH M6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH M6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH M6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BBB@ HHHH **** "BBB@ HH MHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB M@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** M"BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH * M*** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HH MHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB M@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** M"BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH * M*** "BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6B MDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6B MDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6B MDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6B MDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6B MDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6B MDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6B MDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6B MDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BBB@ HHHH **** "BBB@ HHHH **** M"BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH * M*** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HH MHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB M@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** M"BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH * M*** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HH MHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BDH MH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDH MH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDH MH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDH MH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDH MH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDH MH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDH MH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDH MH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDH MH 6BDHH 6BDHH 6BDHH 6BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HH MHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB M@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** M"BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH * M*** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HH MHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB M@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** M"BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** $S1FEHH 3-&: M6B@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* $S1 MFEHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B@!, MT9I:* $S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* $S1FEHH M3-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* M $S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6 MB@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* $S1F MEHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T M9I:* $S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3 M-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* M$S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B M@!,T9I:* $S1FEHH 3-&:6B@!,T4M% !1110 4444 %%%% !1110 4444 %% M%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 444 M4 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 M 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% ! M1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %% M%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 444 M4 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 M 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% &3XDUJZT2Q26STB[U MJXDD$:VUH44C()W,SL J\=<]Q6?X-\;)XKDU&UET^YTC5-.D6.ZL;HJS)N&5 M(920RD=P:L>,_&-CX)TU:5;B\2TE5TMU VQQ+@]%'&>YS3 [FBBBD 4444 )FC-+10 F:,TM% M"9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+1 M0 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9HS2 MT4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 F:, MTM% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 )F MC-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% " M9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 M F:,TM% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9HS2T M4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 F:,T MM% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC M-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9 MHS2T4 9^L:!I?B*W2#5=-M-3@1MZQ7D"RJK=,@,",^]0Z-X3T/PY)*^DZ-I^ MEO* LC65JD)<#H"5 S6M10 F:,TM% "9HI:* "BF[J-U #J*;NHW4 .HINZC M=0 ZBF[J-U #J*;NHW4 .HINZC=0 ZBF[J-U #J*;NHW4 .HINZC=0 ZBF[J M-U #J*;NHW4 .HINZC=0 ZBF[J-U #J*;NHW4 .HINZC=0 ZBF[J-U #J*;N MHW4 .HINZC=0 ZBF[J-U #J*;NHW4 .HINZC=0 ZBF[J-U #J*;NHW4 .HIN MZC=0 ZBF[J-U #J*;NHW4 .HINZC=0 ZBF[J-U #J*;NHW4 .HINZC=0 ZBF M[J-U #J*;NHW4 .HINZC=0 ZBF[J-U #J*;NHW4 .HINZC=0 ZBF[J-U #J* M;NHW4 .HINZC=0 ZBF[J-U #J*;NHW4 .HINZC=0 ZBF[J-U #J*;NHW4 .H MINZC=0 ZBF[J-U #J*;NHW4 .HINZC=0 ZBF[J-U #J*;NHW4 .HINZC=0 Z MBF[J-U #J*;NHW4 .HINZC=0 ZBF[J-U #J*;NHW4 .HINZC=0 ZBF[J-U # MJ*;NHW4 .HINZC=0 ZBF[J-U #J*;NHW4 .HINZC=0 ZBF[J-U #J*;NHW4 M.HINZC=0 ZBF[J-U #J*;NHW4 .HINZC=0 ZBF[J-U #J*;NHW4 .HINZC=0 M ZBF[J-U #J*;NHW4 .HINZC=0 ZBF[J-U #J*;NHW4 .HINZC=0 ZBF[J-U M #J*;NHW4 .HINZC=0 ZN?\ $GC#3_"AA.I3RPK/YAC,=K+-GRT+MG8IP0JL M0#UQQD\5O;JPM;\+:;X@NX;B^@>26V618F29XRH==K?=(SD<<].V.: .;'QQ M\(^1;3?VK*T=PRK$5L+@F0E'88 CR>(Y.G>-QU4@3/\ &CPE&;@/K.PVT+W$ MP>UF!2-1DL7J#A(6&AXB)BI*3E)66EYB9FJ*CI*6FIZBIJK*SM+6VM[BYNL+#Q,7& MQ\C)RM+3U-76U]C9VN'BX^3EYN?HZ>KQ\O/T]?;W^/GZ_\0 'P$ P$! 0$! M 0$! 0 $" P0%!@<("0H+_\0 M1$ @$"! 0#! <%! 0 0)W $" M Q$$!2$Q!A)!40=A<1,B,H$(%$*1H;'!"2,S4O 58G+1"A8D-.$E\1<8&1HF M)R@I*C4V-S@Y.D-$149'2$E*4U155E=865IC9&5F9VAI:G-T=79W>'EZ@H.$ MA8:'B(F*DI.4E9:7F)F:HJ.DI::GJ*FJLK.TM;:WN+FZPL/$Q<;'R,G*TM/4 MU=;7V-G:XN/DY>;GZ.GJ\O/T]?;W^/GZ_]H # ,! (1 Q$ /P#]4Z*3CTHX M]* %HI./2CCTH 6BDX]*./2@!:*3CTHX]* %HI./2CCTH 6BDX]*./2@!:*3 MCTHX]* %HI./2CCTH 6BDX]*./2@!:*3CTHX]* %HI./2CCTH 6BDX]*./2@ M!:*3CTHX]* %HI./2CCTH 6BDX]*./2@!:*3CTHX]* %HI./2CCTH 6BDX]* M./2@!:*3CTHX]* %HI./2CCTH 6BDX]*./2@!:*3CTHX]* %HI./2CCTH 6B MDX]*./2@!:*3CTHX]* %HI./2CCTH 6BDX]*./2@!:*3CTHX]* %HI./2CCT MH 6BDX]*./2@!:*3CTHX]* %HI./2CCTH 6BDX]*./2@!:*3CTHX]* %HI./ M2CCTH 6BDX]*./2@!:*3CTHX]* %HI./2CCTH 6BDX]*./2@!:*3CTHX]* % MHI./2CCTH 6BDX]*./2@!:*3CTHX]* %HI./2CCTH 6BDX]*./2@!:*3CTHX M]* %HI./2CCTH 6BDX]*./2@!:*3CTHX]* %HI./2CCTH 6BDX]*./2@!:*3 MCTHX]* %HI./2CCTH 6BDX]*./2@!:*3CTHX]* %HI./2CCTH 6BDX]*./2@ M!:*3CTHX]* %HI./2CCTH 6BDX]*./2@!:*3CTHX]* %HI./2CCTH 6BDX]* M./2@!:*3CTHX]* %HI./2CCTH 6BDX]*.* %HIF?I36;GB@"6BH=QHW&E<1- M14.XT;C1<":BH=QHW&BX$U%0[C1N- $U%0[C1N-%P)J*AW&@.0:!DU%1@YYI MR]*8#J*3CTHX]* %HI./2CCTH 6BDX]*./2@!:*3CTHX]* %HI./2CCTH 6B MDX]*./2@!:*3CTHX]* %HI./2CCTH 6BDX]*./2@!:*3CTHH **6B@!**6B@ M!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@ M!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@ M!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@ M!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@ M!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@ M!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@ M!**6B@!**6B@!**6B@!*1\[#@_ARX_\"%_PKYO\2_\ (R:K_P!?Q_Z%RY_\"!_A1_PV-8_]"Y<_^! _PKQ3 M0?@QXN\3Z)#J^GZ4TUA,I:-_,4%@"0>"?4'%<5)&T+M&XPRDJP]"#@U<\TS& MFE*;LGY(N>;9G2BI3T3VNEJ?4'_#8]C_ -"Y<_\ @0/\*/\ AL:Q_P"AM=QJWP6\7Z'H4NKWNDM'8Q1B5Y!(I*K@;9E63=/6V^B/:O^&QK'_H7+G_P(7_"C_AL:Q_Z%RY_\"%_PKY= MJ]HNAW_B*_CLM-LYKZZ?I%"A8G_#ZFLXYQCI/EC*_HD9+.L?)VC*_P D?2G_ M V-8_\ 0N7/_@0O^%'_ V/8_\ 0N7/_@0/\*\Q3]F?QX]J)O[.A4[<^6;E M-_TQ7GVO^&]4\+7S66K6,]AH/0CZ9K>KF&:45S5$TO-(Z*N99M0 MCS5%9>:1]'_\-CV/_0N7/_@0/\*/^&QK'_H7+G_P('^%>%>#_A7XE\=V,MWH MUA]K@CD\IF\Q5PV >Y]ZV+K]GSQ[:0M*VA22*HR5BE1C^6[FJCC\TFN:-VO1 M%PS#-IQYHIM>B/7?^&QK'_H7+G_P(7_"E'[8EDQ 'AVY&3C/VA?\*^9+RQN= M-NI;:[@DMKF)MKQ2J593[@U''_K%^HKF_MC&J5G+\$221@D:*69B M< =37Z-!WBF^Q^FQ=TCP3]IG]MSX.2:WM])M5F=40 M@%GW.H ); ZYP?2O5_AM\1]%^+'@+1/&'AZ9[C1M8M4NK=W7#A6'W6 )PP.0 M1D\@U^,'Q$\/:_\ \%'?VQ?B"WA^>0Z/HNGW0TZ0+N40VR,MN@]YIB#_ ,#/ MI7TU_P $$O$WPDU69DU#0I6U'3X9>&%O(X69 #S\DI!Q_TUK0H^Q_ MVF?VK_!?[*/A_1]8\:0:M/::K=-:0#2K9)F#JFX[@SK@8]S76_!KXS^%OCU\ M/M.\9>$;QKS1[T$*)5V2Q.IPTHS^E?"?_ 6VR/A)\.,?]!R;_P!) MS7RM^Q+^T/XD_8G^*6E:1XTMYK?P#XQM;:[FW@LD<#O%UMKLVK:O:1WENVF6D?\ P5NU M"VU;]JGX5WUG.EU:7'AVREAGB8,DB&^N"K CJ""#FM3_ (+80&X^+_PRA3&^ M31YD&3@9-QB@#]8/!OC71_'_ (7TKQ%H-XFH:/JENEU:W,?1XV&0?8^H['BO M$_$?[=7PY\+_ +24'P0O+;76\937=K9K+%:1FSWSQ)+'F3S V-LBY^7@YZU\ M#?\ !._]I[6OV8_B?=_ OXH;]*TBYNREE)>-A;"Z;H-QX\J7((/3)![FJ_QC M._\ X+0Z0WKKVAG_ ,D+:@#] M7_ &Z?ASHG[1UM\$[BVUT^,9[N*S25+2,V MF^1 ZYD\S=C!Y^6OHKR$G'_3,>M 'UC^S/ M^VU\.?VK;S6[/P8=5@O-)CCEGM]6MDA=D:;\+O M /B'Q?K"7#Z5H=C-J%TMJ@>4Q1H6;8I(!. < D5^+OPWT?6_^"O413IG_MF#WK]7_VR'63]DGXNLC!D;PKJ!# Y M!'V=Z %_9F_:M\%_M7^'M8UGP7!JL-II5TMG.-5MTA)Q:I=&W?TNS\APV&>*Q:I=+Z^ESUW4_'>F_#GQ7X/\%Q( MB6EQ$8F8GF/ VQ?FP/Z5\X_M$^"O^$0^(5S-#'LL=3!NHL= Q)#C_OKG_@0K MJ-,\.0_'KQ[XCUV;7TTA;6>-;5BJL#&,[2,D?W0?QKT_]H#P6/%_PS^U6\J7 MVHZ2HF$\//F "0<9ZCG'L*^EQ$)X[#5?=TB_=].I]9BH5,PPU7W=(N\/1:- M'SW\!_!?_"9_$:PBE3?969^V7 (ZJN"%/U8@?3-?3]E\0]-\8>/O$G@>:..2 MW@M0@SSYC6'CN7Q.EGJ#W4DLEM(J_/EB&R2P/.3V[U&!C4PU.G3@M9OFE_AV M2(P$)X6E3IP6LWS27]WL>)>-_"\W@SQ7J>BW&XO:S%59NKIU5OQ!!_&OICPE M;Z=\ /@W'X@GM4GUB_1'8G 9Y'&4CW=@!U_&N>_:R\%+(--\56BAD;%K=.G( M(ZQM_P"A#/N*Z+XCZ9+\5?@'H]SHJ_:);9(;DV\9R24C*2(,=QN/Y5E0PSPE M?$J:G^U7XCTB2*/4/",5HTL8E1)VD3: MVN5GDDC$D95LB(8(!'K7%_#_ .)GQ2U7QEIMM*MW?6LEPBSQW%GM01EAN.[: M,8&3GVKV;X5?%FY^(7@[5]:FT^*SDL6=5BB8L&VH&Y)^M$:[BNEOM>I MP'[7FGVEOXJT6XB1$O+BU83A0 6"L-I/_CWY5X/%_K$^HKTG]H31-9T?XBWT MFKSO>1W7[RTN'&!Y70(!VVGC]>]>:Q\/?\ ("T[_KVC_P#017S7_P %'?CN?@7^S-XAFL[GR-=\0@Z)IVTX=6E1 MO,<=QMC#D'L2M?2GAX_\2+3O^O:/_P!!%?.W[6_[#6D_M>ZUX?N]?\8ZMHUA MHT3I#IUC!$T;.[ NY+#.2 H_"OU&G\*]$?K$=D?E_P#LH6G[5'P<\.W7B#X3 M_#V]N=,\3QQ3'4GTA+D7$2%MFQF/"Y9CP.:PO 'B_P")'[)O[7?ASQ[\1/#E MYX1N]7U!KK4K22V^S)<6D\FVX*(IQCYF8#ID"OWD\*>&+#P9X;TO0M,B\C3M M-M8K.VB'1(XT"J/R%>(_M=_L8^%_VOM%T*SUS5+W0KS1[AY8+^PC1Y"CKAXR M&&-I(4_5?>M2SY6_X+4ZA;ZG\%_AC=VLJS6\^L2RQ2(>'5K8D$>Q!%=1XR_9 M%L?VI?V!OADMC"D'C;1O#EO<:/=@ &5O+R;=V_NOV]&P?6O5?B[_ ,$_=(^, MWP+^'_PTUWQQK)MO!QQ;:HEO$9[A!&8T60$8^5,#(Z[:^@_A9\.[;X5_#CPY MX/L[N:^M-$L8K&*XG4!Y%1 M ?C_ /%B#X@/K&H^%]7)C>\CTV&-H[R1&R)&##AB 2.N!WZ[W[6?[!GAW]K M7Q?X:\0:SXGU30I]#MVMHH;&&-UE!DWY;<,]>.* /'O^"B/[%K?&SX4Z;\0O M"%B?^$ZT'3XVFAMU ?4;54!*\188TAC+'N=D:@GOBOZ![&Q2RTVWLPQ=(8EB#$K"PUJQP)H >2A!X=">=I_ BOC.Q_X(BV*:P6O/BK<2Z7D8BAT=4FQW M!$/ _[.NM_"3P9>7GABQUJW:"^UB$+->3EP%D=BPP2R@KT / %+^R/\ ML=>&/V0_#FM:;H.I7FM7.KW*W%S?WR*LC!5PB87C RQ_X$: /R9_:QL?VH_B MYHUIXI^+GP_O;+3O#<3XU1-(2V$$3LN0[+R5SCKTR:^WOAI\>A\=_P#@EKX^ MN+RY-QXAT/PKJ.D:GO;+EX[=O+.=(?2[V"YMXAY)* MLJS)@??578<\'//2@#Y[_P""//Q9\%?#OX4^/;7Q1XKT;P]<7&M120Q:G>QP M-(H@4%E#$9&>*_0[0?C_ /#3Q3K%KI.C^/?#NJ:G=/Y<%I::G#)+*V,X50V2 M< ]*^%3_ ,$2O 1_YJ/XCX];6W']*[WX$?\ !*3P=\"_BSX:\>Z=XYUS4[S1 M+@W$5K!?V9O NH/IESXI>*36[J M%B"89'(2)B.=@5'D<=P%'3- 'T%X\_X*,_L\?#K5Y=+U/XCV=W?1,4D32+6X MOT0CJ#)#&R<>F[->@?!G]J'X6?M!),/ /C/3]?N(5WRV0WP72+_>,,JK)M[; MMN/>N+^$7[ OP.^$?A:UTJ'X?Z'XDO$C"W&K>(K"*^N;A\?,Q,JL$!/\* > ME?.'[8?[ NH>$?$OA;XI?LS>'_[!\<:?J*"XT?1I$MK>13G$R*S*D8!&UU!" MLK2<=*U_#GB M+3O%V@:=K>CW27VE:C;I=6MS&"%EB=0RL,@'!!!YKXS_ ."FM[J^H_L W=UK M^GKI.N32Z6]_8K*LBV\YE3S$#J2K -D @D5[_P#LU:M9:#^RI\-]2U*[@L-/ MM/"MC-<75S((XHD6W0LS,> .230!Z_17QMXK_X*S_L\^&=8EL(-"ZML] M-\;@'!P<,,J?6@#U>BO(/^&I/!?_ T;_P *2VZE_P )G]C^W;OLR_9?+\KS M?]9NSG;VV]:[GXF?$+2OA/X U[QCK@G.D:+:/>70M4#R^6HR=JDC)]LB@#IJ M*X;X*?&/0/CW\-M)\<^&!=KHFI^9Y OHA%+\DC(VY02!RI[UX9\5/^"F_P ! M?A-XKN/#M[XCN];U*UD,5U_85FUS%;N#@JTF0K$=PA;'3KQ0![EXJ^.'@7P1 MX^\/^"=<\1VVG>*M?Q_9FF2(YDNLL5&TA2!R".2*3QY\'?#WBCQ M';:/K/B&7R-*M)D)?@;HWQH^$-I\3_#E_K'C M&[O@OA>[M?-\NUF\Z(!GV2H,;S&?F5NAXH ^H:*\B^+G[47@CX)?$#P7X0\4 M2WEOJ/BR1TL;B.)3;1;64,TTC,-BC<#G!XS7C'B#_@K!^SQH'B:31QXAU/4H MXI/+?4[#3))+0$'!(8X9@/55(/;- 'V)17._#_XA^'/BIX2T_P 3^$]7MM&_!6I^//&?B2>6TT M?2K",LGF(H+/+MRVT;@<*.>M?G;\,O#GQ4T;_ (*;?"_4?C'?17/C77+= M]3EM() Z6$30W"QVXQ\J[0GW5) SU)R: /V,KS'XI?M-?"OX*7L5EXW\=Z-X M>OY%#K97%QNN-IZ,8DRX4^I&*[OQ/?W.E>&]6O;.+S[NVM)9H8L9WNJ$JOXD M 5^8O_!,OX%> _VEK/XA?$[XI:=:^/?&T^MO!-;ZV//2V5D#[S$W!+%F + X M$>%QS0!^C?PT^,?@?XR:3)J7@CQ5I?B>SB(65].N5D:$GH'7[R$^C 5V5?EE M\1O >B_LD?\ !2?X46WPD0Z/9^+EBBUGPY9R$PK%)*T;_)D[4('F!>BE,C K M]3: "O'OB!^V#\%OA;KDFC>)_B3H.F:M$VV6R%SYTL+>DBQABA]FQ3_VL[GQ M_!^S]XOB^&&G7&I>-KJV%K8I:2(DL>]@KR*68 ,J%B.[^(_@2R\2>/M6@^U:O)XAB%R]O(Y)\E58E5V@@%AR3DYZ8 /K#X?? M%#PC\6-#&L>#?$FF>)M,W;&N-,N5F5&_NMM.5;V;!KJ*_+B7P1I_[&?_ 4V M\">'?AE++8>%O'-M&NI>'DF9XH5D:5" "2=JL@D7.2OS ''%?J/0!RGQ,^*? MA3X.>%9?$OC/6H- T.*1(7O;A69%=SA1A03R?:O'?^'B?[.7_15=)_[\W'_Q MNO/O^"N/_)F6M?\ 86L/_1M/_9@_8M^!WB_]G;X<:WK/PRT'4=6U#0K2XNKN M: EYI&C!9F.>I- '??\ #Q/]G+_HJND_]^;C_P"-U[]H.N6'B?1+#5]+N5O- M-OX$N;:X0$++$ZAE89YP00>:\2_X8)_9[_Z)-X<_\!S_ /%5T?QG^,WA+]DO MX6V6M:KHNJ#PEIYBT]5T.T6<628VQ[E+KM3@*#SR0.] 'K-%"( MM8U,>'F9;S6#:*FGDABJA)=^6+$,5^7D*3TH ]PHKY8'_!2OX'0>$]>U_4-: MO]*@TC4WT@VEW9_Z5=W"C+""-&8LH&,L< 9&2,BM/X&?\%#/@I^T!XFB\.>' M_$-QIWB"6K_ ,%*/@9/\5K7P!::[J&HZO7QYXDCT^\ MNE+VVF6\;7%W.HXW+&@)"YXW-A<\9S7FOPC_ ."F'P'^,7B:V\/V'B.ZT/5K MIQ%:Q:]:&U2=R =6\1VUEXPUI!)I^E.CF2X4E@"I"E?X&ZD=*X[]G_\ M;&^%/[3+7%OX&\2"ZU6VC\V?2;V%[:[1,XW;&'SKR,E"P&1G&:XGXN>)?@;8 M_MB_#72_%GAR_O?B[<6RG0-6A\WR+>/=+@/B55ZB3JC=1^ !]0T5R'Q1^+?@ M_P""OA2?Q+XVU^T\/:-"0IN+ICEV/1$0 L['!^503P>*^8])_P""MG[.^J:Z MFG/K>LZ?"[[!J-WI,@M^O4[=S@>Y7ZT ?9=%9>B>)]*\3>'K77='U"WU71[J M 7%O>V<@EBFC(R&5@<$5\U0?\%+_ (%_\*^N_%][KU[I5G#J$NF16-W9DWMU M-&JL_E1(6)0!U^&O#WB"YT_Q!UVP\,:)J&L:IO@S_@ES^R]\*/C!^S5/KOC3P)I'B/5UURZMQ>7L1:01JD15(HM)\$6'A36(;*:>SU73&>)X)40LI8;MK+D8(8 M'@G&#@UP/_!)#XPZOXC_ &9/$5AXAN9KZT\&W[V]K.Y+N+7RA*(P3U"G=@=@ M0.@% 'WS17R!<_\ !53X"6?@FQ\23ZKJT:WMU+;0Z9]@W7N(]NZ1D5R%3+8! M9@20< X->Y:)^TC\/-9^"]K\5G\01Z3X'N(3,NI:M$]K@!BN-C@,6+ @!0=W M\.(E\/^-?&<5CKFQ9'T^UM)[N6)2,@R")&"9'(#$$@@@5M^%/VK?A3X MV\0>&-"T?Q?;W&L^)K(:CI-A);3Q2W5N0Y#A70;1B-S\V#Q7Y,?!_P#:5^"# M_M=?%CXC_%#PQ=>+M"UZXD?0[>^TB*^:'?*"&>&1MJD1@*#SCD"OT+NM9_9X MTC]KSX>Z"G@VXL_BF^BQOH%Y90O!96EF89BL?EI*(UPGF#'EG&1^ ![WKOQR M\"^&?B7H_P /M4\1VUGXRUB,36&D.CF2=/FY!"[?X'ZD=*[NOSE_:._Y2U? MG_L%)_[=U]W_ !-^*GA+X-^$KKQ-XTUVT\/Z);X#W5TQ^9CT1% +.Q[*H)/I M0!U=%?&>D_\ !6S]G?5->33GUO6;"!GV#4KO29!;?4[>'_ !!I MGBO1++6-&O[;5-*O8EFMKRTE$D4R$9#*PX(H T*AO;VWTVTFNKN>*UM84,DL M\SA$C4#)9F/ '-/$O[4?[5OA?]E[PMJTVD>'5\NY\1W-N>9/D M\Y@P_B6.( A3P789Z# !](^+?^"EG[./@[5I-.NOB/;7MS&Q1VTJQNKR)?\ MMK%&R,/]UC7K/P?_ &A?AS\?-.FO? 'B[3_$D<&#-%;LR3P@]"\+A9$![%E& M:XWX>_L-_ KX<>&X-'LOACXI/[UU58I%#(R9P#M( H M_2"BL36?%NG>$O"SWTZK%;< L&?..#QP>>W6OD[4_^ M"MW[.^G:XVGIK>M7T"OL.HVVD2&W^HW8 /\ @J;^S]\0/%-OH,7B*_T2XN91#;W.LV#06\CDX \P%@F?5]H]ZM_\ M%#/VF/#/P2^"NL^'-5.I#6/&.C7]GI4MA )(UD\L*3(VX;1^\'(![T ;EC_P M44_9_P!4^(%IX,L/'BZCK=W=I80"STV[F@DG9@BHLJQ%#EB!N!*^]?2-?E-_ MP2T^(GP'N=)\)> +WP-!J'Q:N+NYOO[HKI?C#Q(3KS()/['TR!KJZ53T+A?ECSVWLI/;- 'O5%?.?P M'_X* ?!?]HC7X] \->(Y;+Q!+GR=*UFV:UFGQSB,G*.?]E6+>U=K^T%^TMX/ M_9HTC0M2\8C4/LVLZ@NFVQL(%E(E()!?++A<#K0!ZO17S!HO_!1_X(>)/B]: M_#G2=(O$4]_XAMR!LP-LFL-/AFOI8F[J_DHX1AZ,0:V/VQO%^N^ OV7_B3KWAII(];L M]'E:WFA^_#G"M(OH55F;/;;7RA_P3$_9T^"/C?X 6/BS4= T'QUXWO)YCK$F MMP1WTEG)YC!8Q%(&$>5 ;=C+;B+2/"'CZPN]8EXCT MZ\BELIY3Z(DZ)YA]DS7N=?#?[;/_ 3N\,?$3X?G6_A!X-TSPQ\2],N(I[+^ MPQ%IL=TN\;E< I&& ^)+K7=4M7,5S'H%H;I M('!P5:3*H2.X5CCH<&O3?@%^U=\,?VF+"YF\!^)(]1NK50UUIMQ&T%W #P"T M3@$KVW+E<\9H Z/Q7\D_P#!6S]G?5->33GUO6;"!GV#4KO29!;? M4[>'_$&F>*]$LM8T:_MM4TJ]B6:VO+24213(1D,K#@B@#0HKYX M^/7[>WP9_9TUI]#\4>)7N?$$8!ETC2+=KJ>$$9'F8PB'&#M9@<$'&*L_L_\ M[(G37U0R#1]4MVMKEU')* _*^.I",2!R0!0![GJ&K6.D_9 M_MU[;V?VB9;>'[1*J>;*W"HN3RQ[ UG7_AUJNJ*ME9^ M4\5RMROFH&98YD('R2?Q$ZAMA);PKB-569R^5PLB$]>,GG M%>[@Y&1TH CNKJ*QM9KF=Q'!"ADD<]%4#)/Y5QWPI^-'@KXX:'=:QX&\06_B M+3+6X-I-<6RNJI*%#%3N4'.&!_&N&\(_M6> /BM\0_B#\/=)AU2_N_"4$PUJ MY^S!;3"G8Z)('RS$[@.!]UN>*\K_ &;_ (Z?L^_#C]FSQMX^^&'AS6/#_@+1 M=29M4M6CDEN)+@B)2R+),Y/#Q_Q <'B@#ZXAU:QN-2N-/BO;>2_MT22:U253 M+$K9VLR9R =K8)'.#Z5;K\??V ?VS/!G@'X[?%.3Q$VN7=Q\0?$, TF2.V\Y M@'GF"><2X*8$J#OC!]*_1SX4_M8>"/B_\5?&/PZTA-4L?%7A5G6_M-3MEA#! M9/+9HR';< <<\<,#WH ]FHKDOBO\3]!^#'P\USQIXFFD@T31X//N&A7?(1D M*BY&6)( &>IJ+X/_ !4TGXV?#G1O&NA6U_:Z/J\;36JZE"(9F0,5#%0S8!QD M<\C!H [*OFSQ-_P47_9\\*>-I/"MYX_CFU>*X^RRBPT^ZNH4EW;=GFQ1,I.> M/E)Q6]^V!^TGX9_9M^%\U]XC&I;];2XTVP?3;<2LEP87*ELL-JCUYK\Y?^"8 M7Q'^!-C%9>"O&G@B'Q%\2O$.O8LM3OM$@O8XDVKY0$TA)CPP*?'_ /;'^$_[-#0VWC?Q,EMJTZ>9%I%C$US=LG9C&@^13V+E M0<<$UQ?P9_X*0_ OXW>);?P]I/B2XT?6KIQ':VFNVIM?M#'HJ29*;CV4L">P M- 'T_17GOQX^.7AO]G7X<7OC?Q8MZVBVDL4,@L(1++ND<*N%++W/K7A^M_\ M!4#X"Z%XITO09==U*[O+V.!V>QTY[B.V:5598Y"F27&X J@;!R.HQ0!]944V M.02QJZYVL 1N!!_(\BG4 %%%% !1110 4444 %%%% !1110 4V3[C?2G4U_N MFD]@/S>\3<^)-5_Z^Y?_ $,UZOIGQQTKPU\(7\*Z18W4&IRP%)+I]H4N_P!] MN#GID#Z"O*/$W_(R:KZ?:IO_ $,U,LFS3TO#H5M]E:0Q"=C/M9P 2,^9C/(/ MXU^3T\14P]2HZ>E[KY7/R&CB:F'J5)4W9NZ?IFZO:SZC87+"2..(@[6QA@0QZ$8_*O,SJUOGG1[+_OJ?\ ^.4?VO;9_P"0 M19?]]S?_ !RHH5ZF&FITW]^IEAZ\\--5*4M?-/J>J_%OXYZ=XT\(6/AW0=/G MTRQB=?,27:!L481!@],_R%>-"5E'#D?0UJSWL=LP671;)"5#XWS'Y2,@_P"L M]*C.JVP/.D67_?JG'Y"N;^%'QIU/X83R0*HO\ 2)6WR6CL1M;N MR'L>!]>*XY=3@=@JZ-9,Y. TQR?PDJ6^N1IMU+;76A6MO<1'#QRF<%3[_O* MU>,K&I#J?4N;&$R M _[^&/3X;&PMF+19 :8GDO#V]HVN>G M?"7XTZ=\/O!6L:-=6=Q/->N[*\6W:N4"\Y->2VM[-8WD-U;RM#/#()8Y$."K M Y!_,5H3WD=M]VUA8C$3Q4U.;N]MK'Z.^'O^0%IW_7M'_P"@BORJ_P""N7QL M^(GPU^/'A:P\(>/?$WA6QFT!)I+71=8N+.)Y//E&]DC=03@ 9(S@"OU5\/?\ M@+3O^O:/_P!!%?D3_P %@(4N/VKOAU%*@>.31[965AP0;N4$&OU>G\*]$?KT M=D?:O[ ?[7EI^T%\!OMGB+4TB\4^%HA;:]+<2;=Z*I*W1)[,JDL>S!O:OS&_ M:O\ V_/B-\4OC/K.I>"?'?B?PEX1MG^R:;9:-J]Q9))$AQYSK&ZY=SELGD @ M=JZ#]LW]G#QG^RO\<-5TCX>OJ$7A'XCQM9V-M89_?*\BL]BWNK;<=RI _O5C M?MP_LP67[+?PW^#^A,L]:EGV5_P5 M#^*OC7X?_L[?!_4O"_C#7_#>HWTZ+=WFD:G/:S7 ^R!L2/&P+?-SR3SS7B_P MY_94_;3^*'@30O%NC_';4X]+UFTCO;9+OQQJJ2A'&1N 4@'Z$UZ!_P %0KS/X0ZU_P % 8/AAX8C\!P7)\&K81#22MIHC VVT;.9 M5WGC'WN: /HWX%_ C]I#X$>%OBSKWQ3^)]YXGLCX1OAIH3Q-?7SVMTL3.LJ" M95",,<,IR.*^+/V8="_:J_:R@U^3P9\;O$ULNBM"MS_:_C'4H[[]ECXR-^T DB>(5TW41IWF16 M3XMZY;>%M+6]U^7:D8(&0@P%''&*]I_9?UC]N&Y^./AF/XMP MW"> &DF_M(O:Z0@_U+^7DP+YGW]G3\:^L_VOO^34OC%_V*.J_P#I))0!^1'[ M-WA?]K7]JG0]8U7P1\8O%)M=*N4M;C^TO&E_ V]EW#: YR,5ZE^VWX@^./[- MO[.GP T'6_B/XEL?'#2Z\-9U+2_$=T9+T?:8G@\R8.&EV12J!NSMY P*]5_X M(BC/PN^)?_89MC_Y!-<__P %Q_\ CP^#7_775_Y6= 'H7[?GQ/\ &7@S_@G_ M /"KQ%X?\6ZYH7B"\N-&6YU73=2FM[J!Y%'CC6(3/)=LGF?8( M"Q5"BGAI'(.,@X SW%?G%^UI^T['^U-K_P +?$5Q!]F\0:;HT>FZQ$HPC7*W M#MYB?[+JRMCL21VKVO\ ; >"T_X*LZ/-XJ:,>'EU;0G'GG""T$< ?.>,;Q+0 M!M^%_P#@G=^TU\:]!M/&GBGXE3:1K-ZGVJ"TUC5+J6Z0-\R[BI(B)S]T?=XX M'0?37_!/GX:_M*?#GQ=XIT?XL>(+F[\(:9M@LX=2N3?/=2MSYEM.S;EB"XR# MW. 0<>U_MC:O\:-)^%VG7'P(L4U#Q9$#C*E&X/0T ?J] M1110 4444 %%)FC- "T4F:,T +129HS0 M?F)XA46?\ P6ITAM3X2>P0V9?H M@KY%^$G_ 5'^!'Q$\*V MU]K?BA/!.M",&[TG6(9 8GQ\VR15*2+G."#G'51TKYH_;,_:S_X;QSZIK:V\D,++&V5 W ,L2'#M(P ^50,]P#Z-_X*S?\F6^)/^PC M8?\ H]:TW^#^F_'/_@GUX(\*:WXOG\$:'-X:TRXOM5B:-56&.%&*R%R%"$@$ M\CIUKSW_ (*$^ (_A5_P3>C\(1W>6R?QKS;]MC M3O%=_P#\$RO@^^@QW4NB6]EI4NNI:@Y^SBU^1GQ_ )-N<\ [2>E 'J7A']KS M]C[]F?X=V/@?1O$NG:Q%IUNMM.-*T66Y:_<##RR2B+RW9SDDER.?2O ?V&?' M/A3Q;_P4L\7ZM\.M(N_#/@W6M%N)X=+N;9;4CY8&8B)6*JI<,R@'HPZ=*]A^ M"W[4G[$WPM^%6AWVDPZ#I.JVME'YUJWAZ275FG"C42[EL_-OV^X%>1_L MH?$O4?B5_P %2]8\7:UH%]X4_P"$DT6XFTW3M4B,4YM?)C$#%3W:.+=QQUQD MF?\ .:/_ +ES_P!L*^I_VXO^30_BU_V+]S_Z#7QK^U)XM/[*W_!2WPI\ M8/%%A>'P+K&EK9R:A;0F01GR6@D''5D^1RO4J> :Z;]LS]OGX?\ Q?\ @9XI M^'_PAN;WQ[XAUO3I#=266GSQ0:=9(/,GFE:5$Z(I&!GKR1P" 9GPW^)&H_"K M_@CD=>TB9[;4_L-U903QG#1-/?O"7![$!R0?7%>U_P#!-GX >$O 7[+WA/7D MT6RN?$7B>S_M'4=2G@62:42$E(]Q!(15P-HXSD]37GG[-GP=D^/G_!*2R\#6 M[K'?ZG8WOV-Y.%%Q'>2219/8%T4$^AKG?V+?V^/!7P1^%UO\)/C9/>^ /%O@ MTO8#[=83R)/"K$H/W:,5=0<8(P0%()S@ '*?M!_ ?PW\'?\ @IO\#-5\+:;; MZ/8>)[^&\GL;1!'"ERDI61D0<*&!0D#C.3WKM/\ @I'_ ,G;?LM?]AE?_2NW MKQOQG^TW:?M0_P#!1CX'Z[X>L;V#P3IFJQ:=I-]>0-%]N82;II5!Z#+*,=0 M,@$X'LG_ 4B/_&6W[+7_897_P!*[>@#GO\ @J_X2@\??M"_L\>&KIV2UU>Z MDL9F0X(22Y@1L'Z$U]Z:G\ OAX?A7=^!4\':-%X7-D]N-/2SC"*-A 8<9W]] M_P![/.2-B;L[5)!- M?I3^TU\-[WXO_L_^/?!NFN$U+5])FM[7<< RXW(I/8%E _&OB[_@G?\ MD^ M/A7\(8OA%\3]5B^'OB[PK=W%LT6MJ;>.9&E9_OD;5=69E*L03@$9R< 'G/@C M0-;_ & _VNM&U;XWV=M\1E\8R_9=.^)4MS/+=6;G"-N25B 0&4,,;@K?*Y&5 MK]9 00"#D'O7Y8?ML?%W1/V[/B]\,/@_\()CXJ_L_4SJ&IZ[:1M]FMT.U6(< M@95$W,S#Y22H!)K[[^/7[1'@S]EOP/I_B#QM<7L6E37*:=$]G;&=S(49AE0> MF$/- 'JM>'?M5_M<^"_V4?!3:IX@N!>Z]=(PTK0+=Q]IO9.QQ_!&#]YSP.@R M< L_:(_:HT7X)?LU3?%:"(W\=[902Z-:3 H;F:X0- K#J!@[F[@*:_-;]E;X MQ_ ;5O'UY\:/VD/B0?$/Q+N;DR66C7&CWUQ:Z8JGY&.R!HV8?P(I*H,'EON@ M'T_^Q%^SIXY^(_Q;O_VFOC3"UKXFU1#_ ,(_H!O^"BG[/OQ)\8:1X6\.^/&O];*QPJ[G@"KGU) M KZ0S0!\9?\ !7'_ ),RUK_L+6'_ *-KPWX#_"']N35?@OX*O/!GQF\&:1X3 MGTFWDTNPN[=#-;VQ0>6CG^S7^8+@'YF^IKW'_@KB?^,,M9_["UA_Z-KF/V;O M^"CG[/7P_P#@%\/O#>O>/6L=:TK1+6SO+8:+J$GE2I& R[D@*G!'4$B@"#3O M@K_P4!BU"V>[^.G@66T653-&MM'EDR-P'_$K')&>XK[C\6>$-+\>>$M3\-^( M;.+4M)U.U:TO+:0961&7##V]0>QP:^:_^'I?[,G_ $4=_P#P0ZE_\CUVGQF_ M;#\$?##]FT_%ZROEU?2=1M@V@Q&-X7U&=P?*0(ZJZC();(!"J30!^7WCW6OB MC^R#XD\<_LJ^&M;MI]%\87]N-)U.XNUC>TM[EMI&[.(C(I57SC&TD?>S7ZN? MLM?LY:%^R_\ !_2_!NCJD]TJ_:-3U';A[VZ8#?(?;C"CLH ]:^ ?A9_P3]UW M]J#X ^-OBK\0+J2ZD;']\'^*@#Y]_X)8? 7PUXP M^*OQ9^(FO:;;ZK?Z)KDECI:748D2VD9W>295/&_&P!NW.*]2_P""M_PAT1O@ MO:?%;3;2+2_&_AK4[4Q:O:J(YY(G?:%9ARVUMC*3R,''4U\T_L%?M?:'^S-\ M3/BCIWCJ&]LO ^N:[)C7H+62>&RO%>3"R! 3ATST!/R=,9(]/_;5_:DTG]MN MW\/_ (^!2W?C"ZU?48;G4]6CM)8;:"*,Y /F*K;5)#LY 4!0 23P 7?^"D_ MC:X^)7_!/GX3^*;L8N]8O--O)\?\]'LY2_\ X]FOMO\ 9W^#/A/X;_!/P+HV MG:#IR+9:=:W1E^RH7>Z,:LTY8C.\L2=W6OCS_@JMX,MOAS^Q'\._"MFV^VT7 M5;#3XWQ]X1VDJ;OQQG\:^_?AYS\/_#/_ &"[;_T4M 'XW?"_]I_X>1_M;_$[ MXH?&#P?XC\?W_P!N>VT"VTS3H;Z"P1)&52R2RH RHJ!, XRQX/-=Y^V5^V#\ M#OVF_A+J.D:?\*O&^G^-H%631=:N-!M83;R*P^5Y([AG\MER",'L<9 K?\ ^ M.I?^"9_[7'Q TSQ[IE\GPM\=7)O-/UVUMVECB_>,Z-@?>V"1T=1EAA2 1C/L MG[0?_!4_P39>%X-(^!EV_P 0OB)JLT<%A;Q:7<8Y M .5\8:-\2/VJO^"5'A^+38+W4?&%NL)N[(AA<:A%:3/&5P>6E_##XE?"^[\"R6%G'IVH6YTA+FRD95"N\L>!*&8Y8@Q MLRN_BBNDMJ_V4"\T;7/#TMW-!+M^98G6%P1 MNSM96!Z9P: /3?V-/A%\'_"7@#QI?_ KQO=Z_HWB69I)/,O$ECTZ?:X14B$: M/$0''$@+$*OUKX:_9D_: LO^">&O^*?!7QI^$^IC5[W4WG'BJUM8Y9[B/ 7" MF7:)(L@N&1_XSD9KTK_@F+X0U:7XB_'3Q]\-]%GT'X<:E#+:^%[361(8)K@2 MEX PW994 *L0V1YF-V(-*VUOF:-R/E!//-<3^U#_RE9_9^_Z\(_\ T.YKQ>ZL MOAM\#?A7XF9[KP3X:TX7L MNF%R([A_)-P^0/[Q\I#_ +*XK[S\:_ /X?>/_ %QX+U?PCI$GAV2 P1VD5G' M&MN,8#1;0/+9>H*X(Q7PY^VYHWB/]F+]L+P9^TSI>B76N^$3;IIWB!+-M<9_P2 ^"OA;Q/?_ !(\=ZWI%IJVKZ=JJZ?ISWD2RBT!#/(Z!@0& M.5&[J #CJ:]>_P""8OP2\5^$/ OQ"^)OC>PETO7?'UT;V*RN$*2I;CS'WLIY M7>\K$ \X4'O7/?\ !&8_\6Z^*O\ V,P_]%"@#G_^"LO@G1O!?C'X*^/="TZW MTCQ.VN_9Y;^SB$4DRHT4D9_B7_P!BYJ'_ *3O7Y8_L%?%;]J3P9\#Y;#X/?"K0?&7 MA,ZK/(VHZE*%E%P5CWIC[7%P %_A[]37ZF_M)'_C'OXE_P#8N:A_Z3O7R]_P M1Q_Y-)N?^QBO/_1<- '!^.-0_;Z_:"\.7G@^Z\!^%OAOH^IQFUO=3MKN))/* M88=2QN9W ()!*)G&>:^FOV>?V9-._91_9CU3P=:W8U/4Y+.ZO=4U%4VBXN6B M()4'D(H55&><#)Y-?16:P_'1_P"*(\0_]@ZX_P#134 ?G3_P1A^%/AZZ^'/C MCQM>Z5:7VM3:M_9<5S<0K(\,"1*[*I(^4,9.<==H]*=^W?I,7Q@_;,^!?P#? M_B7>!MB7]UIUD/)B?<\FX!5P!B.$J,=-[8ZUV/\ P1?/_&-_BK_L9Y__ $G@ MJE_P4A\!^*OAO\8_AE^TCX4TB;7(/"+);ZU:P*2R0+(S*[8&0C+)(A;HN5)H M ^U)_@;\/;GP(?!37'A729)-1L(9G+>24G2,8]VCF0'U*"O79O^"L/[/4?@0Z\G MB.^EU3R-X\.C3)Q>>;C_ %6[9Y6<_P 6_;[UP'_!,_X<>+_%/Q$^*'[0OC#2 MIM#;QQ*R:79SJ5=K=I?-9P" =GRQ*I_BVD],4 97[!__ "D _:A_Z^I/_2MJ M/BW_ ,IBOA=_V A_Z(NZ/V#S_P ; /VH?^OJ3_TK:CXMG_C<3\+_ /L!#_T1 M=T '[1W_ "EJ^!/_ &"D_P#;NO+O^"BOQBM5):$ -&2W]T/$^%8\!D /49 #Q5_P M4._9M\9^!)_!NJ? _P ;S>')(# M@GABQ2.%<8!C NAL8=0RX((XJ[_P1S\: MZK<>$OB+X,GCU)/#^CZC'>:,NIQ%)(X9C(&3'('^K5B 2 6;UKU'7_\ @J_^ MSYIO@.77=.\27>JZN8"\/AY--N([II<<1LS((UYZMO(]":[7]AKXK_%WXV?# M*\\7_%/1=-T&"_N=VAVMI9RV\[VN#F64.[9!) 4@+D*3R"* /I&OS$^ :_8O M^"P_Q4CU+BZFL[LVN_J08[=EQ_VSS^&:_3K-?G%_P4 ^&GB[X$_M >$OVI/ M&E2:M%I82#Q'90J3B-5*>8^!D(\3&,M_"54GK0!^CU->14*AF"ECM7)QD^@K MY6\ ?\%.?V>_&_AF'4[OQO'X8O#&&N-+UBWECGA;'*Y52K_5"?PZ5\D?M/?' MK4/^"CWQ1\)_![X*V]_<>$]/OUU#5/$DD#PQY&5\[! 9(XU+8W89V8 #@9 / M2?\ @JMJVH^._B)\#O@Q%>RV6C>*=6674/*;'F9FCA3/KMWR$#UP>U?;OAKX M$?#WPEX"B\%Z;X.T:/PRD MVT^2RC>.9<8)DW [V/4LV23S7QO\ \%(?@!XE MTGP?\*/B1X LKG6M0^%KQ++;@-+.]K'Y3+*0,EMK0C=WPY/8UW?AG_@K#^S] MJO@*+7-5\17FBZR( T_AZ33;B2Y67',:,J&-LGHV\#UVT >+_LGZ4/V:?^"E M'Q'^#WAZ22+P3K-BVH6^G,Y9+=Q&D\>,_P!U7D3/4C&>E_M-ZYHESH'AN_A>PT"&[7#SH0D89?[RK%& 6'!9R 3@T_]CH_\;./VD_\ MKE-_Z4PT =G_ ,%:?A=X8O\ ]E.^\1_V)8PZWHE]:?8KZ&!4EC1Y!&T>X#.P MAON],@'M7:^(-6NM=_X)B7%_>S-/=S_#D/+*YRSM]C&23ZU5_P""K1_XPK\6 M_P#7W8_^E"4VY/\ QJR/_9-Q_P"D@H RO^"\N65\?\ CM?#G[%W[57PO^&VO^+_ (A?%+P/XK\??$?7-2>>+6+#2K>^ MAM8C\Q"-+,A60L3DA>%"@'&17W;_ ,$S]#M_$_[ ^@Z/=9^RZ@NIVDN/[DD\ MJG]":^;_ -D/X^0_\$[O&OC'X*?&NVO="T6;46U#2/$"6LDUNX("%\("S1NJ MH0R@[6#!@.P!YU^V]^U)\*OVAM#T;6OA_P##GQKX6^)^CZA%K?\%/O%-Y\1_V-?@3K^H(8=0UB[M;FX5EVE99+ M(E^.WS$\5Z3\6Q. M2"7X55!)/I@?\%@/[3'P"^$XUIK9]8_MZ+[8UDC) 9OLS;_+#$D+NS@$DXQS M0!]N?"+X/>$_AO\ #GPGH6D:!IUM#I-I"89%M4WB;RP&FW8SO8EB6ZG)K\P/ MAK\5Y/\ @GC\?_B2OQC^%^HZ\/$6JO(R.V86EPCJX8,0'4@C! M!QQ^N6E^8=!L_**B7[,FPN"5!V#&1Z5\$?#W_@HM;^'_ !UXY^&W[5&EZ=X2 MU*TO"EG)!I$\NGW%OT 9"96(; 97Y4ANHQR 7O >L?LI?M=_M ^#_B'X4\4W M7AGXEZ.ZRPZ1 B:7+?NIW#SE>(B=@-P/E/DJ2#D 8^^:_&S]H0_"']H7]I#X M7Z7^RWX?1/%,6HK=:KK&@:;)86<:+)&RR%"J &/#LT@4#D#+$\?LEF@"KJUK M97VEW=MJ4<$VGSQ-%<17(!C>-AAE8'@@@D$&OSY^)'_!(S21XDG\5?!7XCZK M\-[^4F:&T5GD@0GG$4\;I)&GIG?7TK^W'\ ;S]I+]G'Q'X0TID&NJ8[_ $T2 M':KW$1W*A)Z;@67/8L#7R=^RS_P4N\/?![P5IOPM^.VE:UX,\4>%XETTWTEA M)*DD48VIYL:@R(X4 <*P8#.1G% ',>)?%'[;G[#ED?$'B?5K/XK^ +%U^V32 MR_;0D9.,O(RIQXKSK]J7_@I9\.OB=\,M<^''PCM-7^(7BOQ7:OI-NM MOI6_\%%?BYH6H?MS>"_#'Q!T[6-?^&_A.TAO+O0=%B666[FD5I#\C.@(/[I3 MEA\H;'6O4OVTC_QLH_9E_P"V/_I5)53]O'P[XG_9R_:P\#?M-Z'HMQKOANUA MCL->BM5):$ -&2W]T/$^%8\!D /49 #Q5_P4._9M\9^!)_!NJ? _QO-X&+%(X5Q@&,"Z&QAU#+@@CBL+_@F3\8=8\%_ 3XY6#0ZC_8GA"*;6M"CU M2(HZ1M%,VPCD#F)&(!(!9O6O>]?_ ."K_P"SYIO@.77=.\27>JZN8"\/AY-- MN([II<<1LS((UYZMO(]":VOV4O%WQ5_:D_9^\57OQ=T?3?#VG^)89[+1[>SL MY8)VM)(V4RR!W;(.X;,!010!XO\ \$F/@YH/BCX=>(/C'XFL+?Q!XWU[ M6KE!J>H1B:2!%*EBA;.UF=F)8N5N);G1+:-&U#:RL@E)XXPRDX)*L0>@KY&_8K_:5TK]A2X\4_ OXY)=^$GL MM3EO=,UA[26:VGC< ''EJS;&V!E< CYF!((KMOB-^V3XF_:H_: \!?#_ /9J MU[5(M&LKK[5XD\3P612W^SDJ&!$R9VJH;!91N9@%SUH 9^VA_P I*/V9?^V/ M_I5)71_\%F/^37-&_P"QEMO_ $3-7"?\%&O%-G\*/VV/V>?B#KZ3P^&-- :Y MNXH6DVB.Y+/@#J0K@X'-7?\ @J)\5_"WQL_8E\+^+_!FJ?VQX>OO$T(@N_(D MAW%$G1@4D56&&4CD"@#T_P#;I^"S?%_]A"RN+*$R:WX7TRSUVR9!\^(H%\Y1 M]8RY^JBNG^&'[6MI<_L P?%^]G22_P!)T%XKI6/+:A"/)"GW>0(?HXKZ!\ V M<&I?"OPY:7,2S6UQHMM%+&XR'1H%!!]B":_%KQ?X=\7^$/''B;]CG34G&FZY MX\MKRTFYP+-E)'']W889#VS$: /N#_@FK\)[GPE^RAXI\=ZRK/XA\>F[U6:> M0?.T 5UBR?\ :)D?_@8K._X(P_\ )O/B_P#[&B;_ -$0U]IS>&;#P5\)I?#^ MEPB#3M+T5K*WC48"QQP%5'Y"OBS_ ((PG_C'GQ?_ -C1-_Z(AH R/^"67_); M/VF_^QA7_P!*+NJG[34'_#+'_!1GX:_%J$?9?#/CA1I.L..$$F%AD9O^ M!) M]4-<+^Q)\?O!7[-_[47QX\+?$/49_#VI>(/$H@T[S+.:599?M4X"DQJVS/FH M0S87!SFOK7_@I7\%V^,?[*_B)K.$R:WX:(UVQ*#Y\P@^:H^L1?\ $"@#RO\ MX*H>*;_QQ_PJ_P" WA^4G5_&^LQ2W21G)6V1PJ%O]G>Q;_MD:^Y/!GA2P\"^ M$=%\.:7$(=.TFSBLK= ,82- J_H*_,S_ ()]ZEJW[77[4]S\8O$D+O:^"?#= MEH]IYO(-X8!&SCZXN'_[:+7ZEYH Y?XJ_P#)+_&'_8&O/_1#U\8?\$>;M;#] MD?7+EAE8?$%Y(1Z@0PG^E?9WQ5/_ !:_QA_V!KS_ -$/7QK_ ,$/+*#Q)XB.M&VT\:C&)DM M"07+(K9 (4QHI_A"G&*]H_X*=_L\>$O&G[-_B3QI'I%I8>+O"T27]GJUK$L4 MY174/$S* 64J20#T(!&.:^>OV>?BG'_P31^._C_X;?%2SOM.\!^(K[^T=%\1 MPVSS0[02%/_%'BV2*U MFEL;&:.."$.&91YBJ68[0"0-JKN)(Q0!7_:'^(FI_%;_ () >'?$VM3-&$N3W+>5D^YKZ@_87^#'A/P?^RA\.X8=!TZ6?4M,M]6O9Y;5 M'>XN) )=[$C)*Y 7T"C'2OG_ /;%^$TWP,_X)7:;X%N94FO-'&G1W+Q\J9WN M1)+@]QO=L&OKO]DL_P#&,'PI_P"Q9T__ -$)0!ZS129HS0 M%)FC- "T4F:, MT +129HS0 M%)FC- "T4F:,T +37^XWTI\3KGQ)JH/3[7 M+_Z&:ZL^)=!;P]'HNZY"PV\,BS-_JC<*Q9\)MSSO9,Y[+Z5ROB;GQ+JO&?\ M2Y?_ $,UU&H^"=,6#3G@U#[)$UK;&>>5&<\UQOB#PN?#\%HL]Y&]W/O#6ZJ?W8 M61T)+=.J$_2M+5-#T\:VV@6EI*UKKQ M3X?L;*,V=U!-=10S1P2&W8N%:%0H?* ;@_IP.N>M8*?#1S=_9I-2BC>66&"V M/ED^:9$+KG'W<8P:K6O@8W-W:V2Z@C:A+"+F2W6)F\N/R_,X/\3;<<>]:*6( M3?N+4T]IBDW[B%36],?QS%JUR2]M"D<[)''M,TRQ#Y<8XS(.O3KZUOVGBW0[ MK55O9KAH/M%DMM=-=1^;,&1L"1&"$$LH40<"M6#P59S>&8+H6[Q/+9+*+QKM<>1T90RHAY;[P(/< ^E5&^&]X+"UG,OSS&-O*\EON/G!4_ MQ$8R0.F?8U4E7:U@7)XIK6F;4GB/P^NFZFT-S&99I)9$B:%PR2>8IC9,+@#: M#RQSGIP:6]\4Z5/K&I3MJ$4\\]W//;WC6S,(=\8\LD%?X3QP"1U&:QS\-Y5: M4/J,*G=;);94YG,V_;C'W<>6V2?2FZ;X/TJ]@O$35UD=)[>".X$#@!W,@*;> MI^ZISZ&FI8C;D2*4\4].1+_@&I)XRTV":*..2%T>=1>S"U&)U$"JS %AP*\^3F9>I^;O5W64M(KH0VL$D!A413;Y-^^0$AF' P#Z52B_UB_45Q5* MDJC49=#S:M:=22C+H?H[X>_Y 6G?]>T?_H(K\U/^"F'[.?Q*^+G[27@?7?"' M@S5/$.CV.FV\-Q>6489(W6Z=B#D]0I!K]*_#Q_XD6G?]>T?_ *"*T1(!Q^M? MK5/X5Z(_88[(Q]5\)Z/XDN],N=6TNVU"XTJX^V6,MS$':WFVE=Z$]&PS#/O[ M5^>W_!6C]GSXA_&K7OA])X%\'ZEXFAT^WNEN6L$#"(LR%0X4;A6I M9^>O_!2KX%?$#XM? #X3:-X1\)ZAXAU32YT:\M+- 7@ M0AW.YK]?MPHW"@#\_?@-XN M_:K^)GASXJZ)\8?"]U9V%QX3O8M*0Z7%;&>\>-D5%*P75VC:[^U:9#<;O+W!<;B/2OW!W"C<* /RS\(?&C]OVY\ M6Z)#K/@NZBTB2^@2\E.@VR[(#(HD.1R/ESS7W[^TSX?U3Q=^SI\3M#TBSEU# M5=2\-:C9VEI",O-+);NJ(ON20/QKT_<*-PH ^"O^"3?P4\=?!+X?>/+'QOX8 MO_#-W?:G!-;Q7T>TRH(B"PP>@-8O_!6WX$?$#XX67PN3P-X4U'Q.^FR:F;L6 M"!O($@M=F[)[[&_[Y-?H<9 ,]Z^?O$7[96C1>*M7T'P9X)\6_$RXT67R-4N? M"]DDEM:2]3&99'17<=U3)!R.HH \(_;H^"?COXD?L*?#'P?X:\+ZAK/B339] M(:[TRV0&6$16$L*&UGDM+^TOXC!WGA'X>^./'GA>QD>.?Q+H&F+)9'9]\Q%W5I@" M""8U/(^E 'YO_M3_ /!-/Q]X%^-DD_PQ\)W_ (F\%ZA,+VV^PJ'-AE\M ^2. M%_A/=2.X-?:/_!17]A*]_:;T_3_%O@PPP>/-(A,'D3N(TU"#.X)O_A=3G:3Q MR0<<&OJ'PQ\=_!'B[X8M\0=/UZV/A.*%YI[^9O+%N$_UBR@\HR\@J>&B+I2^)?^%;^/A\/C\__"8-I %D(LX\[87\WRN^_9C% 'PKX4_:?_;8^".B M6?@JX^'6HZ\]F/LUO>:GX?N;R957Y0/.B8*X'&&;)/J:Z_\ 9,_9-^.WQ)_: MKTSX^_%>R7P\T%V+R9;V-8KF[98?)1%@7_5JJA1EL<*.I-?H/X_^.,WAGPSX M?UWPMX)U_P")=CK*":)O# @?RXBBNDC&61!M8,,8ST->7K^W'-9?$'PCX/US MX,^/?#NJ^)[K[-8B^CLSD C?(52=F"(#EFQ@"@#ZBHIJN&)&,$4N: %HI,T4 M +1110 4444 %%%% !1UHKP?Q5^W7\!_!/B34M USXD:9IVL:;.]M=VDD4Y: M*53AE.(R,@^AH T?&7[&7P.\?ZM)JFN?"_PY=:A*V^6YBLQ \K=VVDQYJZ99I"TI'0NP&YS[L37D7_ \3_9R_ MZ*KI/_?FX_\ C=;W@3]MCX(?$WQ9I_AGPQ\0M.UC7=0(](E97DL-6LX[JW=E.5)CD!4D'D''%6 M[#0M-TK1H-(LM/M;/28(1;16$$*I!'$!M$:Q@;0H'&T#&*Y+PM\_#/PAJ7C&U\6W?A31+KQ7:)Y=OKLV MG0O?0I@C:DY7>HPS# /<^M=+10!F>(O#.C^+]*ETS7=)L=:TV7_66>HVR7$+ M_5'!!_*L'0/@WX \*Z/J.DZ)X&\-Z/I>I1M#>V-AI%O!!=(005E1$"N""00P M(YKL:* ,KPOX3T/P1HEOHWAS1M/T#1[?/DZ?I=JEM;Q9)8[8T 49)).!U)K& M\9?"#P'\1;J&Y\5^"?#OB>YA&V*;6=)@NW0>BF1&(_"NNHH Y.7X2>!IM0T. M_D\&>'I+[01C2;EM*@,NG#.<6[;,Q<\_)BK'B3X;>$?&6KZ5JOB#PMHNN:II M3^9I][J6G0W$]F^0VZ%W4M&E=&RAU*L RD8(/0TM% '.>#/AQ MX2^'-O=P>$_"^B^%X+R7S[F+1M/AM%GDQC>XC50S8[GFNCHHH *YN^^&OA'4 M_&%GXLO/"NB7?BJS3RK;7)].A>^@3D;4G*[U'S-P#_$?6NDHH *\Q^)W[,GP MI^,U^M_XT\ Z'K^HJ OVZXM0MP5'13*N'('H3BO3JJ3:M8V^HV^GRWMO%?W* M-)#:O*HEE5<;F536)X\^.7@7X8^)O#OA[Q1XCMM'UGQ#+Y&E6DR.6NGW*FU=JD#YF4!@# MX%JT4 ><:'^S7\(O#&KVFK:/\+/!6DZI9 MR":VOK'P]9PSP..C(ZQAE(]0_ &N?%/4/AO8>)K6Y\;Z?&9;K M1E23S8E 4DDE=O1UZ'O0!TOB[P3X=^(&BOH_BC0=,\2:2[K(]AJ]G'=0,RG* ML8Y%*D@]#CBN$_X9.^"'_1&_A_\ ^$O8_P#QJO5:* /*O^&3O@A_T1OX?_\ MA+V/_P :K>UGX'?#CQ%H>DZ+JOP_\+:GH^D*5T[3KS1;::WL@>HAC9"L8X'W M0.E=O52WU:QO+Z[LH+VWGO;38;BWCE5I(=P)7>H.5R 2,]<&@">"".VACAAC M6*&-0B1HH554# Z 5R]G\)O ^F^,KCQ?:>#?#]KXMGW>;KT&EP)?R;AAMT MX3>&])\6-^T-I>N:79:SID_B*(2V6H6Z3PR#=1 MP0?Q%?H/X,^&OA#X"8YDBT;3H;17/JPC50?QK0T7POHWAMK MDZ1I%CI9N6WSFRMDA\UN>6V@;CR>3ZUJ4 <_XT^'WA;XD:7'IOBWPUH_BG3H MY1.EIK5A%>0K( 0'"2*P# $C.,\FMRWMXK.WB@@B2"")0D<4:A510, #@ # MM4E% &9XB\,:-XOTN33=>TFQUO3I/OV>HVR7$+?5'!!_*L#P?\&/A]\/+UKS MPKX%\->&;M@5:?1](M[20@]06C0&NRHH *\]U/\ 9V^%.MZLVJ:C\,O!U_J; M-O:]NM M))BWJ7:,G/OFO0J* (+*RM].M(;6T@BM;:%0D<,*!$11T"J. /85 MS/C/X1>!/B/-'+XL\%>'?%$L8VH^LZ5!=LH] 9$; KK:* ,3PGX'\.> M.-A MX9\/Z7X2">))X)%*/'(H974\$$'@BN&TCX ?"_P_K2ZQI?PW\(Z;JZMO M74+30K6*X#>HD6,-GWS7>T4 (RAU*L RD8((R"*YWP9\./"7PXMKNW\)>%]% M\+V]W+Y]Q%HNGPVBS28QO<1JH9L=SS71T4 '=)\,:69#,;+1K&*TA,AP"^R- M57<<#)QG@5NT4 %1SP174$D,T:30R*4>.10RLI&""#U!':I** .?\%_#SPK\ M-]-ET[PEX9T?PMI\LIGDM-%L(K.)Y" "Y2-5!; SC/ K>=%D4JP#*1@@C(( MIU% 'G\7[/?PL@UL:S'\-/!\>KA_,_M!=!M1<;NN[S/+W9]\UWX P!2T4 M *K_PMHM]XGL$\NSUNYTZ&2]MEY^6.8J70?,W (^\?6N@G@CNH9(9 MHTEBD4J\;J&5@>H(/45)10!Y]9?L\?"K3=8&K6GPS\'6NJJ_F"^@T"T2<-_> MWB/=GWS7H &!2T4 %-DC66-D=0Z,"K*PR"#U!%.HH \/\2?L0_ 7Q9JCZCJ7 MPI\-/>2-O=[>S%N';N66,J"3ZD8 M8]V??-=_10 R*)((DCC18XT 5408"@= !VKGM&^&WA'P[XGU+Q)I7A71=,\1 M:F"+[5[/3H8;N[!()\V95#OR ?F)Y KI** ,?Q7X.T#QYHDVC>)M#TWQ%I$Q M5I-/U:TCNK=RIRI:.0%200",CB@^#= ;PK_PC!T/33X;^S?8_P"QS:1_8_(Q MM\KR<;-F.-N,8[5L44 9'A3P?H/@31(=&\-:)IWA[2("S1:?I5I':V\98Y8K M'& HR22<#DFH?%W@/PS\0+!;'Q1X=TGQ)9*=RVVKV,5U&#ZA9%(K=HH Y?P9 M\+?!GPX65?"?A'0O"ZRC$@T73(;0./?RU7/XU-XT^''A/XD6=M:>+?"^C>*; M6VE\^"#6M/AO$BDQC>JR*P5L$C(YKHJ* &HBQ(J(H1%& JC ]!7-^,_AAX- M^(\<4?BSPEH?BB.+B--9TV&["?02*V*Z:B@#G?!OPX\)?#JUDMO"GA?1?#%O M*07AT;3X;1'QTR(U4&NBHHH *YGQA\,?!WQ#2-?%7A/0_$RQC"+K&FPW84>@ M\Q3BNFHH Y/P;\(_ OPYDDD\)^"_#WA>20;7?1M*@M"P]"8T7-=9110!R/C+ MX/\ @/XC7$<_BSP3X<\3SQC:DNLZ3;W;*/0&1&(K8\,^$="\%:8NF^'M%T[0 M=.4Y6TTRUCMH0?4(@ _2M:B@#G-:^&WA'Q)XETSQ%J_A;1=5\0:7C[!JU[IT M,UW:8.1Y4K*73DD_*1R:WYX([J&2&:-)8I%*O&ZAE8'J"#U%244 >?67[/'P MJTW6!JUI\,_!UKJJOY@OH- M$G#?WMXCW9]\UZ !@4M% '.^,OAQX3^(MK': M^*_"^C>)[:(DI#K.GPW:(>^!(K 5-X1\">&O &G-I_A?P]I7ANP9MQM=(LHK M6(GUVQJ!FMRB@##\7>!O#?Q TO\ LSQ1X?TKQ)INX/\ 8]7LH[J'=V.R12,^ M^*PYO@9\-[GPA;^%)OA]X6E\+6\YN8=$?1;8V44ISF18"FP-\Q^8#/)]:[BB M@"*VMH;*VBM[>)(+>%!''%$H5$4# 4 < <8%<_<_#+P?>>,X/%]QX4T.?Q; M GEQ:])IT+7\:8*[5G*[P,$C /0FNEHH 9-#'H MK"\%_#SPK\-].FT_PEX9T?PM832F>6UT6PBLXGD( +LL:J"V !D\\"N@HH X MOQ1\$_AWXWUN/6?$7@+PQK^L1[2FH:IH]O.U 'B?_!.OX!7'P _ M9FT.PU6U-IXDUIVUC5(W7#QR2@;(V]"L80$=CNKZ&/ASI3:7X3\.:1X7TQY#,UGHUC%:0F0 M@ N4C51N( YQG@5O44 8_BGP;H'CC3#IOB/0]-\0:<3N-IJEI'#] \+><,2?V+ID%GO'^UY:KG\:ZJB@#&\6>#/#_ (^T M671_$^A:;XCTB5E>2PU:SCNK=V4Y4F.0%20>1QQ5[2=(L= TNTTW2[*WTW3K M2)8+>SM(EBAAC485$10 J@# &!5NB@ HHHH **** "BBB@ HHHH **** "B MBB@ IK\H?I3J:^ ASTQ2>P'YN^)N?$FK=_\ 2Y?_ $,U8M/%VJV3ADN%;$<< M8$L:N (QA" 01E<<'K5?Q*<^)-6_Z^Y>_P#MFFKKUZJ@>P4;0';&6&.,-GBJ7]OWO\ SV3_ +])_A1_;][_ ,]D_P"_:?X4 M>TMM,2JR?]^D_PH]I_ M>*]L[WYW^'^9'J&KW6J "=D""1I!'%&L:*Q"J<*H '"K^521Z]?QJ42Y<(8/ MLVWC'EYW8Q]3GZT?V_>_\]D_[]I_A1_;][_SV3_OTG^%)35[\VI/M%S9='C;5UODO%E@6Y4?ZP6T>6.<[C\O+9YW'G-,B\9:O!]F*W*^9;L&CF:) M#(,9X+XR5Y/!..:J_P!OWO\ SV3_ +])_A1_;][_ ,]D_P"_2?X57M7_ #E> MVE_S\?\ 7S);SQ5JE\P,ESM"F,JL2*@7R]VS &,;VQCUI;GQ5J-U(':6-#O MCDQ%$B LA8JQ"@H?[?O?\ GLG_ 'Z3_"C^W[W_ )[)_P!^D_PI.:>O M,#JW=^=_U\RE+*\\KR2-N=V+,?4GK1&?WB_45<.O7I_Y:I_W[3_"J2L6F#$Y M);)Q]:S3C=69C[MURNY^COA[_D!:=_U[1_\ H(K*USPA=:QJ#7,7B;6M+0@# M[/8O"(QCO\T3')^M:WA__D!Z>/2WC_\ 016F.E?L%/X%Z(_:H;(XG_A7=]_T M/'B;_OY;?_&*/^%=WW_0[^)O^_EM_P#&:[>BM2SB/^%=WW_0[^)O^_EM_P#& M:/\ A7=]_P!#OXF_[^6W_P 9KMZ* .(_X5W??]#OXF_[^6W_ ,9H_P"%=WW_ M $._B;_OY;?_ !FNWHH XC_A7=]_T._B;_OY;?\ QFC_ (5W??\ 0[^)O^_E MM_\ &:[>B@#F= \*7.B7CS3>(=6U9&7;Y.H/$5'N-D:G/XUC>)M4\#?L^> - M4UJYCT_PKX-OB5^S_KOB.QTJ??X8\,VNO:8ECIOI<2AILS3G^\PPO\(H J^-;/ MQ7X1_9 _:&^)5U83^&;WXBZH-3M=*/RS6=A+Y-NAD ^[*\>YF';=SS7W5X"\ M):1X&\&:+H.B0Q6^E:=9Q6]ND( 78J@ C'KU_&O-+ :S^TG\-_&7A/XB?#74 M_AY97]M]B6*^U"UNVG616_>(T#L%,9"G#=R/>O/O"'B7]H7X1>%[;P3=?#&+ MXE76FQBTTWQ=9:[;VD%S$HQ&]S%)\Z,!M#;0V<$T 0?!3PCHB_M)?M(?#V;3 M;34/!=]-INL3Z3<1+);"ZN8,S_(1CYF56/N,UWG[4OQ-T[P-\/IO!.DZ M,_%=I-I.@^&[:-29F9"A=UZ)#&&#,QX &!7+>%_AY\1_@+\)/'OC"PTF#XC? M&SQ5>C4;JSMYTM[=)&"QQ0(\A4>3 F3@D%L-ZBO,?@=+\7?AG?:CXK\3?L]^ M*/&7Q*UD :GXDN-?TI,("=L%O'YY$,*@X"KUQD]L 'U-\&/ U_\ !SX$>%?" MIQJNJ:#HT5JP#X$\R1\JI/0%N 3[&OF3X)^.=5^'_P 9Y_$7Q\\'ZQX>\?>, M[S^S-'UJX$5UI%A!D^38021NQA+=6+ ;V[\5[?XV\0_&J^\.^$O%G@[PW86E MZF\ZWX"UZZC6>52<+Y=Y&6177'3!4[O:O/O&F@_%?]JB_P#"_A_Q%\.?^%8^ M#=-UBVUC5;O4]6M[V[NS;OOCAMT@SM#,!EV8$#MZ@'UO$+>)?V+O@=XQ\0:AKFM?#/0=2U; M4)FN+J[GA)>:1CEF8YZDU[3FC- 'Y%^"/V>?AMJ'_!5/Q7\/+GP=IQ\1>&OASHFC:W8N7MKZUA M(DB8@J2#GT)'XU\8?#L_\;G_ !K_ -@J3_TB@K],,T ?EI\$?C!X.^!__!0C M]IOQ1XWUVVT#184E3SY\LTCFYBPD:*"SL<'Y5!/!]*^D_ 7_ 5._9^\?>*[ M?08O$5_HL]S((8+O6;!H+:1R< >8"0F?5]H]Z^8/@-\&?#/Q<_X*F_&F?Q3I M=OK5EX?N+G4(+&\C$D+SF6.-&=#PVW%[_]E#4/$/\ M8ME!K6A7MH;&]AMU26)'E$;QA@,["&^[TR >U 'W$\\<<)F:1%B"[S(6 4#K MG/I7R3\0?^"I_P"S[\/O$4^C'Q%?>(;BW%O\ @ESX N;6]FBU3Q3IFEZ3T^S&N'_9G_ M &X/V>_V>_A+HOAFQ^$7CN;4Q:1C5M33P]9R/?W!4>8[2-<[F0MG:#@!<<"@ M#]"?@=^T=\//VC?#\NK^ ?$<&M0P$+(-1M7,5PF@6;7,<3@X*^:2L;$?[+'%>]>-OAEI M?B/P5XAT33FC\*W&K:8^F-J^EV\<=Q;Q%2HVG'\()P#P*^,_@Y\4_P!D;]A/ MPE<>$%^(.E>(O$*3RO?ZK:Z:][=7+ECB-I((W0!1A=N\#@GJ30!]"?L_?MQ_ M"#]I;59-(\'>(G&O)&9?[(U.W:VN60=60'Y7QWVL2.I %;WQ>_:E\#_ _P ? M>#/"/BF6\MM0\5NZ65Q'$IMHMK*&::1F&Q1N!S@\9K\R]7^-OPW^+G_!1OX+ M^+?A-HE[H%GP_\%3? 47Q3_:1 M_9U\(3R-#;ZU. M1?8^H.00>000<&N=7X%> %^&'_"NQX3TL>#?L_V;^R?LR^5MQC=T^_WW_>SS MG/-?GG^PA\0]0_9]7]JCP##<27ND^ A>ZMI23$L$:(S(1_P+9$3[@^M 'V)\ M?/V\O@W^SCK)T3Q5XD>X\0* TFD:1;M=7$0(R/,QA8R1@X9@<'.,4OP"_;P^ M#G[1^L?V+X4\2/!X@*EDTC5K=K6XE4#),>MZE+QQ1'!VQO+.A5RQ_8+<:;;K,WF;2WS LN!@=:]8MYUN8(Y MD^Y(H<9ZX(S7YI_\%6?$,WB[]FGX&Z[<1&&XU/5+2]DB(QL:2SWD8[8+5^DF MD'_B4V7_ %P3_P!!% 'D/PY_:X\"_%'QC\1?#.BIJHU+P&9!JWVFU5$.QG5O M*(<[N8VZ@=J_-/PO^WAX!TW_ (*%>)?C#?'Q!-X,N]&_L^SA^R![F-O+A&/* M+X5=R.>#WSWKWS_@G8?^,T/VI_\ L*M_Z63TOPX/_&Y+X@_]B]_[;VM 'L_[ M0?Q"^ =_\1_@;??$+PWJ>K^)M;EAN?"-W")5%H\DD+*90DR@?,T9(8/T/X_2 M7CKQ_P"'/ACX7O?$?BK6;30=#LEW3WM[($1?0>I)/ 49)/ !KX%_X*1'_C+; M]EK_ +#*_P#I7;U6_P""C;3?&3]K#X#?!&\N9H?"^HW"7^HPQN5\XO*R'/N( MXW /;>: /5D_X*W_ +.SZ]_9_P#;>M+;;]G]IMH\OV;&?O8_UF/^ 9]J^M/" M'C'1/'WANP\0>'-4M=9T6_C$UM?6<@>.53W!'X@CJ""#S7,W_P !/AYJ'PYE M\"/X.T9/"LEL;4:;'91K&B[F^)] M2\1Z;WYK\SO@L?^-R'Q/\ ^P9/_P"B M;:OTQS7YG?!8_P#&Y#XG_P#8,G_]$VU 'V9\1?VM/A]\*OB_H_PY\37MSINL M:EITFJ)>RQHMC#;HLC,TLI8;<")^Q[>M>.R_\%9_V=8O$ATK_A(-6>W$GEG5 M4TF4VO7&[_GICWV5X!^WA\.]-^+/_!2/X*>$]9C,VD:GI]M'=P@D>;$MQ.[I MD=F"D?C7V]\?_@AX%UW]G/QAX9D\*Z3#I%KHET]G;P64<:VCI"S1O%@#8RE0 M01B@#:^(G[1G@KX=?!67XJ3W\FL^#EBAFCO-%47!F25U1&09 /+#/(QSZ5^: M_P#P3-_:]\(> _'_ (W\/^(6UJ[UOQ]XF@.FSQV_G*2[.H,SEP5Y=?7O7TU_ MP2!U2YU#]CV.&XF>5++7KZW@#'.R/$;[1[;G8_C7"_\ !'\\_';_ +&2/_VM M0!]E_'+]I'X=?LXZ##JOC[Q)!HT=P2MK:A6FN;DCJ(XD!9L<9.,#(R17B7P\ M_P""IO[/WQ#\1P:*OB*^\/7-PXC@GUVQ:WMY&)P 9065,^KE1[U\-^,/VA? MUU_P4+^('B[XO^%]>\=Z'X9FETK0M&TJQBO(K=X7$:O)%+*B[>)'QSEVSCBO M1_VG/VWO@!^T/\(M:\+S_"+QU%K!M'&CZC)X>LXVL;D#]TP=;DLJ;L!@ ,]8::31='LWOK@VBB21HE&3L&0"<=.:^:=<_X*I? M +P_I'A^^N=9U21]8M_M2V=OIYEGM(RS*#.%;"$[20H);&#CD5XY\&_'6O>- M_P#@D?XZ3Q%]I:_T72M1TA)+M6$C0QJK19SR<*X4>RUW?_!*+X/>%M/_ &2M M/UZ?1+"]U3Q+=74E]:&=7MO$-I8KJ2KJ=B;9+BW98W5X]QW'*2HV&53@\CC%>K>/_ !SI'PT\ M$ZYXKUVN.G% 'WW\' M_CAX'^/?A1?$7@3Q#:Z_I>[RY&ARDD#XSLDC8!T;V8#/49%+/ GB/5I]"U'PQIZZEJ-]?0A;01,(RJHX8L[GS4 4+DG@9KX%_8[^*^@Q_ M\%$)Y_A7X9\0>$_AOXTM)(;K1=5LEMDAG6%I=RI&[HJB1"5PW D8 5T6N_" M70/C'_P6%US2?$]C%JFC65C%J4MA<+NBN&BLXMBNIX9=S*2#P<8/% 'T=X=_ MX*P?L\>(/$L>D'Q#J>EI))Y<>I:AIDD=JQ)P"6&64>[* .^*]'_;$_:(\,_ M_P" >IZWJ=Q>RP:_:S:9IEUHZ"4^?-;2-%)N##"<9W GMBN(_P""COPF\):Y M^Q[XVNI= T^.\T&S2[TRXAM41[5ED08C(&5!4E2!P0:I_LTZKYR=L:W$:#\%51^% '@?_ 22_:D\(:=X,TWX.7:ZK)XSU/5; MZ_CF%N&M2AC#G=*6SNQ&W;KBOIK]FSQ+\#-6_:&^+UE\.O#E_I/C^TN&'BB_ MN3+Y5U)Y[@E-TKK]_OX5Y__ ,$>C_QB$/\ L8+W^45<+^P"X3]NC]J9 MCT%](?\ R;DH ^N?C[^UO\+/V:8(/^$[\316%_FX1H"57K M\S;5X/->..2.>:^AO^"C?[.G@_P")7[-GB[7Y-%L[7Q/X:L7U/3]5@@6.=/*^9HBX M )1E!&T\ X(Y% 'T#\:/C!H'P'^&VK^./$PNFT32Q&TXL8A++\[J@VJ2 >6' M>O"O'?\ P4W^ _P]TS1+B_U^]O+W5;*'4%TO3K,SW-M%*@=/.P=D;;6!V%]W MMC%?//BKXFZI\5_^"-]UK.M3R7>J06L.G37,I)>7R+](U9CW)55R>YS7O/\ MP3;^!OA#P5^ROX-UN#0[&;7O$=E]OU'4IK=7GFWLVU"Y&=BKM 7IU.,DT >N M?L_?M7?#/]IO3KNX\!>(!?W-D%-WIUS$T%U;@]"T;#E3TW+E<\9S7KN:_-'P M7X3TOX5?\%BKG2/"UG%HND:QH4MSHQ^RUX _ MY\KO_P #'_QKUS-&:XOJ6&_Y]K[CA^H87_GVON/(_P#AEKP!_P ^-W_X&2?X MT?\ #+7@#_GQN_\ P,D_QKUS-&:7U'#?\^U]POJ&%_Y]+[D>1_\ #+7@#_GQ MN_\ P,D_QH_X9:\ ?\^-W_X&2?XUZYFC-'U'#?\ /M?<'U#"_P#/I?1_\,M> /^?&[_\ R3_ !H_X9:\ ?\ /C=_^!DG^->N9HS1]1PW_/M? M<'U#"_\ /I?// M#]KX8O9_LMMJ\NHQ"UFFVLWEK)G:6PK'&%OBGX.\<:OJ>E>'O$^DZYJ.F!&O;73 M[M)WMPV=I<*3MSM.,^AI@=1FC-8%A\0/#6J^*]1\,6>NV%UXBTZ)9[S2X;A6 MN+>-L;6= 8O//2LCQ'XRT+P?#:3:YJU MII,5W=1V5N]Y*(Q+/(<1Q+GJ['@*.30!L'!!![TQ(U3N3]367H7C'0_%#ZBN MD:K::DVFW"UE#_9[A,;XGQ]UUR,@\C-5O!_Q!\,_$'3[B^\,Z[8:_96] MP]K+<:=<+,D] &Z8U+$Y.?K2^6M8,GQ"\,P^,X_"+Z[8+XI MEM#?)HYN%^U-;AMIE$>=VW((SCM57QQ\5_!GPSMH+CQ;XITGPW#/D1/JEXEN M),8SMW$9ZCIZT =.85/<],4I167':N"\1?M ?#3PCH&EZYK7CSP_IFC:HS+8 MW]SJ,207)7&X1N3AB,C.*O\ @_XQ^!?B#HUWJWAGQ=HVO:9: FXO-/O8YHH0 M 22[*2%'!Y/H: .M$2@YSS2A .]Q MO8Y4M@H)8R%2=H !.3Z5C^#?VE_A1\1/$%OH7ACXB^&]?UFX#-#8:=J44TT@ M4;F(522< $GZ4 >E9HS1FC- !FBC-% "T444 %%%% !1110 4444 ?F=\._^ M4S_C7_L%2?\ I%!7Z8US-O\ ##P;9^-)_&$'A+0H/%LZ>7+K\>FPK?R+M"[6 MG"^81@ 8+= !734 ?G)^QU_RDX_:3_ZY3?\ I3#7L'_!5?\ Y,I\8?\ 7U8_ M^E*5]+Z-\-O"/AWQ/J7B32O"NBZ9XBU,$7VKV>G0PW=V"03YLRJ'?D _,3R! M5SQ7X/T'QWHDVC>)=$T[Q%I$Q5I=/U6TCNK>0J'H#=>(M,T/3=6L+4?>N'BAPT2_[3([X]3@=Z9^RU_P % M-_AAIWPHT?PQ\5M5NO WC7PY:IIE[!?Z?<.MP85"!U\N-BK84;D8 ALXS7WG MHVC:?X=TJTTO2K&VTS3;2-8;:SLX5AAAC485$10 J@= !BN6\6_!'X=>/M1& MH>)_ /A?Q'?C %UJ^C6UU*,=/FD0F@#Y2^"7[;7CO]J3]J&32?AAH5M_PI/2 MHL:IK^KV$JS2L 3F)@ZA&=BH5&!(4%B!T'"_%#_E,E\-_P#L ?\ MM=U^AFA M>']+\+Z9#INC:;9Z1IT(Q':6$"01)_NHH 'X"LNZ^&OA&^\96WBZY\*Z)<>+ M+:/RH->ETZ%KZ),$;5G*[U&&88!Z,?6@#RG]NS3_ !7JO[)OQ'M?!:W,FNR: M=Q'9Y\YX-ZF=4QR28MXP.3S7Q-^PO\;?V0?AS\"M&'B^WT#2OB!:B0ZM<:[H MCW=W)+O8AHI/*?Y-NW"H1C'(SR?U3K@=1_9^^%VKZX^LWWPV\(WNL._F-J%Q MH5K)<,W7<9#&6S[YH _+3XH_M VWQU_;X^ WC'2- O\ 1/AY::G:Z7H>HZA: MFV340EQF66-2!A TJJ![#.#D#TW_ (*Q^*-6\$_M ?L^Z_H5G)J.L:;/-=VM MG$I9[B1+B%A& .26QCCUK]%/$_PM\&>-GTI_$7A'0M?;26WZ>VIZ;#I\L_*OW"V_&/?BN!_P""?G[./B#Q=\./C%X^\?V, MNCZC\6A<1PVTR%9([242DR[3R S2Y4'J$!Z$5]L7'P2^'5YXF_X2.?P#X8G\ M0[_,_M:31K9KO?\ WO-*;\^^:[6@#\K?V+OVFK/]@^_\3? OXZV]YX6CM-1D MO=+UK[+)-;NCX!^XI8QOM#*Z@CYF!QBO4?B]_P %*+OQ]X[\+> ?V8+.'QYX MEO[H&]U"_P!-G^Q0P]",,8WP,[FD.%4+P3GC[@\8_#OPI\0[..T\5>&='\36 ML9)2#6+"*[13ZA9%(%,\&_#7PA\.8)8/"?A71/#$,N/,CT;3H;17^HC53P3 M70:!_P %6/@5_P *MTW59-9OY?$YM(T;PM;Z;.]VUSM \I6V>606Z-OQ@^O% M?:3HLB,CJ&1A@JPR"/2N*TCX&_#?P_XA_M[2_A]X6TW7 V_^T[31;:*YW>OF MJ@;/OF@#\^_^"5%YKFI?M(_M!W_B339-'UZ]>&\O-/F&'MY);B60QL.Q&[&# MS6;XU^+_ (:_9F_X*P^+/%GQ!N9]%\.ZCH<<45\MK+./GMX0K;8U9BNZ)ERH M.#^-?I;H?P]\+>&=>U;7-'\-:/I.M:NP?4=2L;"*&YO6!)!FD50TAR2?F)ZU M5\;?"CP1\2_L_P#PE_@[0/%7V?(A_MO2X+SRL]=OFJV/PH _/_\ X* Z_8>* M_P!I?]DC6M*N!=Z9J.H0W=KYMF1L$ C((." :Z3_@I=\/O%'@SXD? M"W]HCPKI,VMIX)N$35[2W4LRVZR^8KD#D)\TBLW\.Y2>*^V+_P"$'@/59- D MO?!/AV\?P^JKH[7&DP.=-"X*BW)3]R!M7&S&-H]*ZUE#J58!E(P01P10!\:: MI_P5C^ -O\.I?$%EK][=ZX;VV_P ^%] MGKHUN#X;^$8-9#^8-1CT*U6X#]=WF"/=GWS7>T %?F=\%O\ E,A\3_\ L&3_ M /HFVK],:YFR^&'@W3?&5UXNM/"6A6OBRZ4I<:[!IL*7TRD $/.%WL"%48)[ M#TH ^"OVG?\ E*_\ ?\ L'Q_^AW5?=?QB_Y)'XW_ .P'>_\ HAZN:I\-?".M M^+-/\4ZCX5T2_P#$VGKLL]:NM.ADO;9>>(YF4N@^9N%(ZGUK>O+.WU&SGM+N M".ZM9T:*6"9 Z2(PPRLIX(()!!ZT ?#W_!',9_9%NO\ L9;W_P!%P5X5_P $ MX?V@/!7P#^*WQ8^'OCO49] \2:]XJ2WTZ&6SFD6:82RQ>6612$.YEY? YZU^ MG_@WP'X9^'6D'2O"GAW2?#&EF5IC8Z-8Q6D!D8 ,^R-57<0!DXSP*R-=^"7P M[\4>)(O$.L^ O#&KZ_$Z21ZK?:-;S72.I!1A*R%@00,'/&!0!^=?C'7=2_X) MW_MX^)_B!KVCWU[\)_B'O,NI641D%O)(PD8>F]) QVYR4;(R>*]D^.?_ 58 M^%.@?#^Y_P"%7:R_CCQU?((=+TZ'3+E4CE;A7E\Q$R!G[BY8G P,Y'VOK&B: M=XBTV?3]5L+74["<;9;6\A66*0>C(P((^HKE/"WP+^&W@;5!J7AOX?>%?#^H MCD7FE:+;6TP_X&B _K0!\]?$K7?B-XH_X)Q^.M7^*EAI^D^,K[PW=SW%AIT# MPK;QL/W:.KNY$FW!89&"<8&*O_\ !+K_ ),E\ _[U[_Z5RU]0:YH6F^)M(N] M*UC3[75M+O(S#/V8_&?AV&'SM6M[8ZGIN!E MA\$^*/$L,DFE?"CPM;V2>;R)+M0T<;G_ M &B2S^O[H5^N) 8$$9!Z@US?@WX9^#_AU]N_X1/PIHGAC[?();O^QM.AM/M# MC.&D\M5WGD\G/4T ?+?_ 5%_9]\0?&[X$V&I^$K274/$GA*_P#[4ALH%W2S MP[=LJQCJS#"L .3M('.*R?@I_P %5_@SKOPXL)/'VO3>#?%]E;K#J6F76GW, MN^9!AFB:*-@0Q&0#AAG!'&:^WZX3Q'\!OAGXQU=M5U_X=>$]+X?"NB0^+9X_)EUZ/3H5OY$P!M:<+O M(PH&"<8 ]* /'_\ @H'_ ,F:?%7_ +!)_P#1B5P?[(.FW&L_\$S] L+2-IKJ MZ\+:I!%&HR6=GN0H'N217U?X@\.Z3XMT:[TC7-,L]9TF[3R[BPU"W2>"9WA!))"1H JC))X'4F M@#\X_P#@D=^TCX"T'X;VWP?U/5I;#Q]=:U=SVNFRVDQ6=#&K'$@4HI C?AB# MQQFM7_@G^,_MT_M2@]#?O_Z625]S0?!+X=VWBY?%36CX?^&WA'PEKNJZWH?A;1=&UG56WZAJ.GZ=#!<7C9+9F MD10TAR2?F)Y- 'YG_"GX@_\ #L[]J7XA^&OB+I]];?#/QI=_;]*\06UNTT4> M'=D)"@EL+(4=5RP*@X(-=M^V9_P4#\$?%[X67_PJ^"LU]\0/%_C!1IH_L^PG M1((G(WC]XBEG900 H( ))(Q@_H1XD\*:)XRTM],\0:/8:YITAR]GJ5JEQ"Q] MT<$'\JQ_!GPB\"_#B:67PGX*\.^%Y91MD?1=*@M&<>A,:+F@#XA^.7P6NOV? MO^"3.I>"M1*'5K.RMIK_ ,LY5;B6]CDD4'OM+;<]]M?2G["7_)GWPF_[ 4'] M:]B\3^%-$\;:)PU[1[G GT_4[5+FWEP01NC<%6P0#R.H%3:#H&F>% MM'M-)T73;32-*LXQ%;6-A L$$"#HJ(H"J/8"@#\^-0_Y31Z7_P!BTW_I#)7Z M+5SC?#?PD_C1/&#>%M%;Q(]I78)]OF;=I(QNQ@XKHZ "BBB@ M HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** " MBBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH ** M** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHH MH **** "BBB@ HHHH **** "BBB@ HHHH **** "ORH_:2N?'7[1'Q@\<>-_ M!'@;6/$EAX&DBTCPQKNG7D44%C>VD:G:^"M+EQH]MFWN42UW% LC8#D+M / X-?J!:>#M L)+* M2VT33K=[$R-:M%:1J;5*N=LBY!VL,G!'(S0!^;?PZM=0\1_''XX:CXC\*>'_ (3^(?#?@.[TJ3PE MH1PNIK(CR"]W!%251@*&49&5!Q7/?!GX@>&_ACXR_8_U[Q7K%IH&C0> =41[ MZ]?9&K,Q"@GMDG%?J!<>&-'N]0>_GTFRFOGA-NUS);HTIB/5"Q&=IRTM[OPOHUU!:)Y=O%-I\3K"F<[4!7"C/84 0^ _B'X:^*WA]-;\*Z MU::]I#2-&M[82"2(NI^9<^H[_6O@Z--?^"7[1?[5<'P9\#PZEKL>F>'H].TC M3XDCCBDFMF+SE,J&VLS.1D;B>>M?H5HV@Z9X*/!W[ M6_Q"TV/PKXBB\6ZIX2BN+V\\6R1Y&H'=)]HN?+=BL,LF%4)D@$#%>E?MD>&O M'_B/]CCXF:I\9=#\"R:SHT$$V@W'AEKF?[,7GB65BUPBE6(P/E[$U]TQZ'IT M6IRZDEA;)J,J"*2[6%1*Z#HK/C) ]":?J>D6.M6,MEJ-E;W]G*,26]U$LD;C M.<%6!!Y - 'YN_M%_P!B_#SXHZ/XONO$'P_U"[U'P):6DGA[XA65Q=?9HE4X MELQ&C!G8@@QDJ6Y^8 YKZD_X)\Z%XA\-?L@_#JP\3K/'JJ6:1 MH5(/(Q$8QS7NNH>%M%U86POM(L;P6I!@%Q;))Y6.FS(^7\*TU4(, 8'H* /G M#X5>'/CY8?M+?$+4?&NM:;>?"BX,G]@64!4R1_.#$-H 92J9#[LY8@BO#?\ M@HE)+K_QB^#OAQ=%\;ZG!'<3ZM/'X6U(6WGQ6Z,Q,0,BA9XW,;^8<;5)VG.: M_0#8O/ YJG=:'IU[=Q75Q86MQ=0HT<,O$VCZ?XK'C/X@Z[)8Z#!K=[]J:^N;J1UBGMP7))".QDD/+M%N.1@G M<_8TU#5?V6OC-+X(\5^$=2^'?A/Q?HR7-@FL7T4ZOJ5C"OVJ174X'FH=Y7J# M[5^B7_"*Z*;>Q@_LBP\BP8/:1?9DVV[#H8QC"'W&*DU3PYI.N- =1TRSU P$ MM";J!9/+)&"5W XR..* /R5UGQC\0=1\>7G[4%K\.]=N+*U\2?VA9>(4NXOL MX\-QJ;=K?R,[R64LY8<9/XU[9?>*_AUIW[:'C3Q5\:VL+SPIKN@Z=-X!U76[ M?S],%MY(^U(A9619"[9]<%O[P%?H N@Z:FD_V6NGVJZ9Y?D_8A"HAV=-NS&- MOMC%07?A'0]0TR'3;K1M/N=.A $5I-:H\48'3:A&!CV% 'YV?M!W7@WQ!'^S M5+\%/">C:QH4OBW4O[/T2^MVL;"]F\O,@8.A^0G)#;2O Q47P0U'PE_PEW[1 M_C'XMZ!H'PYTBPTRUT+7O 6F*P38&R+IU55$AE9D6-TZ[NV03^CLOAO29WL7 MDTNSD:P;=:,]NA-N<8S'Q\AQQQBJU_X*\/:K/=37N@Z9>37<:Q7$EQ:1R-,@ M(95X% 'P1^R%XK^&_CWXO\ C;XG:,/#WA;0T\)MI=IX"T@+)=-I ML$H>2]O((U*F5LH@4;C@X.2><3]G3Q+X3G_;HT[5_!MQX;\?:9XOL[R1)=-T MA[&Y\(6\*;HXF08C7S"VQCMWDC)..OZ':)X"\,^&KMKK2/#NDZ5_\@_X4NT/O?\ D6_^%^> O^ACM?R;_"C_ (7YX"_Z M&.U_)O\ "JG_ SA\//^A=7_ ,"Y_P#XNC_AG#X>?]"ZO_@7/_\ %T7S#M#[ MW_D'_"EVA][_ ,BW_P +\\!?]#':_DW^%'_"_/ 7_0QVOY-_A53_ (9P^'G_ M $+J_P#@7/\ _%T?\,X?#S_H75_\"Y__ (NB^8=H?>_\A?\ "EVA][_R+?\ MPOSP%_T,=K^3?X4?\+\\!?\ 0QVOY-_A53_AG#X>?]"ZO_@7/_\ %T?\,X?# MS_H75_\ N?_ .+HOF':'WO_ "'_ ,*7:'WO_(M_\+\\!?\ 0QVOY-_A1_PO MSP%_T,=K^3?X54_X9P^'G_0NK_X%S_\ Q='_ SA\//^A=7_ ,"Y_P#XNB^8 M=H?>_P#(7_"EVA][_P BW_POSP%_T,=K^3?X4?\ "_/ 7_0QVOY-_A53_AG# MX>?]"ZO_ (%S_P#Q='_#.'P\_P"A=7_P+G_^+HOF':'WO_(?_"EVA][_ ,BW M_P +\\!?]#':_DW^%'_"_/ 7_0QVOY-_A53_ (9P^'G_ $+J_P#@7/\ _%T? M\,X?#S_H75_\"Y__ (NB^8=H?>_\A?\ "EVA][_R+?\ POSP%_T,=K^3?X4? M\+\\!?\ 0QVOY-_A53_AG#X>?]"ZO_@7/_\ %T?\,X?#S_H75_\ N?_ .+H MOF':'WO_ "'_ ,*7:'WO_(M_\+\\!?\ 0QVOY-_A69JGQ3^%.MWMI>:C>Z-? MW=FVZVN+JU$DD!R#E&9"5.0#QZ58_P"&_\BW_ ,+\\!?]#':_DW^%'_"_/ 7_ M $,=K^3?X54_X9P^'G_0NK_X%S__ !='_#.'P\_Z%U?_ +G_P#BZ+YAVA][ M_P A_P#"EVA][_R+?_"_/ 7_ $,=K^3?X4?\+\\!?]#':_DW^%5/^&_\ (M_\ M+\\!?]#':_DW^%'_ OSP%_T,=K^3?X54_X9P^'G_0NK_P"!<_\ \71_PSA\ M//\ H75_\"Y__BZ+YAVA][_R'_PI=H?>_P#(M_\ "_/ 7_0QVOY-_A1_POSP M%_T,=K^3?X54_P"&_\BW_ ,+\\!?]#':_DW^%'_"_/ 7_ $,=K^3?X54_X9P^ M'G_0NK_X%S__ !='_#.'P\_Z%U?_ +G_P#BZ+YAVA][_P A_P#"EVA][_R+ M?_"_/ 7_ $,=K^3?X4?\+\\!?]#':_DW^%5/^&_\ (M_\+\\!?]#':_DW^%'_ M OSP%_T,=K^3?X54_X9P^'G_0NK_P"!<_\ \71_PSA\//\ H75_\"Y__BZ+ MYAVA][_R'_PI=H?>_P#(M_\ "_/ 7_0QVOY-_A1_POSP%_T,=K^3?X54_P"& M_ M\BW_ ,+\\!?]#':_DW^%'_"_/ 7_ $,=K^3?X54_X9P^'G_0NK_X%S__ !=' M_#.'P\_Z%U?_ +G_P#BZ+YAVA][_P A_P#"EVA][_R+?_"_/ 7_ $,=K^3? MX4?\+\\!?]#':_DW^%5/^&_\ (M_\+\\!?]#':_DW^%'_ OSP%_T,=K^3?X5 M4_X9P^'G_0NK_P"!<_\ \71_PSA\//\ H75_\"Y__BZ+YAVA][_R'_PI=H?> M_P#(M_\ "_/ 7_0QVOY-_A1_POSP%_T,=K^3?X54_P"& O^ACM?R;_"JG_#.'P\_P"A=7_P+G_^+H_X9P^'G_0NK_X%S_\ MQ=%\P[0^]_Y!_P *7:'WO_(M_P#"_/ 7_0QVOY-_A1_POSP%_P!#':_DW^%5 M/^&_\ (/\ A2[0 M^]_Y%O\ X7YX"_Z&.U_)O\*/^%^> O\ H8[7\F_PJI_PSA\//^A=7_P+G_\ MBZ/^&_\BW_POSP%_P!#':_D MW^%'_"_/ 7_0QVOY-_A53_AG#X>?]"ZO_@7/_P#%T?\ #.'P\_Z%U?\ P+G_ M /BZ+YAVA][_ ,@_X4NT/O?^1;_X7YX"_P"ACM?R;_"C_A?G@+_H8[7\F_PJ MI_PSA\//^A=7_P "Y_\ XNC_ (9P^'G_ $+J_P#@7/\ _%T7S#M#[W_D+_A2 M[0^]_P"1;_X7YX"_Z&.U_)O\*/\ A?G@+_H8[7\F_P *J?\ #.'P\_Z%U?\ MP+G_ /BZ/^& O^ACM?R;_"JG_#.'P\_P"A=7_P+G_^+H_X9P^'G_0NK_X% MS_\ Q=%\P[0^]_Y"_P"%+M#[W_D6_P#A?G@+_H8[7\F_PH_X7YX"_P"ACM?R M;_"JG_#.'P\_Z%U?_ N?_P"+H_X9P^'G_0NK_P"!<_\ \71?,.T/O?\ D/\ MX4NT/O?^1;_X7YX"_P"ACM?R;_"C_A?G@+_H8[7\F_PJI_PSA\//^A=7_P " MY_\ XNC_ (9P^'G_ $+J_P#@7/\ _%T7S#M#[W_D+_A2[0^]_P"1;_X7YX"_ MZ&.U_)O\*/\ A?G@+_H8[7\F_P *J?\ #.'P\_Z%U?\ P+G_ /BZ/^& O^ MACM?R;_"JG_#.'P\_P"A=7_P+G_^+H_X9P^'G_0NK_X%S_\ Q=%\P[0^]_Y" M_P"%+M#[W_D6_P#A?G@+_H8[7\F_PH_X7YX"_P"ACM?R;_"JG_#.'P\_Z%U? M_ N?_P"+H_X9P^'G_0NK_P"!<_\ \71?,.T/O?\ D/\ X4NT/O?^1;_X7YX" M_P"ACM?R;_"C_A?G@+_H8[7\F_PJI_PSA\//^A=7_P "Y_\ XNC_ (9P^'G_ M $+J_P#@7/\ _%T7S#M#[W_D+_A2[0^]_P"1;_X7YX"_Z&.U_)O\*/\ A?G@ M+_H8[7\F_P *J?\ #.'P\_Z%U?\ P+G_ /BZ/^& O^ACM?R;_"JG_#.'P\ M_P"A=7_P+G_^+H_X9P^'G_0NK_X%S_\ Q=%\P[0^]_Y"_P"%+M#[W_D6_P#A M?G@+_H8[7\F_PH_X7YX"_P"ACM?R;_"JG_#.'P\_Z%U?_ N?_P"+H_X9P^'G M_0NK_P"!<_\ \71?,.T/O?\ D/\ X4NT/O?^1;_X7YX"_P"ACM?R;_"C_A?G M@+_H8[7\F_PJI_PSA\//^A=7_P "Y_\ XNC_ (9P^'G_ $+J_P#@7/\ _%T7 MS#M#[W_D+_A2[0^]_P"1;_X7YX"_Z&.U_)O\*/\ A?G@+_H8[7\F_P *J?\ M#.'P\_Z%U?\ P+G_ /BZ/^& O^ACM?R;_"JG_#.'P\_P"A=7_P+G_^+H_X M9P^'G_0NK_X%S_\ Q=%\P[0^]_Y"_P"%+M#[W_D6_P#A?G@+_H8[7\F_PH_X M7YX"_P"ACM?R;_"JG_#.'P\_Z%U?_ N?_P"+H_X9P^'G_0NK_P"!<_\ \71? M,.T/O?\ D/\ X4NT/O?^1;_X7YX"_P"ACM?R;_"C_A?G@+_H8[7\F_PJI_PS MA\//^A=7_P "Y_\ XNC_ (9P^'G_ $+J_P#@7/\ _%T7S#M#[W_D+_A2[0^] M_P"1;_X7YX"_Z&.U_)O\*/\ A?G@+_H8[7\F_P *J?\ #.'P\_Z%U?\ P+G_ M /BZ/^& O^ACM?R;_"JG_#.'P\_P"A=7_P+G_^+H_X9P^'G_0NK_X%S_\ MQ=%\P[0^]_Y!_P *7:'WO_(M_P#"_/ 7_0QVOY-_A1_POSP%_P!#':_DW^%5 M/^&_\ (/\ A2[0 M^]_Y%O\ X7YX"_Z&.U_)O\*/^%^> O\ H8[7\F_PJI_PSA\//^A=7_P+G_\ MBZ/^&_\BW_POSP%_P!#':_D MW^%'_"_/ 7_0QVOY-_A53_AG#X>?]"ZO_@7/_P#%T?\ #.'P\_Z%U?\ P+G_ M /BZ+YAVA][_ ,A?\*7:'WO_ "+?_"_/ 7_0QVOY-_A1_P +\\!?]#':_DW^ M%5/^&_\A_\*7:' MWO\ R+?_ OSP%_T,=K^3?X4?\+\\!?]#':_DW^%5/\ AG#X>?\ 0NK_ .!< M_P#\71_PSA\//^A=7_P+G_\ BZ+YAVA][_R%_P *7:'WO_(M_P#"_/ 7_0QV MOY-_A1_POSP%_P!#':_DW^%5/^&_\ (?\ PI=H?>_\BW_POSP%_P!#':_DW^%'_"_/ 7_0QVOY M-_A53_AG#X>?]"ZO_@7/_P#%T?\ #.'P\_Z%U?\ P+G_ /BZ+YAVA][_ ,A? M\*7:'WO_ "+?_"_/ 7_0QVOY-_A1_P +\\!?]#':_DW^%5/^&_\A_\*7:'WO\ R+?_ OSP%_T M,=K^3?X4?\+\\!?]#':_DW^%5/\ AG#X>?\ 0NK_ .!<_P#\71_PSA\//^A= M7_P+G_\ BZ+YAVA][_R%_P *7:'WO_(M_P#"_/ 7_0QVOY-_A1_POSP%_P!# M':_DW^%5/^&_\ M(?\ PI=H?>_\BW_POSP%_P!#':_DW^%'_"_/ 7_0QVOY-_A53_AG#X>?]"ZO M_@7/_P#%T?\ #.'P\_Z%U?\ P+G_ /BZ+YAVA][_ ,A?\*7:'WO_ "+?_"_/ M 7_0QVOY-_A1_P +\\!?]#':_DW^%5/^&_\A_\*7:'WO\ R+?_ OSP%_T,=K^3?X4?\+\\!?] M#':_DW^%5/\ AG#X>?\ 0NK_ .!<_P#\71_PSA\//^A=7_P+G_\ BZ+YAVA] M[_R%_P *7:'WO_(M_P#"_/ 7_0QVOY-_A1_POSP%_P!#':_DW^%5/^&_\ (?\ PI=H?>_\BW_P MOSP%_P!#':_DW^%'_"_/ 7_0QVOY-_A53_AG#X>?]"ZO_@7/_P#%T?\ #.'P M\_Z%U?\ P+G_ /BZ+YAVA][_ ,A?\*7:'WO_ "+?_"^_ 7_0QVOY-_A2_P#" M^_ 7_0R6G_CW^%4S^SA\//\ H75_\"Y__BZ3_AG+X??]"ZO_ (%S_P#Q=.^8 M=H?>_P#(I?VCU4/O?^1=_P"%]> _^ACM/_'O\*!\>O 9_P"9CM/_ ![_ JG M_P ,Y_#[_H7E_P# J?\ ^+H_X9T^'_\ T+R_^!4__P 71?,.T/O?^0?\*']S M[W_D7?\ A?'@3_H8[7_Q[_"G?\+V\"_]#%:_DW^%4?\ AG7X?_\ 0O)_X%3_ M /Q=+_PSOX _Z%Y?_ J?_P"+HOF':'WO_(=\P[0^]_Y%W_A>G@;_ *&*U_)O M\*4?''P.?^9AM?R;_"J7_#/7@$?\R^H_[>I__BZ4?L_> ATT!?\ P*F_^+HO MF':'WO\ R'_M_:/WO_(O#XW^"#T\06OY-_A2_P#"[?!)_P"8_;?DW^%4A\ / M 8_Y@*_^!,W_ ,71_P *#\##IH2_^!,W_P 73OC^T/O?^0T\=U4?O?\ D7O^ M%U^"O^@];G\&_P *4?&GP8?^8[;_ )-_A5(? 7P./^8$O_@3-_\ %TX? GP0 M/^8&O_@3+_\ %4?[?VC][_R*_P!M_N_B7A\9/!I_YCMO^3?X4?\ "X_!W_0= MM_R;_"J0^!7@D=-$7_P(E_\ BJ$/\ H.6_Y-_A1_PN#PA_T'+?\F_PJG_PI/P;_P! 4?\ @1+_ M /%4?\*3\&_] 4?^!$O_ ,51_MO]W\1_[7VC][+?_"X/"'_0;@_)O\*7_A<' MA'_H-P?DW^%4_P#A2?@W_H##_P ")?\ XJC_ (4GX-/_ #!1_P"!$O\ \51_ MMO\ =_$7^U_W?Q+G_"X/"/\ T&X/R;_"D_X7#X0_Z#<'Y-_A53_A27@S_H"C M_P ")?\ XJD_X4CX,_Z H_\ B7_ .*H_P!M_N_B%\7_ '?Q+@^,/A#_ *#< M'Y-_A1_PN'P?_P!!RW_)O\*J?\*1\&'_ )@J_P#@1+_\51_PH_P7_P! 5?\ MP)F_^*H_VW^[^/\ D*^+_N_B6_\ A_\@OB_P"[ M^);/QD\&C_F.V_Y-_A2?\+E\&_\ 0=M_R;_"JA^!G@H_\P1?_ F7_P"*I/\ MA17@G_H"+_X$R_\ Q5*^.[1^]_Y!?%_W?Q+O_"Y/!O\ T';?_OEO\*3_ (7+ MX-_Z#MO^3?X53_X45X)_Z B_^!,W_P 52'X%>"?^@&O_ ($2_P#Q5%\=VC][ M_P @OC/[OXEW_A_P#(+XSKR_B7O^%R^#?^@[;_ /?+ M?X4?\+E\&_\ 0=M_R;_"J/\ PHKP3_T!%_\ F7_ .*H_P"%%>"?^@(O_@3- M_P#%47QW:/WO_(+XO^[^)=_X7+X-_P"@];_DW^%+_P +C\'?]!VW_)O\*I#X M%>"1_P P1?\ P)E_^*I?^%&>"O\ H"+_ .!$O_Q5%\=VC][_ ,@OB_[OXES_ M (7)X-_Z#MO^3?X4?\+C\&_]!VW_ ";_ JG_P *-\%?] 1?_ F7_P"*H_X4 M;X*_Z B_^!,O_P 53OCNT?O?^07Q?]W\2X?C)X-'_,=M_P F_P */^%R^#?^ M@[;_ )-_A5(_ KP2?^8(O_@3-_\ %4G_ HGP3_T!%_\"9?_ (JE?'=H_>_\ M@OB_[OXEQOC/X,7KKUO^3?X4G_"Z?!?_ $'K?\F_PJH?@3X(/_,#7_P(E_\ MBJ3_ (41X(/_ # U_P# F7_XNC_;^T?O?^0KXS^[^);_ .%U^"O^@];_ )-_ MA1_PNSP4/^8_;?DW^%4C\!? QZZ$O_@3-_\ %T?\*"\"_P#0!7_P)F_^+I?[ M?VC][_R%?&]H_>RY_P +N\$_]#!;?DW^%%4O^% > _\ H I_X$S?_%T47Q_: M'WO_ "%?'=H_>_\ (]&HHHKU3TPHHHH **** "BBB@ HHHH **** "BBB@ H MHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BB MB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** M "BBB@ HKP'X:NQ_:_\ C(I8E1INCX&>!^Y->_5U8BA["2C>]U%_^!)/\+G- MAZWMXN5K6 2Q+$Z:N2?]YJZ51O0=>^S2MZIO]#F=:U=4;;IN_HTO MU/6Z***YCI"BBB@ HHHH 3%&*6B@!,4M%% !117(?%2'QS/X.N$^'4^AVWBC MS(_)D\1"4V@3=\^[R@6SCI[TTKNPCKZ*^(O@%\=/VB?B_P"//$^F7%W\/[72 MO!^K+8:ZZVMVLTJ!V$AMN6!.(VQOV\XR*['X6?MA:#X?^"UMXG\?>-E\4WE_ MK-QIU@VDZ+)#/#W7[:WPQL/! M$'B6[N]6M%N+]M,@TJ;2IEU"6Y558QK!MRGS 9R<59TC]L7X<:NGAL? M:-6LKC7]5;1;2UOM+FAF6Z41DI(K#Y1B5#GIS[5'LY]BN:/<]OHKR>?]J/X< MV5YX\M[W6VL/^$(9%UJ6YMW5(F'-* M?5--UY+47T>GZWILME+<6YZ31!P-R\CISCG&*7)*U[!S+:YZY17R[^U?\>?B M-\.?BG\,O!/P]&@+>^+I)H#+K\$KQ)(&0*28V!"_,Z;XR\ M:?##XHZ=HWAOQQIVA7&KZ9K>B+)-8SQI$S[_ "W)8X +8[[6&T'K:I2<>9"Y MU>Q]!?VS_"WAGX4>#;WQCXHG\8^)M>2XEMUT#1)1/=1I,ZEQ;JH**N MW;DXSM)&>:P_B3_P4+T7PMX[^'5KHVGSWOA?7XY)]2N+G3+E;RW179 (HQC< MX9'!7!Q@>M'L9MV2#GC:]S[#HKP/4?VX?A+I'B(:%?:S>VNKM#:3):2:;/YC MBX1'B 4\[9%+ XV\YQ7@GQ"_:S\<>%?@IXQ\2Z1XWL-BK,NBB!; M2W(I< M:?+$\D P&EB5@"XRPXP#@@XQ74R_M0> 89? <37UV7\;V[76B@6L>-/$TGB;7_ !' [VHT729!/?[9 M&!=+91E%& .<9(XS5.C-:6$IQ9])T5X5YVEO+ECQN0@ G.,>A-;GP<_:A\ ?';7M:T;PIJ%U+J6DJ))[>]LY+9FC M)P)$#@$KG'H>1QS4.G)*[0^:.USUFBBBH*"BBB@ HHHH **** "BBB@ HHHH M **** "DQ2T4 )BBEHH 3-&:** #-&:** #-&:** #-&:** #-&:** #-&:* M* #-&:** #-&:** #-&:** #-&:** #-&:** #-&:** #-&:** #-&:** #- M&:** #-&:** #-&:** #-&:** #-&:** #-&:** #-&:** #-&:** #-&:** M #-&:** #-&:** #-&:** #-&:** #-&:** #-&:** #-&:** #-&:** / ? MAH?^,P?C+_V#='_]$FO3?%7QE\#>!_$NF^'_ !!XLTG1];U+'V6QO+I8Y9UEC@BU"R:U,KD1< PMN 4E1C!'!YYZ5[&-476@INRY(?\ I$3RL"VJ4[?S MS_\ 2V?8N1ZT9J.V@6TMHH$W%(T" L$>*/CUXL\1?$G6/ M WPI\*Z?XAO]""#6=;UR^:UT^RE<96 ;$9Y),0Z+X^^. M7A6_<1>)8O%]QJSZO\5O! M/A_6!I.J>,= TW52P46-WJD$4^3T&QF#9/TKQO\ ;-U&UN/#_@*TBN89+JW\ M=:(TT"2 O$&D?:67.1G!QGK@UYAXXMIOCA!\7-4\+_#?XAZ7<7NG:EX@\ M56K7&I7MQ!%B22,1A3'M 4L_4 XK104DGL3S-.Q]HMK%@FHPZ>U];+?S1F: M*U,JB61!U95SD@9'(XHM]8L+N]N[."]MIKNTV_:((Y5:2'<,KO4'*Y'(SUKX MJ_9^U&>^^)_[.%S>SM-//\-[M!)*V6P<^E_ZV/HWXH_M)Z7XV5I$EQ/#Y;D[I0-S@D*Q))R<&O+?B-80:I\._C/974?F6US\8+ M2&5-Q71\#.%4&/A7^U1\#/\ A#] T[PRM[!JMC=KI=LD N(EMU95DV@;\-SELG-?5%82 MBE9KJ:)WW/'?@G^T*?C+XX\=Z(OAG4_#D'AM[5$&LPM;W' M_%^FQ2V]EK%HETD,^-\>>JG'4@@C/?%>9_$[XF?&GPK>^(-2T'X<:!?^$]%5 MIA)?:Z4O=0A1-SO$BQE8_P"( .M?"_X@V'Q5^'OA_Q=ID_$'Q+HUY9Z9;Z-IL$$MM>0ZDDES(74E_- M@QF(#'!/WAS6EX$\&:=\._!FB^&-(C:/3=)M([2 ,:MX?T:TAOI6*HCM&P"L1SM8_*<PT6W6 M?4+VWL(&=8Q+-O@QX;\'^* M9["YCT7Q3X7EBD@NA##F=64(LB93G#ELDCOS73?M[6,&J?!"PLKJ/S;:X\2Z M3#*F2-R-4--&J0&Y+YQM\O=NSGMBOG;XL M^ ?"7PB^//P*N_ ^@Z=X;U*:_N[2\@T>V2 W&G+;%I3*J ;PI .6R^'7PZ\'^#Y&FO;2^FMWEU^5UN,>>)4"K'(S@G!+'D@YJ MXTE*SOHR7-H_0B^\5Z)IDUU%>:Q86DMK&LUPD]TB-"C'"LX)^4$\ G@UYWX M_:1\*>//'?B_PQ'?Z?97.A:A%8022:C$W]HL\8;="N03@G;@9YKP[P[\,/#' MQ?\ VM/$'_"9:1%XBAM?!>C726UZS-"TK;P7>/.USR<;@<9.*W/V=/A=X,_X M7[\<)6\):$UQI'B"S;3I&TV$O9YME;,1*YCRV6RN.>>M+DBD[[V#F;:L?5CN ML:,S,%51DL3@ 5S^A?$?PGXIFO(M%\4:-J\MF"UREAJ$,[0 =2X5CM_&O(?V MYM1N[#]GZ_CAN);2QO=2L++4[B%BI2RDN$6;D= 5.#[$UQ/Q\^&W@WX9>*?@ ME?>"/#^E:'K$_B6WT@1Z7;1Q?;M/EC87$)",-<11I\@C+8QG/&3FO= M_$'BC1O"6GF_US5['1K$,%-SJ%RD$>?3S@OX;&))XH!* (ED"[E0#@*#CVKKOVH?%%G!<>!?"">"=&\<>(O$ M>INNE6OB,@:?;211%GGERK9VJQPH&3DXZ4Y13GRH2;Y;L]?\->,-!\:6+7OA M[6].UVS5MAN-,NX[B,-Z;D)&?:N#_:-^-T7P,\ C5H8[*\UJ]NH;#3;*^NA! M%)-(X7>[=1&F=S$= .VP\&VTE MM8[Q<%59D<_ZS:3EL#((XKJ/V[_#^EZU\/?!LFH:99WTB>+M*A5KF!)"LLPZ?+I\/QHAT^2QTD/%8I&Q'F1P*6+)'EFP,\9JE34M= MAPTYMM[=1ZE"T5J>F)6#80_[V*RO&WQ%FLO M!5EK_@XZ)XDBNKN"%)I]7BM[5XG?:S)-RK,.RC[QXKY[U'X%_#V']MC1-%C\ M&Z+%H;^#7O7TJ.S1;22>.YV1R/"!L=E5B 6!]>H%>5Z[I]OH'P?^*&A:?"EG MI&F_%ZTBLK*$;8K=#VUF;F400"XE M5/-D/1%R?F8^@YKY"\8?#1?B[\:?VE/"X^6[NM!T9[*7O%2_M5?%#X>ZA=QL;3X?:+]LU:)QP-F\4G335U_6@*70^R M2P )) [US^A?$3PIXIU&YT_1O$VCZO?VN?/M;"_BGEBP<'>JL2O/J*\K_;< MU?4=%_9H\7S:;/-:M(MO;W-Q 2'CMI)XTF((Z?(S GT)KS;X_P#PW\%_"K1/ M@]K?@#0],T/Q!!XFTRRTZXTJ!(I;RWERLT;LHS*K)DG=GU[U,8*2UZE.5CLM M _:)\1_$CXUZOX;\'W/@B'PQH>HQZ?=2:OJ,C:CJ)V!YFM(X_EPH) +9!([< MX]%^.WQLTOX$^#H->U*%+L3WUO91VQN5A9O,D5"X+9R$!W'CH.U>/?LK?#KP MG!\6/C7J$?A?1H[_ $OQ?)%872:?");1#;IE8FVY0'K_ /"R MSJOC7PU8>'IM"UOP_J"W0O-1AUB(S0O&@95BA7)ER2-V#\H()K9U7XE^$-"U MC^R-3\5Z)IVJ[/,^PW>HPQ3[<9W;&8-C'.<5X%X[\):-X$_:@^"=EX5T'3=" MM_L/B"9;33+2.VB:4VB?,40 9. ,X[5Y%X/\)^ O$'[#'CGQAXBTW1-3\;7L M&JSZIJVJPQ27D>HAY B>8XW(PPFU01VP.:%3BTG_ %NPYFKH^F]9^/":+\>[ M#PE"_ 7AWX@_'OX-V?B71K37+*V M^%MO=1VM_&)8?,$B ,R'Y6QN/# C//4"N2^(WA+1=(^&W[6N@6FDV4.BZ1JE MC>Z=8+;IY-E-)%&7>%<8C)R?NXX)JE3BVE_6]A7A'QIHOC?2X[[1M4L MM1C*(THL[I)_)9ESM8J3@_6L"[^(DX^*ECX9LSHESIGV.6;4)SJ\:WMK*HRJ M?9?O%2.2W&*M_"WP3X<\%^$[%?#F@:7H4=W;0S3C2[.*W$S^6/F?8!N/N:\) M^*?AW3-,_;*\#7MAI=I:7^H^%];>\N+>W1);IUC15,C 9<@< G.!6,8IMHMM MI'TG_P )/HYT3^V?[6L?[(V[_P"T/M*?9]N<9\S.W&>.O6J^K>./#F@+,VI^ M(-+TY881-QXS7Q=%)M#LM>M[+X>6=Q!;ZA")H5D\\KN,;95B QQD'&>* MOV:5[O:_X"YGH?5>F^)-(UG1DU?3]4LK[270R+?VUPDD#*.K"0$K@8/.:X#Q MW^T;X(\)?#KQ+XKT[Q#HWB5-$MFGDL].U6!WD8=(\JS88G@<5\9:_96VBV?C M+P'$/[*^'MS\7[73K^SMSY4$-G+$LC0C& D;.%! P*^A?VI/@;\./#_[/WC_ M %+2_!'A[3=3M_#]Q'!-::?%$X5=K X51DJ54ACRO8C-/V<8M)]1U)PC;FZ#YG>Q]2:CXBTG2&@6_P!3 ML[)K@,T(N+A(S(%7?3;N.X M16'52R$@'VK\^_A_HUI\3-*_9ET7Q3;C7]"76]?M+:.^)=;FSA#" -S\Z@(H MP<@A<'(KZ"^&7AC2/ 7[:OCC1_#>F6FA:1>>$;&]ET_3H%@@,XG9!((U 4'; MQD"B5)13UU_X-@4FSW;XDG_BW7BG_L%77_HEJX?]DH_\8W^ /^P:O_H35W'Q M)_Y)UXI_[!5U_P"B6KA_V2O^3;_ '_8-7_T)JZX_[A+_ !K_ -)D<,O]^C_@ M?YQ/6\T9HHKS#T@S1FBB@ S1FBB@ S1FBC- !FC-&:,\4 &:QO%_C/0O &@7 M&N>(]6M=%TBW*B6]O9!'$A9@JY8],L0/J:V:9<6\5U$8IXDFC;JDBA@?P--> M8'P'^RK\5/ _PV\9_'.^\1^-_#.G6OB76WN]*D_MJUE^TQ%IB&PDC%/OKP^# MSTKY]TF_\(Z5\ O#GAWQ%!I>N:O9:]J&H++H7C>PL=0TT.(O*DCD+21N&VG* MX)!4'CO^N7]@Z7_T#;3_ +\+_A1_8&EY_P"0;:?]^%_PKJ5=)WM_2,?9NUKG MY.7GC2UUGX.>'=/^(>O6WC_5+/5;FZL)K/Q[:0:UH4)6,1 W,FY)MQ5B1@[< M*05Z"&Y\;Z]%X"^&FO:O\0= \9^(O"GBF34X-"U+Q5;2WL5D1$4CDNF;:QW1 MGH3@,,#L/UI_L#2\_P#(-M/^_"_X4O\ 8&E_] VT_P"_"_X57UA?RB]D^Y^2 MVMO9_%>Q^.5[K/BOPAX2U7Q1?V&K:79GQ-:W,4[0M(7@,D;9!PX^9E4;L=N: M]#_9L^*'P[T?XRZ!XDU^.+PY>:=836UQKVN_$:'5E!:,J(X80Q;:22>20/KS M7Z2_V#I?_0-M/^_"_P"%?,?Q _;/\'^!/B1XH\'0_"[Q1XEO/#:K+J-SH6E0 MW$4,116,C?."J@,.6 %4JKJ)Q4?Q^0G#E=VSQ?\ ;!^-?A[Q'\9OA'XW\ Z_ MX7\7KX4EFN;FU;Q'9V0+%D*KNED!YP>0#C%8.A^.-(^)GQ$\<_%?XB>.?!.@ M:]/X9N]#T#PQI^NP7!C,D#H#),&V<[V&=W)>>XO=(T9'33?*;$B73$[8R.3U(P,YQ72?L]_M#:)^T-=N=-^% M_B/P_I!LVN[?7-9TJ..QNL2*ACBE4E6?+$X'9&]*.9QA\.P63>Y^>-SJ/AS3 M?A9\/M.FCM)?%^B:;<10Z]X9\>V%A=6,[W,SK%("SK)'M=6W(01N89].ZU[X MH7VD6_P!\8ZIXY\-_$;Q7X.FNGU:R7Q);)<%)&!C4S2-B1@O!8;N1W'-?=7[ M1OQO\)?LV>'-(U?6?"UQK2:G?"P@M]*M86E\PJ6'#%?# M/QSJ7B/2M8\.:GX UKP_9/J-]I_BK2TM95MU +. "QX!7@@$Y& :KVCDN;ET M%R).USQ3X)_&KP;8?M9_$+XC^(?%/AK0M%\1:'8I;EM>M)REP(X/-APCEOD9 M77<5 .W(X(KP+Q#<:==? _XB:#;^(_#,VLZI\0AKME:_\)%8KYUF _[S>9MJ M]1\K$-STK[$\-_MN^$_%-Y9WEE\(_&#^#;R]2QA\5?V+']C+LX0,QSPFX@9S MD>F>*A\2_MV^!_#GB?Q=I2_"OQ9J]KX5NWM=6U32M)@GMK;:Q7>[;QL4[3C= MCI0G)/2/;KV"R:W/F/Q9XRTSX^^/_'WB_6]>\)> V;P?)X>TO3Y_$EK=27TY M'#,\;8"]>6Q_#UP2*WPZ^*K:QXY_9ZF\13^%?#VC?#T/9W=[_P )793O*FT M2F(."H. JESU/ Q7Z8?#KQ#X2^*?@G2/%?AZUMKG1]4A$\$CVJHV,D%67'! M!!!'J*Z+^P-+Q_R#;3_OPO\ A6?MTO=Y?ZV*]G?6Y^8GA#XMZ?X(/Q\\$B_\ M-ZEI'CF;4[S3_$4/B:R2)2\$OE(8F<-EV*+SMVEB3P,UE^%_&6F_".Y^!WCS M3M<\*^*-8\+:)/I&K>&/^$DM(9H2\DQ62.4N8SQ-SM)/'OQ^I_\ 8&E_] VT M_P"_"_X4?V#I?_0-M/\ OPG^%+VZ_E_K8/9ON?D?JD6G:O\ #J_U&7Q7X2B\ M1^(OB!!XDN- @\0VA&G6JB7),C2*C-F7HI)P!QU ^IO@OXK\.^)/V_O&OB/1 M_$FA:GI.NZ%%:Z>]EJMO++M?97]@:9_T#;3_OPG M^%20:18VLHE@LK>&0='CB52/Q J95U)-6_K^D-4[=2WFC-%%,O"7P]\!>';;Q-\0/$Q9[:&_E,=K;0KG,DA4@D<-P",!2<] ?/OBQ^T9\= M?@S\-+G4_%_A;PKINL)K>GV-K>:=)+/\ 'TK94I2M MYD.:1]BT5XMXY_;#^%7PS\3S>'O$WB.;3M4MC&MT1IEU)!;LZAE#RK$4&0P/ M4XSSBNKC^/'@2;Q;=>&8O$$9U%B5#"82!-C @@X5B>>E1R2 MWL/F7<[ZBO&M6_;!^$FB^!M#\77'BQ3HFN3/!IKQV-RTUTR-M?; (_,PI&"2 MH'3U%> ^$OVU/%GC'PAJ&MC7/".A6Z>.1H%G<:GIM\R75FRED55A#L)F&/F< M*H[XJU2F];" M0%'?O7BEO_P4,\&O#MI?ZAIC:G9WOAF>9XXU4,=L@D)/.UAGCG'4 M'-9Q@Y)M="G)(^HZ***@H**** "BBB@ HHHH **** "BBB@ HHHH **** "B MBB@ HHHH **** "BBB@ HHHH **** / /AI_R>#\9?\ L&Z/_P"B37O]> ?# M3_D\'XR_]@W1_P#T2:]_KT\P_BP_P0_](1YN _AS_P <_P#TMA1117F'I!7F MGQ,_9U\"?%G6+76==TJ:+7K6/RH=8TN]FL;Q4_N&6%E++UX;(&>*]+KR7QC^ MU?\ "7P!JM]IFO\ C:QL-1L;C[+:_NB= MNH[0_P!ECX9>']&CTRU\.,T*ZG;ZR\T]_Y7>E4O M$?[(7PK\5^*]3U_4O#LDUSJC^=?VD>H7$5G=RXQYDD"2!&;WQUYZ\UIP?M1? M"FZ\9Z?X4M_'&EW.N7Y06T$#L\I?KN=$FMK#PTGE:1+9:A<07-FF,%5G5_,((X(9CFK?A']FSX:^!M*\1 M:;HWA6WMK#Q# EOJMO+-+,EXBJ5&\2.W.&;+#!).22>:M^+?C_\ #KP+8:3> MZ[XNTW3[/5[9[RPN'D+1W42@$M&R@AN&7 ')R 37,2_ME_!>#PU!KS^/]._ MLZ:=[=<1S&<.H!8- $\U0 1DE0!D<\T+VC6EP]U$/AG]C/X2^%=4TO4K7P]< MW%_I-U'=Z=/>ZM=SM9,ARBQ;I2%09^YT.!D' KJ[[]G[P#J-EJ]I<:#YEOJ^ MLIX@O4^V7 \V_0JRS9$F5P57Y5PO'2O//C+^T5;>"/&OP=U"T\4Z?9> /$3W MTVHW[^6T,\"6PDB82$$K\Q&-I!)..>E=WX/_ &D?AKX]\.Z[KNA>++2^TW0H MS-JU0 G>\;J'VX!P=N#@XH?M+*6H+EV.IUOX?Z!XC\5>'_ !)J-A]H MUK0#,=-N?.D7R#*FR3Y58*V5X^8'';%;6H6,.IV%S9W 9K>XC:*0([(2K#!P MRD$'!Z@@BO,;O]JKX2V5GJ%T_CO2W@T^WANKMH&:4PQRD"/<$4D$EE&W[W/( MK1^&_P"T+\//BW-J$'A3Q-;ZG=6$?G7-JT,MO-''_?\ +E16*_[0&*AQG:[0 M[HQO!W[)_P ,? /BR+Q+H>BZA::VCB3[5)K^HS^8P4J/,22X99, D ,#BCQ? M^RC\-O&OB/4=;OM)O+:[U0@ZG%IFJ75G!J..GVB**14D]R1D]\U!'^V/\%Y= M2TVQ3X@Z6]QJ+*D&T2% Q8JHD?9MB)(X#E?7I74_$?XZ>!?A+<6=OXI\0PZ= M=W:F2"TCAEN)W0=7$42L^T?WL8]ZN]2_6XO=L3:Q\%_!>NOX/:[T&';X1G6Y MT..WED@CLI% "E4C958 ?*P(]JXGQ%^QE\(/%7B35=?U+PQ=2:MJMPUU>3P M:YJ$ EE;JQ2.=5'X "O4O!_C+0_B!X=L]>\.:G;ZQI%VNZ&[M7W(V#@CU!!! M!!P01@UROQ!_:%^'7PKU233?%?BNRT;44MEN_LDP=I7C9BJE%527)(/RKD\$ MXQ4ISO:-[C:CU.C\!> =#^&?ABU\/>'+62RTFV+&*&6ZEN64LQ9OGE9G/)/4 MFL37_@7X'\47?BNZU30ENY_%-O!:ZNS7,P%S'#_JA@. A7U3:?4U7T[]H3X= M:MX$@\9VGBRQF\,S726*Z@-X59V8*L;*5W(V2.& QD9XJ"7]I3X7Q>&-6\1? M\)OI+Z)I=W]ANKV*;S(UN",B)-H/F,1T";LT6G>^H>Z0_#K]FSP+\,/$(UW2 M;*_NM92%K:"]U?4[B_DMH3UCB,SMY8/?;@GIFL3]KKX7ZQ\7OA3:^'M&TX:I M,VMZ?<7%N9TAS;I.&E.YF7HN> <^G-6[G]J?X?:E\+_%GC'PYXFL=3@T"V=Y MXY$EC>*4@^4LD3*LBAFP 2HSSSQ69\%/VM_ WQ/^&T6OWWB/2].U*QTR._UV MW#/'#IY;@@LXP1NX&"35VJ)\[6Q/NVY3I?AU^S=X#^%_B*?7M&TVZGUJ2$VR MW^JZC<7TL,).?*C:9VV+[#&>^:YB[_8A^#=_<:DUUX5EGL[YWE?36U.[%G'( MYRTD4*RA8V.>J@8[8KK? _[0G@'XIW%_I_A/Q-;WNJVUL;DVUQ;S6\GE]I0D MJ(SIG'S+D>_-87A;]H;PQX>^&?A76?'GCOP\;G64N6AU6RCEM[*[\IWW>6)! ME=J@ ANK XSD4KU+];C]T[[1/AEX:\.^++OQ-I^F_9];NK"#3)KKSY6W6T.? M*3:S%1C)Y R>Y-<[JW[/'@G5_B9'X]:RO;3Q('B>::QU&XMXKIHO]69HD<)) MM_V@<]\U:^'OQ]^'WQ4TK5M2\,>*;/4;/2>;]W#VYM5P3ND65595P"=Q&.#S MQ69X(_:@^%_Q'\30>'_#OBVWU'5K@.;>#[/-$+@("6,3NBK( 3E2>E3::ON M/W3T+Q%X=TSQ;H5]HVLV,.I:5?1-!;_ ]_9:^'/PR\20:] MHVD7,NJ6D;0V4VI:C<7OV&,\%(%F=A&,AP>]=K12YFG>^H65K'F_PU_9W\ M ?"/6[G6?"^AM8ZQ=6HL[J_EO)YY;B,/O_>&1VW-NYW'YN ,X %=-XW^'V@? M$?3;.P\16']HVEI>PZA#'YTD6R>)MT;Y1E)P><'@]P:Z*BFY-N]]0LMCS'XF M_LW^ OBWX@L]<\0Z7SED@SDQ2-"Z[TSG@^IQ3-)_9C^&6@ MZ##HNG>%H[/2H=9C\01VL-W<*B7R !)1^\XQ@?)]S_9KU&BGSRM:X_L_^ =1T_6;& MXT'S+76-837[Z/[9<#SKY&5EFR),K@HIVKA>.E>AT4N9KJ%D_L RZ<- M0U*YO(M/#<$6\% PN!QTI_CSP'H7Q,\*:AX;\2Z>FIZ-?($GMG9E MS@@@AE(*D$ @@@@BM^BE=WN%NAYIX,_9V\$>!;_0]0L+/4+K4M$:Y:PO=2U6 MZNI8?/18Y1F20@@JB@ @@8XP237SA\5?V?=;^(FO^*H;+]G?PSI>N:O)/:Q^ M.IM".)R5^UFU W^=L.>%SNYW5]M45I&I*+N2XIZ'"^$_@WX;\*ZAX>U>. MS,WB#1=#C\/P:B9I 3:KM)7R]VSEE!SMS[XJ67X,^#+C_A,O.T..=?&&W^W$ MEFD=;S;'Y:Y4L0F%X^3;Z]>:[6BHYGW*LCB/A7\'?#OP;TFYT[PV-1%I.ZL4 MU#4I[S8%&U50RNVQ0.,# KS'P_X2\?\ Q!_:1TGQWXH\)P>"]"\,Z7>:=9PO MJD5[-J#SNO[S$8Q&@5GT+134WJ^XK(\*N_P!B+X-ZC=:E)=^%)+BV MOI'F?3VU.Z%I%(YR[Q1+(%B8GNH!';%>G6'PT\-Z9XS_ .$LMM-\OQ!_9J:/ M]L\^0_Z(C;ECV%MO#<[L;O>NGHH#?V6?AUX);4VM=+O=0;4;%],G_ M +8U2YO@+1\;H%$LC!4.!TYX'->MT4<\MKA9=CR'P[^RE\./#6D1:5!INHW6 MG07]MJ5M;WVL7X.!3_B!^RO\-_B7XDN=>UC1[F/ M4KQ%BOY--U*XLEOT48"SK$ZB08XR1G'&:];HHYY7O<7*NQQO_"G_ :T+?X?Z!:^/+OQG%8;?$MU8I MILU[YTAW6Z.75-F[8,,2*?^P5=?\ HEJX;]DK M_DV_P!_V#5_]":NY^)/_ "3KQ3_V"KK_ -$M7#?LE?\ )M_@#_L&K_Z$U>E' M_<)?XU_Z3(\Z7^_1_P #_.)ZY1117F'I!1110 4444 %-_.G4W% .G>@?=[ MT <4 ?+0 =AUI?3K1C@48Z4 8OC'Q38>!_"FK^(=4=X].TNTDO+AD4LPC12S M8 ZG Z5YQ\,OVF_"WQ3\>ZCX4TNVU6WOK*,OY][:F."=T$9GBC?)R\1FC#CL M6[UW'Q1L1J?PX\2V;6=CJ"W&G31&TU2OR_^(G@SXC>,OVJ?VBXOAKXAFT?5[?2XI+BQ@A5GU. I M$'@5SRC8)((Y)&.,YK]0 .*\=U7]F73M6U.\OF^(/Q*MFN9GF,%IXPO(H8RS M$[40-A5&/P?X@DMV,. MK2V,=XL2BZD+#RG^4Y&1STS7??\ #*NF8_Y*/\4O_"UO?_BZ/^&5=,Q_R4?X MI?\ A:WO_P 75RG%WL^MR5%H^7_VZ?"_CWPU\%/A[8>,O&T/C'Q*_C%&@U=- M,BLDC4Q$(IBC^4[6!.>^:Z#XB_L3>.=6\&?%'QEXD\7#QU\3-9T5;&SBL+); M2%8HWC!O =Y#JMOXXL4@T27P MW%IDIF\X,(R^XJ$"Y^8Y8,.>,U\V:[X'^(_BSQ'^U%<> ]=N+>RM-9;^V= M M85\S4[4R3;]LA!8%%#?*!\P)] #]\K^R3H@NC/FE M7/J!C."*\U^/'QTU/]IGX32V5])X#\+36VOZ;=Z?I7_">:7/(] O(XO^ M$;6Q^).FV&EV\8*EEFM6F'FR<8^;'()R1BM&X\5/\/\ XFZ-KVA:QX$\41:E M\/(/"]Y&?'.F6HL+E851R[&5MP!4?=!#9X-?I)_P@7AC_H7-)_\ &+_ .)H M_P"$"\,?]"YI/_@#%_\ $U?MU:UB?9O>Y^7G@N5_A+8_ GQ7:ZUX%\2:SX27 M4+74?#3>-]+B:+SII&CE67SV3I)G(+$;1D>E>#2FOO =Q#>>(_ UIJUS\38_ M$LEI'XWTF18[/:=T@?[0 0"<8X8_W:_4O_A O#'_ $+FD_\ @#%_\31_P@7A MC_H7-)_\ 8O_ (FG]86]@]GYGY\>)IO#^J:Q^U-/'XQ\#S1>-;:!/#['Q=I? M^F,@YZW'[O!Q_K-M?2?P8^//P]^'W[/_ (4TB]^('@J3Q'I&A0PR:6/%5@"] MQ'%CRO-$I0988W9(YSTKW3_A O#'_0N:3_X Q?\ Q-'_ @7AC_H7-)_\ 8O M_B:SE4C)6:_K8I1:U/@#X#?&N[\-?M%?$'Q9K2^#="TKQU)$'NS\0]%G_LD( MC .52>3I6$WQ%AAUOX;ZG#IEM$/"DP\8:=$VKS$ .9LW7[L*><,$SC />O'OV M0?B1J\/QQEU/QCIGA;7O&GBRX-O=^*8_B%I%U+;0X)CM[6QAD=]N55=JDD\= MABOO;_A O#'_ $+FD_\ @#%_\34MKX,\/V-Q'<6VA:;;SQG+?VK)IK."2>74GMWE:,%VC^P ["<9VY)..E?5U9= MIX5T33Y=5DM=&L+:35G\S4'AM40WC;=NZ8@?O#MXRV>.*N,N5,EJY\/7^FVE ME_P3[^#TMO:PV\JZOHMR'BC"GS6O &?C^(@G)ZG-:?PDMO$TWC[XSZ8_Q3T7 MP/K+>)KJ6^TS6-#ANI[BU<#R)?,DF0M$8\ @8]Z^Q7\!>&)/#UGH#^'-); M0K-HWMM+:QB-K R-N0I%MVJ5/(('!Y%9'CGX+> ?B9=P7?BOP;HGB&[@&V.X MU"QCED5?[NXC.WVSBMO:K5,CD9\K>#OA_HO@_P"+7[-GAZR\0V7CO2]/M_$# MVVK10IY+L/F'EJ&=1L8E00QQMXKO_A%H>G']H?\ :5D-C;F5WL(VD,2[BKV9 M+KG&<$\D=S7T!8^ ?#&ERZ1)9^'-)M)-(C>+37@L8D:R1QAUA(7]V&'4+C/> MKEGX:T?3]0U*_M=)LK:^U,J;ZZAMD26[*KM7S6 R^%X&[.!Q4RJ7_KSN-1M_ M7D? OPSGTNW\,?L>2:U):1V$=WK.7OV41*P,@CY;@$$+CWQBNG_: O=/\2_& M+XMZCX9N+>]M+'X77=KKEU9.KQ_:&=F@C=EX+A 3CJ *^M=3^#G@+6=$L=&O M_!'AZ\TFP61;.QFTJ!H;42??\I"N$W9.=N,U-X=^%'@OPCX9N_#FC>$]'TW0 M;P,+K3;>QC6"X###>8F,/D<'=GCBK]JKW_K>XN1VL?.FN>+D^!O[,OPE'A+2 M?#^BW_B%M*TTZMJ%HHM+!YH@[74H7;N8$$@DCYCDFN:\/27L?[9&F0ZE\2[+ MXCZFO@O45N9[&SMK5;0;T*Q%8">O+#>Q(S[U]?ZQX'\.^(/"Y\-ZGH.G7WA_ MREA&ESVJ/;!%QM41D;0%P,8'&!BLSPO\(/ O@DV[:!X-T+1Y+>*2"*6STZ&. M1(WP74.%W8; R,\X&:E5%9Z:@XL^.M)T>QB_X)8ZD\=G!&\FG3W3LD2@O*MX M<2$@:H> M-/A+X*^(UA:V7BCPIH^O6MH,6T=_91R^0.F(R1E!@#ICI3]JM;K>_P"@?F(SQNZ5Q M%W?:)IO[?5U<:O<6%K(G@:+[++>NB$/]K;=Y9;OMSG';-?0?A3P=H/@31X]* M\.:+8:%ID9W+::=;)!$">IVJ ,GUZUY'XL_9HTWXA?M WOC'Q9I.A^(O"TOA MV+2H]/U"'SIDN4G,GF!63:HVG&X-GDC&*E23DVQM.R2/E;XE0:7XFTKXT:AI M4<%[X*U7XB^'X('B :UNIE95NRF/E8%F )'!KWWX\:=H7@GX]? 6XU&TL='\ M$6MW?P@^4D-G!?- !;%N JGA@I/0]*]^C^'/A2+PW9^'E\,:0-!LW26VTPV, M1MH71MR.L>W:&#<@@9!YZU>\3>%M&\::-/I&OZ39ZUI$IH-06W^&M_!KTVGL)$,K%OLT1V42AE$D\.X;D279D,0, M@9K[>\$_#?PK\-M+DT[PKXA::^L(8]0^S6$2"Z0G)60 89223@\4U52MY!R,\0A\"SZS\4O!WBC M7_C=H'BC4]-M;U=-TW3=*M[66]BEMV#J&2XGVNIZ'^QY M!>6T-W#]LUQ_+GC#KN4RLIP>X(!![$5]E^$/@1\.? &IRZEX;\#:!HFH2@JU MU9:=%')M/!4,%R >X&!6W9?#WPMIJ:.MIX9T>U71C(VF+!81(+$OGS#!A?W> M[)SMQG)S1[5+3^NO^8/4=2#!!"# M<,@E8GCY01R>WM4_PY\?^-/AC\1?AI\._$.K^#/B1XU2_O;Z\T#3+N]OK7[#=7,]G&\EQ;YSY,C M$9:/))VG(]JP_!/P4\ ?#;4KC4/"O@S1/#]]<*5DN=.L8X9"IYV[E&0OL.*7 MM$U9CY7>Z.VHI**YS06BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH M6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH YWXD_\DZ\4_P#8*NO_ M $2U<-^R5_R;?X _[!J_^A-7@ SQ7RA\5_VV+OX]?GW\>:^$_A%\0KOX6>.]&D\&ZQ\*_$46I06IU*W\&>'WAGQ)< MQ1?9VF64[&_>%U##GRFR!BOO_P"(@U^3X9^(1X5<-XE;3)O[-:0*H-QY9\L_ M-\H^;'7CUXKY<_91\,^.O"OQKU;2M=N];U+1Q92W,US>VUA!9O*SQF!D-N,R M2[#(KY^ZR<$AA0!]GQG(YZT[/6D P>M+Z]: $!XH!XKY\^(_[8.D?!#Q=/I? MQ'\/WWAS1I;CRM-UZVGAO8;I2!RT,;&>,Y[>61[U[3X.\9:/X^\.6&O^']0A MU71K^,2VUY;ME)%Z?4$$$$'D$$'!% &T#\M+G@4@^[WH[#K0 ,:_//X\Z1J1 M^.GB.#5/B?H&E1P7T>IZ-93>*3:W4=U+]FBB,D&1M2"-+AP@R)#*!CFOT,:O MSU^.?AOP7?\ Q>\5O82ZS83V][)>ZWKPT*VNX57?IXN;>"1F6421YMYA( ?+ M!D SG% 'Z#6YS%&2V\X'S#OQUJ0'G\*CMR/+3#%EP,'UXJ0=>_2@#Y=_:E_: MCM_AKXQT+P=H_C_PMX,U>X\R?4;SQ#;270MHPF8E\I&7'F'/S$X&W'>O5?V> MO&MQX^^&]KJ]UXOT7QQ+)/*AU?0+5K>U?:V-H1F8Y'0\US'[16MZIX+U[PAX MCAT'4M>\-6UQ.NL6>AVT$]W*6BVP960@M&&+$A3G.P] :V_V:9]>NOAA#/K\ M=Q!-+?74EK#?"$7<5JTI,*SB+*"0(0"!T&,\YH ]9!XH':@=.] [4 .HI** M%HI** %HI** %HI** %HI** %HI** %HI** %HI** %HI** %HI** %HHHH M**** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ H MHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BB MB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH \ ^&G_)X/QE_[!NC_P#H MDU[_ %X!\-/^3P?C+_V#='_]$FO?Z]/,/XL/\$/_ $A'FX#^'/\ QS_]+844 M45YAZ04444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 % M%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 44 M44 %%%% !1110 4444 %%%% '.?$G_DG7BG_ +!5U_Z):N&_9*_Y-O\ '_8 M-7_T)J[GXD_\DZ\4_P#8*NO_ $2U<-^R5_R;?X _[!J_^A-7IQ_W"7^-?^DR M/-E_OT?\#_.)ZY1117F'I!1110 4444 %-S3J;GW% #Q7SA^V#\6M8^&A\% MVNG^,1X$L-6N;A+S6DT1M5EC$<>Y$$0! #,<%C[8ZU]'@\=17SK^U[/?_8/# M"3GQ.W@L74IUY/!DC+J6/+_<8\LB3R]_WMG/W<\9H [#]G?Q7+XU^%::C)XS MF\>N\\T?]L-I7]ENV#]P0X&-O][O7QWJ^H>(-2UK7X+?PK\?8=4M;X6%@C>) MTM[.=PB;#(Q;Y0QW9*!@0,CDD#[ _9<.N/\ "B#^VSJQC^V7']F#7V#:@+'? M^X^T'/\ K-OK\V,9YS7R7^T7\/M"U[X]^-K;5O'VDQ9B_M:"UNK6Z9M+NFAM MK83RS(#&I@CS+$H((,NXX'- 'UQ^T7;^+;SX+:WI_A2SL+C4+VSDM;F;4M4- MBEK"T3AYO-"-RO!Z#OR*^>OV&KKPIJ?CC4)/#W@WX*7B@4Q,# M*X!Y &20.M?(7P"N/'WQ ^*^D7]CXU\/6NI:)I?V6.SO_!5SIR[P?+0 CA21\HS0!]0?$[]J_P"%_P '/&=AX8\8>)[?1-4O(6G59U;8B 9! M9@.-W(&,\@]*ZGX5?%WPY\9_#D^O^%;F2^T=+N6T2[:,HDYC(!>//WD/9N]> M'?MK>($\!-X'\5Q>+M+\*W]A+#IY4/S # 8L>!Q7HG[+_ M (_O/B)\,%U:^U:SUF47DT'VJRT>;2X\*?N^1+\P(.03WH ^6/&WQ7M?AM^T M_P"+4LO#'A>'Q3=W'EZ?I]UHUQSQ(MR6("2QRSJH0!4\DELX(K[GT MO3-"^'GAZ<6T5IHFC6[37DV"(X8B[M++(2> "S.Q/N:^,/&UWKU]\<_$\NMK M\:'BBU=(M*F\)2QQ:4+39'@ ;@2-WF;CWKZU^-KZ9'\&/&K:S:W5]I*Z+=F\ MM;)RD\T7DMO1&'1B,@'MF@#MHKE)HE="&1AE64Y!'K7#_$_X[^ O@NNGMXV\ M36/AQ;\LMJ;QB/-*XW8P#TR/SKY1_8LU/1[?XEVVG6]SJ%Q?OIUXH@A\9W&M M6=K'$\(3,;G:-RR+M< D_MEZ\_A75? FL:1JD\/BRWDNTL--3P])K4 M=S$T:"9VAC(92@"8<$?>QWH ]E^&7QW\ _&>.\?P3XJT[Q']CP+A;*7+19Z% ME." <'GIQ7RCX^\%Q7W[0'B#6=?^"&H^)#!J\*VFJ:7XBCM+2ZC98O+:ZM6N M KR;D&,J-X1,@D5ZG^R/\,?L5L_CR?4M2N;W4+6:T>UU'1?[):)VNI)Y2(3\ MRH7BCW->(_&GQ!8:?\6?''@:W\1Z=<:+XBUJTOM9E'AF_OM1T^X18=L< M4\*&+#S^%<)\9O'%U\-?A#XG\46"P27>E: M;+=0B\)$6Y5R"^.<>N.3TKR3]F7XT:Q\2O$]U;:A\5_!/CB-;(3C3_#>GRV] MQ"V5^=R[GY1G&,9R10!B?M\>'?!.N:)X;;QKXBM-,MT:[2ST^\M;BY6XN&B! M201P?-^[91DD$;78<$BNP_8?L;*Q^ UD-.ETU[634+N98=(M)[>VM]TI/E() MP)&"YQN;^0KF/VU8]>@U?X?ZEI*>+H+:SFO#=:CX+M();VW#1*J@M*=H1CG* M]R ?X:]%^!.MWVG_ 4?5=3?Q7?W%LMS<$^+8(H=1D5Q@ M\4#M7S9<_'OQKIOP%^'WQ+N+;0ITUB]L9=4T^"5\BRO)52)+=OXIHQ-%NSPQ M5@,5](Q-N /M0!)1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%% M% !1110 F:,T44 &:,T44 &:,T44 &:,T44 &:,T44 &:,T44 &:,T44 &:, MT44 &:,T44 &:,T44 &:,T44 &:,T44 &:,T44 &:,T44 &:,T44 &:,T44 M&:,T44 &:,T44 &:,T44 &:,T44 &:,T44 &:,T44 &:,T44 &:,T44 &:,T M44 &:,T44 &:,T44 &:,T44 &:,T44 &:,T44 &:,T44 > _#3_D\'XR_P#8 M-T?_ -$FO?LUX#\-/^3P?C+_ -@W1_\ T2:]^KT\P_BP_P $/_2$>;@/X<_\ M<_\ TMAFC-%%>8>D&:,T44 &:,T44 &:,T44 &:,T44 &:,T44 &:,T44 &: M,T44 &:,T44 &:,T44 &:,T44 &:,T44 &:,T44 &:,T44 &:,T44 &:,T44 M &:,T44 &:,T44 &:,T44 &:,T44 &:,T44 &:,T44 &:,T44 &:,T44 &:, MT44 &:,T44 &:,T44 *?^P5=?^B6KA_V2O^3;_ '_ _P#0FKTX_P"X2_QK_P!)D>;+ M_?H_X'^<3UO-&:**\P](,T9HHH ,T9HHH ***2@ /W37R'^V3\+O"_B'Q;X7 M_P")1HT?BOQ&\EJNN>(]0NH+&VC@CW[2D4J;G8'"C([GM7UX?NFOG/QSJ&G? M$GXV>*/A[XWET!?".GZ';W=II>MVL4AO+B5FS=*9.,1%0N!W;F@#8_9 ?3[7 MX.M::;IME8KIVI7=G-_95U+=6ES+&^UIH'E8L4; P"3@@CM7R9\2K^U^)GQ& M\7ZE9>#/B]8M+?26MWX=L=.C2QU9V@ABE6][I%LMM9WD$$I1)XXU^558#^'C(.*^6_BO_9FO?'/Q MCJFI^&8O'FGW-Y!_9FHP_$NWTY((5@C1HEMQ<+M D5SR,G<: /M/XR-HL/P4 M\7GQ##.="71;G[;%:$>;Y7E'<$[;L=/?%?-7[*7C#_A*OCC>1:[KWB/Q-?:5 MID^F:)J&IVMM!:A(V@-Y$HAY>1&>!6=N#M.,&=+FOO" M^IO>P:.P=[,17L>R,?.2@^T)-9U*<7L= MLT^IFPABA^S-]HW28.YC']U,9+ 'M6]^RA!H7_"I].&P\WG*%!4KCH!@@BO,/VZGOY([2UF^(/A*VT6ZOM/M'\*^(-(M;UD\ MV98VNLRON 4,6Z?PGFO;?@7X:3PY\'O[%M_%6@>);:W6:*#4-$L(+6RB3'"> M5$Q3Y3R>>>] 'PUXK^%W@71_'NO^'M#TS1+N;4-8M[K1/% \Q!5SM ._>.17Z.?$9X$^'WB SW%_:P?8)MTVDQ>9=H/+.3"F#N?^Z,') MQQ7P1IOCRR\<>.XOAS'X2^$?A/Q5I8BGU+QK=QV5Q;WD(<*CV$0'S2,%P5'?!?B/PG':^.+Z&PT<3*1++J36(\PJR@>8KJ>A;C/\J /G[]C M7PKXZ\,^*]::[\':?I/@BZA+V^LZCI5OIFN74N1M$T,!*E<;CE@ISCBNH_:] M\'>(O$-]X0U'PSIOC.\U#3S<@7'@_5K6PDA$BH")#.IW XX ]#GM6'\+O#?P MN^'G[1?AS2?AQ<6VIG4]$U">\N8_$$^H-#Y;VX1=K3.HW;VY(SQQWKTKXX^% M_A%\0KRQT_X@Z_96EYIVYXK8^(&T^10X&2RI*A.0HQG/M0!+^RAK-WK?P?MI M-0?7WO[>^N[2X7Q/=Q7-\DD>#/CQXSB\.>)_ MB3;64VJ"ZU%='T[3SID4J"VCFQ),-^U?-@#MVWY]Z^FOV7-7T2T^#FK#PYI] MG9Z%H^L:K:VBV,S3+<1PSN!*9&9B[/C<6R+[!]+N_LLMK<>9'#]DNCY@\URABR#][R^5.!0!]6_M"6E]/\+[RZLM M=U;1C:1M/*NC6\%Q<7:^6P,:I*I5CSN Y*@5XG^QUKUIXG\=:G>^'_&GB7Q MWX>2S:)]2U32+.PM$G#KF--D:2.Z\@\;1C'7%=Q^V?>^&(/!/A*S\4:)I.KZ M5?Z_#;M-K5P\%I9*(I'>5F0@[MB,JC."S"O'?V'M/TG0?BH[V/@WPWX=3Q-X M>;7;"/11,+JQLVN L45UO<@M(FR0-@=Z /5_VM]&3Q#J7@Z"70[;Q[I]K-Z5/X+\.ZEXQ2VT_2=+GU6X MF$MS/=R$F9H8V7?!!%%(2W7.!TKW?]E,Z==_LYWFF6^GZ)H=M876IZ9--I49 M_L^=HY71KE0Y.4;&X[B>XS0!X/\ !K4?AE?W_@WQ4WP5^(::M="UOU2'3KE] M$MKN0*S7$$+2F-$#LS*P7@)/B%HGACP!\:?"V MI^"M)N8K*_U6]TBTTZU\M"JBVLT,ADF;: H95"#CYC7Z+1YP,G/O0 _-&:** M #-&:** #-&:** #-&:** #-&:** #-&:** #-&:** #-&:** #-&:** #-% M%% "T444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%% M% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 M %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 > ?#3_D\'XR M_P#8-T?_ -$FO?Z\ ^&G_)X/QE_[!NC_ /HDUD?'+]O3P)\!OBK9>!M9T_5+ MZ[=8GO;RS1#%9K)]W(+ N<$,0.@/<\5ZV.A*=6"BOL0_](B>7@6HTIM_SS_] M+9]+45'!.ES!'-$P>.10ZL.X(R#4E>2>H%%%?,5IK/C;]I;XH>-=-T3QGJ'@ M'X?^$K[^QS-H4<7V_4[U5!E/FR*PCC3( "CG//M<8\PF['T[17R9\7=/^(WP M<\+^&K>\^)>I^)+2\\;:-;6=W)&EK>I;.[B:WG>(*)E;Y>2.>01TKTOQU^U' MI7@+7-8L;GP-X\U*QTAL7VM:9H+36$("AF;S=P+*H.25!QS5>S?347,NI[11 M7 Z5\;_"NN^+/#&@:==2WMSXCTA]59M.C3^SI'V@0Q!#F2)=P.\_-UXJ_9 M22)YT?0E%>0> ?VG_#'CWQS!X3&C^)O#FIWEN]WIK>(M(>RCU.%/O/;ECEL M@X8*<=J]8OC;2W62%G.QI%5V)^4DMWS@ 5YIJ'Q M&UKQWXI^,3ZS\6M1^&NL^#+F=='\/6AMH8C:Q1[TNIDEC9KE9#UP0 " .HK1 M4W=JY/.K7/M"BN$^!/BS7/'7P=\(>(/$MF+#7=1TZ*XNX A0!R/O;3]W<,-C MMFO-?C9\,_'<-CXO\:VGQJUSP['IUM+?Z;I=I9VJ6-LD<>[9,&0M,"5.22/O M=.*A1][E;'?2Z/H6BN ^ 7CC4_B5\%_!OBC6;=;;5=5TV*YN8T7:N\CE@.P/ MW@/>LSQ[^T-HG@GQ3+X:M-#\1^,M?MX%NKRP\+Z=]K>SB;[C3$LJJ6P<+DL< M<"ERN]AW5KGJ5%>26'[4/@748/!5U%*.278.9=SVBBO"I?VQ?!<4@O/[)\3OX2^UBS/C)=);^QP^_9GSMV M[9O^7S FW/>M/Q?^T_X?\,^+-2\/:=X<\6>,[[2D1]3?POI)O(K'>NY%D;=J[CCM3]G+L',CV*BO&-?_:H\-:7J-CIND^'_ !7XOU6XTZ+59;#P]I#7 M$UE;RC,;3AF7RRW.%R6XZ5#X=^+6G>,/C%X=^R>(=;TZUU#PS-J2^&K_ $Q8 M(@J3F-IIG?\ >1RJP*[.F!FCDENPYD>VT5X$O[:G@-KI9_[-\3KX4:[^Q+XS M;1W&BF7?L_U^<[=WR[]NW/>MKQW^U-X4\"^.;KP;_9?B/Q%XGALXKY-,\/:4 M][)/%)G#)M., #)+%1R.3FCVQT5QOPG^+&@_&;PDGB#P^UTEN)Y+ M6XM;Z P7-K/&5W:'?J>J45\Y6G[=_P]OM*L]9@TCQ=+X:EE6"Y\0K MH*=3\0P_:=*TCPW9F\N[J#:&,JH" $ (^9B!5>SEV%S M+N>H45XLO[6_@)/ASKOC&[.JZ;;Z#=Q6.KZ7?V1@O[":1U55EA8C .X'()&, M\\&J.H?MG_#O3=#36YDU]=&EU.+2K:^.CS*EW)(C.KPA@&D3"$;E!R2, YH] MG/L',NY[O17S[;?MJ^#[B[OM*;POXX@\56VQX_"TOA^0:I=1,"1-%$"1Y> < MLS+CC/)%=-9?M,^&=8^%EOXZTC2?$>MVDUZ=..D:=I;3:E%<@D/$\ /RLI!S MS@<*/V7G"R\/NPLMZ$ M227#C[L;-\RLW!7D<5J^$/VB] \'_#YM1U+7O$7CN^OO$=[I.G6D6DI_:%Q/ M&Y#6\,,9PR1A3\[$</4+JXFSY4<$0)$I;:V"K8X.2*8?VK/#MAX8\1:WKOACQ?X5BT**& M>YMM$K/4OM/G M>*+]=.L/)BW#S60N-_/RC"GGFN*\7?M2^&O"^N:SIUGH'BGQ5'H;;-8U#P[I M1NK73F W,LLFYR&VD>RT5XWXA_:I\(Z;=:-::#I^O^/+[ M5-.35H;3PIIQNY([-CA9I,LH0$Y !.[(QBO0_ 7C:S^(?A:SUVQM;^Q@N=Z_ M9=4M6MKF)E8JRR1MRI!4BAQ:5V@NF=#17B%Y\8]#\"?$CXI77B#QAJ+:7X=L M+&YN=*GL4%O8B53M,#IEY7D. 5(X) %;OP[^/]C\0O$46C-X.\9>%[F>W:ZM MI?$>C-:PW$:XSL<,PS\P.UL'':FX.UQ!7S9\7/BE^R]XZU)M)^(OB7P+J>H:3,\)M]6NHC-;2*2'3DY M7D^ ]>TV-UE2TU"\@FB5P" P5LC(!./K65X.^,W[) M?P]U1]1\,>*?AQH%^\9A:YTZ6V@D9"02I90#C(''M7\_-% '] GB[XP_LC^/ M]6.I^)?$WPVU[4O+$?VO4)+::3:.B[F!.!6SX7_:4_9E\%:(^C>'_'O@/1=( M9F9K&QNX(826^\2BX'/>OYXJ* /WMB\:?L60S)/'?_"E)D;S%D"VFX,#D'.. MN:['Q?\ M+_LS_$#25TSQ+X_\":]IP=9!:ZC>031AQT;:V1D9/YU_/#10!_0 M+X/^,G[)/P_U,ZGX9\3_ WT#43&8C=:=+;0R%"02NY0#@X''M4?BOXM?LB> M.M8DU;Q%XC^&NMZG(JH]Y?R6TTK*!@ LP)XK^?ZB@#^B'PS^T[^S5X+T)=$T M'XA>!='T@%RMC97L,4(W,-'?2==^(G@;6-,<@M:7U[!-$Q'()5LCBHM'_:>_ M9K\/ZO>ZIIOQ"\#66HWL<<=S=07L*22I&H6-6([*H Z"OYWJ* /Z'M4_:5_ M9EUO78M:O_'O@.\U>&%[:*_FNX&GCB<89%<\@$$Y&>]6-&_:F_9O\/>'(M!T MWXB^"+#18HC"EA;WT*0JASE0HXP>'OB3X?BUSPMK-EKVC3,R17MA,)8F*G# , M..#Q7\O5?O)_P2=_Y,P\-?\ 7_??^CVH ^Q**** "BBB@ HHHH **** "BBB M@ HHHH **** "BBB@ HHHH **** $S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3 M-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* M$S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B M@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* $S1FE MHH 3-&:6B@!,T9I:* $S1FEHH \ ^&G_ ">#\9?^P;H__HDUN_$W]DKX7_%_ MQYIWC#Q1X=^WZW9!%\Q9Y(TG5#E!*BD!P/?MP9@$G3G?\ GG_Z6QJ*L:A5 55& . *7-+17E' MIB9KY&^&_P 0]&_98^*WQ*\*?$.Y_P"$NT86=VDP'F0F4 J MLB%>C8_EGZZJ&[LK>_@:&Z@BN86ZQS(&4_@:N,DKI[,EJ^J/D/\ :"^-OA/X MS>%?"4GA"\FU;3],\?Z'"^I"W>.VF=I')6)V \S;MY(&!D1'<,4=4=@#M) .,^E9/C34E^--G^U# MJG@Z*[U:RF;0;R.-;:2-[RWA4-(41@&965&(X^88(R#7Z'W5G!?0F*Y@CN(B M02DJ!ER.G!J4 8 I^VUO;7_@W%R=+GQ5\7OVA_A]\7M9^!FG>#=;35[B+ MQAIUS-#;V\@6T38ZA)&*A4?)P$)SP>,"N(\;?\B5\7O^RRV7_HZ"OT'MK*WL M@XMX(H [%W$2!=S'J3CJ?>IJ2JJ.B0^1O=GSQ\;0!^U3^S^V/F\S6!GV^RBO M?[^_M]+L;F]NY5@M;:-II97^ZB*,LQ]@ 35BBL7*Z2[%I6N?'?[/7QV\ :Y^ MU5\7!8>*]/NCXEGTQ-'$;D_;6CMF$@CXYVD'-GX5M[5)W2[=>Q')H?/7P@^-%_\ #KX2?!K2?B>NJR>,/%L@TRW:2$-+O+?N MC<$L"I\LIDX)SG(SFO+/CW^TCX%^)/Q3U+X8^+/%\/@SP!X?N0FO+*LOVK7) MT.?LJ;%.R $#>QP6Z#CFON"BI4XJ7-8;B[6N>"].U;P9>V]_ MX;9#!:2VL;)&%C.S:JL 0!MQT[5\?ZRFC?#O]H_XHI\0?B3XI^&$&OW5OJ>C MW^FW:6UEJ$ A",ID>%QYD9&-N1P>E?=%07EA;:C#Y5W;Q746<[)D#KGUP:49 M\K?F#C<^(?$L/P\U'X CX32[S5V(ECN@RO/J&]8XR(XB M-P<#!;@$@FN9UO5(/"7[&?Q:^%^LVJ:?XZ\*S))JS[F9M566[C=-0#,2SB0$ M9)S@C'' K]"418U"JH50, 8 %<+\U[DN'8^=?BA\5/"?[05U\(?!GP^U>+Q+KMKXAL-8O M'L$9AIMK;*3+),Q \L\[0#@DG&*W/V=M%N_$'PC^.VF::PBU&_\ %7B"V@D' M&)'7:O/U(KZ3 MT!R*^Y9-.M);M+I[6%[J,82=HP74>S=12SZ=:74\4\UM#--"LI-:L9[-9+*^_=!X_W M$RD.1N*X5MR\C&>2WPIJ_B_XQ_$3PO=Z[ +#Q?KOPGU2(A8C #(UVZ12;#RF M]=CX[;J^Z+O3K2_,9N;6&X,3;D,L8;8?49Z&K%+VJMHA\GF?!-S\;/!]U^Q6 MOPFCWGXE-I"^&AX.^S/]N%\"$/[O;]W(W[^F.^:]3^"&E76@_M6^*-,OG\R] MLO >AVT[YSND338_.GX MSZG;?$G3?CK\1/#X>?P5J-SX>TRSU QLD6H3P7*"62/(&Y5R%W=#7T?^U> - M4^!8 P!XZL./^V P?$+6_A_\ #O7TL==N/!WAW5/BUJECKOB:SMQ++IMJ M=IW+E6"%F 7>0<5^@M,F@CN8GBEC66)QAD< JP]"#0JEMT#CYGP7\.-0\+ZE M^TEXDE\)>,O$/CO3?^%>7JMK.O7'?AA^ MU]\6].\5:M!H5WXD_L=]'2\RGVX"$QD1'&&.\[<#O7D'A2'P!+\)K"3QEXQU M'X>:M;>/->N-"\3V&5%K<"*:6$YC> M1 S(?52>GX4^YMH;R!X9XDGA<8:.10RM]0:I54NG;\!(R A?&TE^2.",KQ9XV\9_ M$;X1_&GPG9^,!\8O"FD:59WMEXHM=.2&3S1.KRVI,0V3,L:%RPR>.>N*_01; M*W2T^RK!$ML%V>2$ 3;Z;>F*6ULX+&!8+:".WA7[L<2!5'T I^U2Z?U]PN1] MSXR^(OQ]\#?%[X@?L^V7A#6AKDUMXFMY[I[:"3RK?-NX".Y4*)#S\F<_*3BN M,\"'PM\.=2\>^%_B9\7/%_PSUM->OKS[!#>QVUGJ%K/(72XAWV[^9N!P<,3D M=*_0"UL[>QC*6T$=NA8L5B0*"3U.!WIEWIUI?F,W5K#Y\(367P:\#'PY<>"OC7KGPLU^ST%(K+5=6M5>+5; RR21F2*: M)4E*N6P!M;&/EZ&OJ']EWQUXH^)'P5T+7_%\*IK-R91YZ6YMQ=Q+(RQ3B,_< MWH V/?( !KT^\TZUU!46ZMH;E4;# M;[XR?M&6OC^:[M/"D^E>'X[N[L49I;;(.R8;58C8^ULX(&.016Q^SW\4-U06>GVNG1LEI;0VJ,=Q6&,("?7 [T_:)JS0N76Y/FC-+16!H)FC-+10!S?Q M)/\ Q;KQ3_V"KK_T2U] 'F%%%% !1110 4444 %%%% .37T[\-_P!@ M3QW\3/AYH_BO3[W3[>#4U,D5M.Y#B/. Q/3G!XKYBKV_X9?MD?%#X4>'(-!T M76T?2K?(@M[N!9?*!.<*2,@>U &C\=?V,O&'P%\%VGB36;NRN[26X%M*EJQ+ M0L0=I/J#@U\_UZ[\8/VJ/B%\;])ATKQ-JR2:7%()A:6\*QHSCH6P.<9[UY%0 M 4444 %%%% !7[R?\$G?^3,/#/\ U_W_ /Z/:OP;K]Y/^"3O_)E_AG_K_O\ M_P!'M0!]@7%Q%:023S2+%#$I=Y'. J@9))] *\7TC]I*]\36\>M:!\,O%6M^ M"I9O*B\06OV4&=-VWSHK9IA,\6>=P7)'(!KT;XFZ!=^*_AQXIT6P?R[W4=+N M;2!B<8=XF5>?J17C'P7_ &D_AYX:^%'A70-;UVU\/^*=*M+?1[OPQ<@C48KJ M-5C*+; >8P)&0R@@@YS6L8W5[7(;UW/7_AE\2;'XHZ!=ZMI]K<6D%MJ-WIK) M"5HF8;21@E21WQ7EVF?M>6=SH+^)K[X?>+;#P6EQ+ _B1([6YMX1'*T M;R21Q3M,D893EC'P!GI7(?LQ?'CX>>$]!U?PKK'C#2=.\1R^+-61-,N+@+.S M27LGE@+_ +61CZURWP?^/7@O0OV;=1\'I?IK_C.XFU>SA\+:=&US>32RW4X1 M#&H.U3N!+-@ A/->VI[^W[2/AA/C5IGPX,5T;O4]/CO[/5E"-93> M8KM'$'#9WLL;L.,$*<&I[W]H;P[I7A'QAXBO;35(K'PUJMSI%PEO9OX:, M@^FX%#ZJ3ZUH?"KXI:;-^R_\9O$GB:>W\+2ZMKNM0M;ZE,L.R[>V0>0"QY;> M& '4XH=./3R!2?4^A->^.>E:)\-_#/BQ=-O[Z3Q*UI#I6DP",7%Q//M3\0:+>Z)>^&_$>@R1)?Z9>O'+M65-\4B21LRNK# M/<$$$$"OF[Q?XH\.>,?V3_A)"-3M9_"BWNDV.N^(-/F#OH?EPJS2"1<^1(KA M$+G[@D.>M;7P4^(?A[X4ZC\6]:N_%,GBWP%:W=A(GCB7-[<74\BB(VS31 B< M1?NP&087>0>F:*%HK. M06\0$3R;FF8!"<(1M5BWJ .:[_-?-O[27Q0\(>%_C-\&[35_$^DZ9=:?K4UW M=PW=Y'&]O"]G.B2."?E4L0H)X).*^D8I$FC22-@Z. RLIR"#T(K*4;)/N6G= MM"YHS2T5F4)FC-+10 F:,TM% "9HS2T4 )FBEHH XWQW\1/^$)NK6'^SC>^> MA?<)@FW!QCH:YC_A?(_Z 3?^!0_^(J'XWKNU33/^N+?^A5YKY7M7T&&PE"I1 M4YK4^8QF-Q%*NX0=DO(]0_X7R/\ H!-_X%#_ .(H_P"%\C_H!-_X%#_XBO+_ M "O:CRO:NGZCANS^\X_[1Q7\R^X]0_X7R/\ H!-_X%#_ .(H_P"%\C_H!-_X M%#_XBO+_ "_:CRO:CZCANS^\/[1Q7\R^X]1_X7R/^@$W_@4/_B*3_A?(_P"@ M$W_@4/\ XBO+_+]J/*]J/J.&[/[P_M'%?S+[CU'_ (7R/^@$W_@4/_B*3_A? M(_Z 3?\ @4/_ (BO+_+]J/*]J/J.&[/[P_M'%?S+[CU'_A?(_P"@$W_@4/\ MXBD_X7R/^@$W_@4/_B*\P\OVI/*]J/J.&[/[P_M'%_S+[CU'_A?(_P"@$W_@ M4/\ XBD_X7R/^@$__@4/_B*\P\OVI/*]C1]1PW9_>']HXK^9?<>H_P#"^1_T M F_\"A_\12?\+Y'_ $ G_P# H?\ Q%>8>7[4GE>QH^HX;L_O#^T<5_,ON/4? M^%\C_H!-_P"!0_\ B*3_ (7R/^@$W_@4/_B*\O\ +]J/*]J/J.&[/[P_M'%? MS+[CU#_A?(_Z 3?^!0_^(H_X7R/^@$W_ (%#_P"(KR_RO:CRO:CZCANS^\7] MHXO^9?<>H?\ "^1_T F_\"A_\11_POD?] )__ H?_$5Y?Y7M1Y7L:/J.&[/[ MQ_VCBOYE]QZA_P +Y'_0";_P*'_Q%'_"^1_T G_\"A_\17E_E>U'E>QH^HX; ML_O#^T<5_,ON/4?^%\C_ * 3?^!0_P#B*3_A?(_Z 3_^!0_^(KR_RL=J/*]C M1]1PW9_>']HXK^9?<>H?\+Y'_0";_P "A_\ $4?\+Y'_ $ F_P# H?\ Q%>7 M^5[4>5[4?4<-V?WA_:.*_F7W'J'_ OD?] )O_ H?_$4?\+Y'_0";_P*'_Q% M>7^5CM1Y7M1]1PW9_>']HXO^9?<>H?\ "^1_T F_\"A_\11_POD?] )O_ H? M_$5Y?Y7M1Y6>U'U'#=G]X?VCBOYE]QZA_P +Y'_0";_P*'_Q%+_POD?] )O_ M *'_P 17EWE>U'E>U'U'#=G]X?VCBOYE]QZA_POD?\ 0";_ ,"A_P#$4O\ MPOD?] )O_ H?_$5Y=Y7M1Y6>U'U'#=G]X?VCBOYE]QZC_P +Y'_0";_P*'_Q M%=]X0\1_\)7H4.H_9S:^8S+Y1??C!(ZX%?.'E>U>\_"<;?!5H/\ ;D_]"-<& M-P]&E3YJ:UN>EE^+KUZKA4=U8["BBBO%/H0HHHH **** "BBB@ HHHH **** M "BBB@ HHHH **** "BBB@ HHHH **** / /AI_R>#\9?^P;H_\ Z)->_P!> M ?#3_D\'XR_]@W1__1)KW^O3S#^+#_!#_P!(1YN _AS_ ,<__2V%%%%>8>D% M>,7G[6G@6U\?:EX+C36;[Q)I^HQZ;/96&F27!0L%/G,4R%B&\9=B.^,X->SU M\R_ O3IM3^('[35K:,(KRYUX012]"K-9*%.?8FM()--LEMZ6.FU/]L+P9ITM MW=+I'BB^\*V=T;2Z\7V>DM)I$+AMC$S;MQ16X+JA4'O6KXR_:;\/>%_%5QX= MTS0/$_C?5+2VBN[V/PII9O5LXY!NC,C;E&67D*N21VKY!^&C?#;2_@L/ _Q- M^,/C;P3K&GPRZ7K'@Z2[2-0=S K##]F9I$<'(VEL[NM=EX]U#X=_#SQ-JFI^ M"_C7J?PL\:6NCV4-S8:M9K/!JT<5LOV9VAEC DTJP\->+M2\)7WAMM1:QLO#DDMY+,SKMD5<;]J*2K]E;@ M\UWZ?M?>!)O&%SX4AM]?N/$EM>PV,^FV^DRRRPF14;S) N1'&N\!F!KJUN;JZC:&W6[,ZN$.?N%DP^T_WL5Z; M^RS=VVI?%;X^WUJZ307'B6WDBF3HZ&TC*D'TP<_C2E"*5[=/U&FV]S3\$_'K MPWX.^$6M>+/$7C#5/$%A;:]=ZZ>L=T\ZR[%M(88L^9A@0IZD#O&WACQ/96TSS0V5II=]H*U()$XPS*T?!&58\C![5\R_& M+X@^%OB%J'P=\3,;[%)4JQV\ ]LU MG_$'PIX"^)?A'XC3?#OXE^)?BIX['A=H&2ZN5NXQ9K<12M$'C@0;VVG"[B3E MN*GV47NO^ /F?0[3XO\ [6/_ FUAX#3PAI7CGP[9W_BW3$BU^ZTN6RL=2M6 ME(=$FS\RN,':P&X#H<5]3_$/Q*_@WP-KNMQ6MW>RV-G),D%A;F>9F"\;8Q][ MGG'H#7QW\8_VB_AY\4? _P (-#\):PM_J,?BG1)9K""VD!L51MI28[=L9!.T M*3DX.,@5]I^*+:2]\-:O;PH7FEM)HT4=2Q0@#\ZB:24=+%1=[ZGSI\"?VP+7 M6O@C9^)_B!8Z]I,EGIOVN_UZ[T5[?3[MS)L5+9U&)'8E0%49)S7?^ /VG?#? MCGQ=9^&;K0_$_@[6=0A:XTVW\4Z4UE_:$:C+&%MS!B!R5)#8[5\EZ7XST?Q# M^R!\/?#^F78U;Q#X#U2RU;Q'X:@1FO(;6VNV$^Z+&3MWJV/0>U>N^.OBIX6_ M:*^,OP8L/AQJD?B:?1-9;7=3OK%&,=A:+"RE97(&UI"P78>>.16DJ:N]._R( M4G9:GL?[3WQ+U+X1_ [Q5XGT>"ZEU6TM6^RO;6GVD0R$?+)(O01K_$QX%>#_ M !7_ &F]1U#X/> _$:V_BWP8T'B/15U6]O\ 39K!;V&16:;R@.9HSM.0H((* M\/VI]*N];_9R^(UC86\EU=S:),I?"QTCQ)X6UG[(VH6L'B?2VL?MMLIPTL.XG*C(SG:?;@UC2_MB^"XI!> M?V3XG?PE]K%F?&2Z2W]CA]^S/G;MVS?\OF!-N>]<7^TCHMYXA_:1\ :9IK^5 MJ-_X3\16MO)G&)'MU5>>W)%>'>!I_A5<_!"R\'?$7XQ^.?"^I6EHNEZOX)FN MD1HI4X,45O\ 96=D) *[2W4-83,9%$07>7)^4+C.<^E M?/FI_MP^!].L-0UB/P_XRU#PG9R-"?%-EH3OIO5_%' MAR76OA)JN@Z/+(LUUHDME9RS'#Y: HA8\8/(S7P[XV^-^A6?[#MQ\+KC1=?T M[QOI6EV^FZAI3Z-<*EHT4T8:628H(A&Q&00Q)+#CFLZ<%+SU*E)H^OO'_P"T M!:>!=6M-.@\%>-?%D]Q9I?%O#6C&[CBC8D#>Y=0&X/RY)K.F_:P\"_\ " :) MXILAJVK?VS>/IMCHEAI[R:G-=IGS(/(."'3!W9( ]>1GQ/XD?%"*+XSW'A;X M@_$K7/A?X,L="LKK1XM$-]?\!WEOX\UFX\.^+)-XN+>4>6"+AY$."Z,-PD R0W_ M !R_;!OM ^&+ZKX<\+^+O#^NP:S965Q;ZUX?*O%')("V02RD.NY4()RW YKO MM7_:\\&>%M.T.\\3Z7XG\)KK%S<6MK#K>C2V\[/$BN?W7+D-N"KM!+-P!7S+ MXQ^(?BSQ[\ OB*FI^)%^(WAGPKXCT>:P\8VFFBV%[;K,KW.5C&U_)PH+*.RBTGPWXRO=!O;Q;&V\4QZ%(=*ED+[ 1-G.S=QO*A M?>O-/VAO#FH^+_VDM2T32"?[4U#X6:G;6P!P6D:?"C/N3C\:Z+]GO]I[X:6' MPT\!^#[C64TGQ;;V]KHDOAJ2WD%[#=J%B9&B"Y W G O".L>(]4\W^SM*M9+RX\E-S^6BEFVC(R<#I7B-O^W1\.GETR6[ ML/%.EZ+JL9;3M=OM#F2QOI F[R87&6>3J N"> 3Q7<_M/\ _)NGQ)_[ %[_ M .B6KP_XA ?\*P_93..1K^AX/_;JU13C%K4UOX\>&/#_P +-&^(%U]L M_L#5OL?V;9 #-_I+*L6Y<\"O$O[(7P\\$Z;JS7GBJRFT2WOM,CMI3)9/!/$LGGG; MB/YEP-Q&21C-6J2DU9=B7-K<^L_'7[3GASP9XQNO"UEH?B?QIKMC$D^H6OA3 M2FOC8(PRGG'*A21R%!+>U5_$'[5GA31UT&"PT?Q-XFUK6+$:E#H.AZ0\U_#; M9QYDT3%?*&[(PQ!R. :\L^&OQ3\+?L\?%WXQZ1\2-5B\+WFM:Z=-0HCDQAC&05*]1G@5'H7QA\)?#W]I/Q/XY\3ZG_9/A'QWH&GS^']?OX) M(H)%A#"2 LR_(QR'"MC((H]FNW_!'S>9Z\/VJ_ +_#0>-([C4);8WXTG^R4L M7.I_;R(;Z[\&>-]$N=%MX[F73-2T-TN[ MA';8OD*K,)3NXPK9'>OF%(O GC+2OB/XX\7:QJW@OP7XF\:VUYX6\36<3PO# M:COOVB?B7H/A+XC6WAKQ^GQ)\-:/%IYA\?V^CQB M33Q-,%N%P@\N=HX_GW8..IJO9)["YWU/J+P'^TQH7C7QI:^$[WPWXK\%Z[>P M27%A;>*M)-G]M1!E_*8,P)4')!(/M78_$SXG:-\)O#]OK6O?:5TZ6]@L3+;Q M[_*>9PB,_(PNXC)[9KXS\,:QX.U?]J7X,/X4^)?B;XF2*^H_;-0UF\DN+:)C M:$A8OD2-&/)*IR!MSVKZN_:3\#-\1O@3XVT&)=UU/ILDMMCJ)XQYD1'OO1:S ME",9)=&4FVF:=W\9?#%E\7;'X:RW;CQ3>Z%IO"OP?\ V8UO M%*ZCJ7CJQU>\+=3-']&_X M61-/H_BJ8S?;[2Y6)&AGF=T+*2,Y,B]6YP>1I[*-B.=GUMH_[3/ANXT;Q%J? MB'1O$G@.WT&U6\NQXITMK4F)B0K1E2PD)88PI)R0,&/&?BO2_#] MUH?BGPC?:PC/I+^)]):RBU(*-Q$#Y()V\[6VG':OE'Q;XL\<_$KP5X\\/6'B MP_&GP;X8FTG6H]?L]-2&681W(>>SS$-D[+&N\D9/'/7%>K?%+XO>$OVCO&/P M>T+X;ZHGB/5+/Q);:[>2V<3XTRSA5C(9B0/+)W!=IY)XQ2=)+I_P-!\[.D^# MOQIO?#/@/XA:UX@B\2>,)+?Q_J6E65GI=N^H7:QAD\N*-,\(HSW %;6H_M:: M5J'A'QP++P[XKT'Q?H.DOJ*Z%K.C&.]:,@JDZ1AF5XU?&X@\ '(KY\C^(>M^ M ?A]XA6RUZY\'^'M4^+>J66O>)[. 2RZ;:G:=RY5@A9@%WD';3O!A\/^)OC_ M .+X/!'BWQ%\0K:X^&]_ FJ:Y=RW333&4#9!(ZJ&7) ^0;=Q/?-4Z:=VT+F> MQ[M\$_VKK+7O@M:>*?&^GZ]H;6.DP7>H:UJ.C/;65Y(^%Q:L!B4LQ&%0&[WP_XH\'ZKJ,#W&FQ^)M,^R+J"(,OY+!F!8*"Y-*U#Q#I&CY_M*S@@?!OQS\2O ]U8_&SQ9X_\1V=Q)=Z5I=[>)<+$YA8.956V4QC;D'G^&/VSOA_XS+KH=OXAU5X8KJ6Y%IH\LJVWD!RR2.N5#L$ M.U,DG*\#(J]X4_:IT#Q#XNT;P]J?A3QEX+N]:9H],G\4:*UG!>2!=WEH^YL/ M@$[6 KQKX->*_$7@+]@'6]?\(VWG^(;*74YK8+#YI4_;9 TFS^(HN6QWVUYS M/XF\'^)?B-\"KC0_BQXH^)FNR>*+.74#J%S(]C:EHV) B6-8H7)R GWL!NV3 M3]E%MV0;? #_DCGQY_P"QK\1_^@+7I/[)7_)M_@#_ M +!J_P#H35UR_P!RG_CC_P"DR.'_ )C8?X'_ .E1/7****\@]0**** "BBB@ M!#28_P XIU)B@!I'RG_"OYJ?VH?^3C_B=_V,=_\ ^CWK^E^DM!;VS"%I'+%,F<$XSCH.E 'Y&T5^IG_#G M_P"&G_1?(_\ P%MO_C]+_P .?_AG_P!%]C_\!;;_ ./T ?EE17ZF_P##G_X: M?]%]C_\ 6V_^/T?\.?_ (9_]%]C_P# 6V_^/T ?EE17ZF_\.?\ X:9_Y+Y' M_P" MM_\?H_X<_\ PT_Z+Y'_ . MM_\ 'Z /RRHK]3?^'/\ \,_^B^1_^ MM M_P#'Z#_P1_\ AGV^/L?_ ("VW_Q^@#\LJ*_4T?\ !'_X9]_C['_X"VW_ ,?H M_P"'/_PT_P"B^Q_^ MM_\?H _+*BOU-_X<__ T_Z+['_P" MM_\?I/^'/\ M\-/^B^Q?^ MM_P#'Z /RSHK]33_P1_\ AG_T7V/_ ,!;;_X_0/\ @C_\,_\ MHOL8_P"W6V_^/T ?EE17ZF?\.?\ X:?]%\C_ / 6V_\ C]+_ ,.?_AIC_DOL M?_@+;?\ Q^@#\LJ_>3_@DZ/^,+_#/_7_ '__ */:OF?_ (<__#3_ *+Y'_X" MVW_Q^OOC]DOX'Z7^SS\%=+\%Z-XC_P"$JT^UGGFCU,1H@D\R0L1A68<$XZ]J M /9*A-I ;D7!AC-P%VB78-X'IGKBIJ* "BBB@ HHHH :Z+(I5E#*1@@C((IL M$$=M$L4,:Q1J,*B* !] *DHH **** "BBB@ HHHH **** "BBB@ HHHH \F^ M-"[M3TW_ *XM_P"A5YUY8KTKXPKNU+3_ /KBW_H5>?\ E"OI\(_W$3Y+'1OB M),J^6*/+%6O*%'E"NOF9P6*M>4*/*%',PY"KY8H\L5:\H4>4*.9AR M%7RQ1Y8JUY0H\H46*M>4*/*%',PY"KY8H\L5:\H4>4*.9AR%7RQ1Y8 MJUY0H\H46*M>4*/*%',PY"KY8H\L5:\H4>4*.9AR%7RQ1Y8JUY0H\H M4X?"WCP;:_[\G_H1KQGRP,U[3\,0!X0M M@/[[_P#H1KSL>_W2]3ULMC:LWY'59HS2T5\\?3"9HS2T4 )FC-+10 F:,TM% M "9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+ M10!X!\-/^3P?C+_V#='_ /1)KW[-> _#3_D\'XR_]@W1_P#T2:]_KT\P_BP_ MP0_](1YN _AS_P <_P#TMB9HS2T5YAZ0F:,TM?)/@OXLZ9\'O%O[1_B36A=7 M<$'BFSM[:RM5WS7,\EM&L<,2DXW,Q _,U<8N5[$MV/JV;3K2XN8KF6UAEN(O M]7,\8+I]#C(HN=/M+R6*2XM89Y(CNC>2,,4/J"1Q^%>*^&?VD-9@\;Z+X:^( MWP\O/AW-KR2-I%Y+J<%];W#QKO:*1H\>5)MYVG(.#S6;H/[4'BCQUOUGP;\( M]7\2>!%NFMH_$"ZG;P2W*J^QYH;5_G>,$'!R"<<"G[.0%?$+X]_$'P)/X@U!?@S?ZCX/T5I'GUE==M8 MII8$&7FBMB-S #)P2"<5RGB+Q59^+_VHOA'K>G33/I.J>"M4O8MI*,T;B)E/ MLV#^!IJFWN+F1]0'!&",BH+2PM=/C:.UMHK:-B6*0QA 2>IP.]?.?PM^+'B* MT^!G@K5/ GPZUOQGHUW;W4LD^J^)K5;FUVW$@Q++<%3)G#$$< #M6QX"_:4 M\3_$SX3S>,/#OPKU&_NVU,Z=::7_ &K;JMTB\/<+<$;/*# KNY!QQFATY(.9 M'N=MI]I9Q/';VT,$;DLZ1QA0Q/4D 7OA3X@:;X>EUBRLH=8M[B.>V.4,\=PNU0T9^8J0#\O' M)K@-.^,GB;6/V1+#5_B%X5\16>F1V6F2)XBT[Q'#'=ZK(\\:;P8R9(\[@Q#C MD9%-4I,.='V=;V=O:-*T$$<+2MOD,:!2[>IQU/O4V:\3\9?M#:U#X_U?P?\ M#_X?7GQ!U30XHY=8F34H=/M[,R#%_% M.G^%]9U:XUG7/^$=FT*$(M]9WH#[XF0G#,"F,9 .X'(J?9R?0?,D>_16-M;W M$MQ%;Q1SR_ZR5(P&?ZGJ:+6QMK'S/LUO%;^8V]_*C"[F]3CJ:\@^&O[0&K^) M?B9<> _&7@*[\!>(7T\ZM81S:C#?1W=L'V,=\7".I(RO/U]?9ZEIQT8TT]A, MU!:V-M8^9]FMXK?S&WOY487K_LT^-?'$<>C>./C#?>)O!8NDN)M%CT*VM);I M4<.D4MRA+,@(7.%!..37T-151DX[":3W*\MA:S^1YEM%(8"#$70'RSZKGI^% M/N;:&\@>&>))X7&&CD4,K?4&I:*D9%%;0P6ZP10I' J[1$B@*!Z8Z8IMI9V] MA"(;6".VA!R(X4"J/P%3T4 )FH!86HO#=BVB%V5VF?RQO(]-V,XJQ10 F:,T MM% "9J&"SM[:262&".*24[I&1 "Y]21U-3T4 5[NPM;\(+JVBN0C;E$T8;:? M49'!I;NSM[^$PW,$=Q$2"8Y4#+GZ&IZ* (WABEA,+QJ\1&TQLN5(],>E,MK* MWL[<6]O;QP0 8$4:!5'X#BIZ* (;6T@L81#;0QV\0R1'$@51^ J7-+10 F:, MTM% %>2QM9;J.Y>WB>YC&$F:,%U'H#U%3YI:* $S4,ME;3W$4\EO%)/%GRY6 M0%DSUP>HJ>B@""YL[>\\O[1!'/Y;!T\Q VUO49Z'WJ26*.>-HY$62-AAD<9! M'H13Z* (;6T@L8%AMH([>%?NQQ(%4?0"FVUC;6;2M!;Q0-*VZ0QQA2Y]3CJ: ML44 1S0QW,3Q2QK+$XPR.N58>A!HAACMXDBBC6*)!M5$7 4>@ J2B@"O!8VM MK-++#;Q0RS',CQQA6<^I(Z_C26VG6EG-++;VL,$LIS(\<85G/N0.?QJS10 E M0VMG;V*,EO!';JS%V6) H+'J3CO4]% '-_$D_P#%NO%/_8*NO_1+5P_[)7_) MM_@#_L&K_P"A-7<_$G_DG7BG_L%77_HEJX;]DK_DV_P!_P!@U?\ T)J]./\ MN$O\:_\ 29'FR_WZ/^!_G$];S1FEHKS#TA,T9I:* $S1FEHH 3-&:6B@!",U M_+Y\2O\ DHOBG_L*77_HUJ_J$K^7OXE_\E%\4_\ 84NO_1K4 @YHS6?H7B/2_$]G)=Z3J%OJ5M'-);O+;2!U66-BKH2.ZL"".Q%]2VWBW1;RSU2[@U6TEM M=+EE@OIEF4I;21C,BR'.%*@@D'I19C-7-&:Y_6/B%X9\/>%(_$VI:]86/A^5 M$DCU&>X589%?&S:V?FW9& .3GBI?!_CCP_\ $#2!JGAO6+/6M/WM$9[.42*K MCJC8Y5AW!P:+/<5S;S1FN%U[X[?#OPOXNB\+:MXTT33O$,C(@TZXO424,V-B ML"?E+9& <9R,5W=#36X7$S1FEHI#$S1FEHH 3-&:6B@!,T9I:* $S12T4 >8 M?%M=VHZ?_P!7]*^BPK_7]*3RS[5U7./E*WE#WH\H>]6C$11Y?THN@Y"KY0]Z/*'O5KR_ MI1Y?THN'*5?*'O1Y0]ZM>7]*/+^E%PY2KY0]Z/*'O5KR_I1Y?THN'*5?*'O1 MY0]ZM>7]*/+^E%PY2KY0]Z/*'O5KR_I587D)OVL\D7"H)",<;2<9K.I6A2MS MNUW9>;[&D*,JE^57LKOT$\H>]'E#WJUY9H\OZ5I=&?*5?*'O1Y0]ZM>7]*/+ M^E%PY2KY0]Z/*'O5KR_I1Y?THN'*5?*'O1Y0]ZM>7]*/+^E%PY2KY0]Z/*'O M5KR_I1Y?THN'*5?*'O1Y0]ZM>7]*/+^E%PY2KY0]Z/*'O5KR_I1Y?THN'*5? M*'O1Y0]ZM>7]*/+^E%PY2KY0]Z/*'O5KR_I1Y?THN+E*OE#WH\H>]6=GTI?+ M^E%Q\I5\H"O8_AN,>%+&>\%%%% !1110 4444 %%%% !1110 4444 %%%% !1110 M4444 %%%% !1110!X!\-/^3P?C+_ -@W1_\ T2:]_KP#X:?\G@_&7_L&Z/\ M^B37O]>GF'\6'^"'_I"/-P'\.?\ CG_Z6PHHHKS#T@KX=\;_ E\9:MJ7QAU MG3/#FH75UIOC[2O$NGV3:KJ^K^(-*EL%MV\AXTMT\P R2%GYVY M ZU8^ ?Q>O_ ()?#?0?ACXE^'GC*3Q9H9.FQII6BR7%I>H)#LN([@?N]A4@ ML6(Q@U]:457M$URVT%RN][GYV>*_#(\0VGQ.T_XB?#CQ[XZ^*T]UJ T>2.UN M9]-BMB#]E>W(<0*BC!Q@L2, $G%>J^!? _B.T\>_ 2XG\/ZI#;Z;\/+NROI9 M+*15M;@Q0@0RDKA')! 5L'@\5]?453K-JUA*%CX"6_\ &WAO]F/X6?#"7P7X MWL['5DN3XGOM'T"ZN+JTLA=2DVP14RDDP(&6QA#GG-=U\8_$=UXG^%'@ZT\* M>#O'_AWX>:1K,%EXAT:TTBYTW4I-.6([1#'Q(T6[:'*<^]?8=%'M=;V#DZ7/ MA+X=?#6QU3XS^)[OX?\ PT\1^#O"NI> ;W3X+S6[&>!;V[>0 $M*S,"1@ .0 MQ"DXQS3;W5M5\:_L4P_#BR\&>+8O%_AVVTNVO;&XT*X7+Q7<0?RFVXDP%+?+ MG"\G%?=]%'MKN]@Y#Y8L?$UY^S7\:OBA=:]X5\1ZSX?\87D&KZ9JOA_2Y+\> M:(1');2",$HV5&W/!!ZUY[I/PJ\9IHO@/7;[PQJ5I>Z[\5_^$IN=+2W:632[ M.0.%-P%!$> 6)P 6P>:^Z:*2JVZ!R'A/B3PYJT_[9O@W6XM+O)-&@\)WUM- MJ*6[FWCE:="L;28VAB 2%)R:]VHHK)N]BTK!1114C"BBB@ HHHH **** "BB MB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** M "BBB@ HHHH **** .<^)/\ R3KQ3_V"KK_T2U<-^R5_R;?X _[!J_\ H35W M/Q)_Y)UXI_[!5U_Z):N&_9*_Y-O\ ?\ 8-7_ -":O3C_ +A+_&O_ $F1YLO] M^C_@?YQ/7****\P](**** "BBB@ HHHH *_E[^)?_)1?%/\ V%+K_P!&M7]0 M=?R^?$K_ )*+XI_["EU_Z-:@#FZ*** "BBB@ HHHH **** "BBB@ HHHH * M2I!!P1WHHH [ZR^/WQ(TZTAMK;QOKD,$*A(T6^?"J.@'-?\F2^ /K>_\ I7+0!]!_%6[U*P^&/BVYT;?_ &M#I-U):>6,MYHB8ICW MSC%17DK?LK?#G^TI;F/2]0MK.6Y^V2:-;:S>1:8\^[=YAM%E$.<\XVXSVK M1-6LR6G>YD_LA?\ ),=;_P"QIUK_ -+9:\Y^'/ASPKKG[$FLMXKMK-M.M_[: MG^TW"KNMW6[N"DB.>5<, 00I1 MP&=G\QF,(N/+Y8DE=N#Z8J'3_P!DKX5:;>13IX:FNDBN6NX[._U:]N[-)BY< MN+:69H@=Q)^YUK3GC=N[_KYD\K/F+1=&\5:UXGM_'@AFG^(?A3P5X?UH1OD2 MW:XN!=6[>\L1;C^\%]*[SP/'X9^,'[.'QPU66TMM:T:[U[6M5LOM"!U#?9D> M-\'HRY_ U]2VG@O1K'Q7J'B6"R":UJ%K#97-SYCD20Q%C&NPG:,%VY !.>2> M*Y*+]G;P#:>"=2\(V>CW.F^'M1OI=1NK/3M4N[7S9I!B3+QRJX1AP8P0G^S3 M=5/\!*#1X=XQAN[_ .#G[-UAH4\<'C&2XTZ?1FO5W6(DCLBTIN%')7R]^ OS M;B,8ZUVW[,][=P>-/B[#XIM[?3O&G]M6\^JQV,F[3]CVZK;M QPQW(F6W@-N M[=*[EOV=? C>!K/PE_9U\='L+E;RQ,FL7DES8S*H5&@N'E,L6T# ". !GCDT MJ?L[> O^$4NO#UQH\U_8WE]%J=W+>:A:Y!5< MC QC'% M)SBU;^MQJ+3N<5^TF;;Q]I]W\(O#=C;WOBCQ.(Y-1F6,%-+LPZ[KR=@.&PNV M,'YF;&.%)KW>RM1965O;JS.L,:QAF.2<#&37F'B#]E[X=>)O%.J^(KS3-4BU MC5766]GL/$.HV8F95"J2D-PB\* .!7ING6$.E:?:V5N'%O;1+#&))&D;:H & M68EF.!U))/!BHWJLK>57*_$;Q1<^$-%@G MLX$FNKJX6VC\W.Q203DX_P!VNKU&\M]*L9[R[E6"V@0R22-T50,DUX]XZ\?V MGCV%/#^CV5Y-BTZGFUJD**LW MJ=!X>\?SVM[+8>*9+*SE6+SH[I)-J.N0,')^]R#Q[UW-C>6NJ6RW%G<174#= M)(7#*?Q%>+_$/P18>#(?#ER[2:C."RW4 1T]74#-,TC5/$/A M[Q1=Z=HNGPZ8EVBW M=04D*!D94 C&>A^@JY4N:TH=>A*GRZ3Z+<]S\JCRJY M/PS\2=-O[!1K%W9Z7J2R&%X))E4,P[KN.<'^?%=DH#J&&"K<@]B*Y+M:,Z^5 M/8A\JCRJL;/I1LSV%.XN0K^51Y56-GL*-GL*+AR%?RJ/*JQL]A1L]A1<.0K^ M57/:[']AUW2;WHK,;:0GIAN5_45U.SV%4M6TF'6+*2UF!V/_ !*<,I[$?2O) MS3#SQ.&<:7QQ:E'UBTU]^WS/2R^K'#XA2J?"TXNW9JS^[?Y$GE>U'EUC)9^) M;)=D=Q8WL:_Q3JRR'\1Q4VG:[-)J']GZC:?8KTJ60AMT<@]CZ^UG*FY:>\M+]KIM7[:ZFU3*IJ,IT9QJ):Z/6W=JR?W)FF(LT"/-9GB>ZFMGTN M"UE*3SW*K@="@^]GVP:W/+Y[5WT<9&M6J48KX+7?JKV^74XZN$E2I4ZK?QW_ M =BOY5,<+&C.[!%49)8X %4?$7B"+08H1L,]Q.2(H@<=.I)[ .X0'!,3AL'TXJ?RJYF VEAKNF7>GJ(K.^# M6\L87:%=>1D=B""*ZX1[1C K7+L;4Q49PK)*<'9V>CNKIKK9IHSQN#CAW"5- MMQDKJ^ZL[-/S3(/*H\JK&SV%&SZ5[%SS>0K^51Y56-GL*-GL*+AR%?RJ/*JQ ML]A1L^E%PY"OY5)Y=6=GTKGO&7C"T\'Z5]LD0W4CR"&&WB(S(YS@>W0G\*%= MNR$XV5V;#($!9B HZD]JXSQ?\0AH6HP:9I^GOJNI2IYOEH^U47U)Y]#VK@/% MWC'4?%.I:;I^JV5SI&GKNDGB@K:I-I.K3Z<\(4 M6P=-Q>/Y@S8.,@,,9!X((/:NF--15ZOW(QE._NT_O9ZIX/\ $2>+-(^V+ ]K M(DC0RPN76EZIJGAJ]Q+/"7G>4=1("JOD]U8-&ZG M&<,0?NUZAY?L*RJ4W2ERE4I>VCS%<1XKU;P!QX9@_P!Y_P"=>8^7FO4/ @QX M,>R)FC-+10 F:,TM% "9HS2T4 ) MFC-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% M'@'PT_Y/!^,O_8-T?_T2:]^S7@/PT_Y/!^,O_8-T?_T2:]_KT\P_BP_P0_\ M2$>;@/X<_P#'/_TMB9HS2T5YAZ0F:,TM% "9HS2T4 )FC-+10 F:,TM% "9H MS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 F M:,TM% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 M)FC-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 *?^P5=?^B6KAOV2O^3;_ '_ M _P#0FKTX_P"X2_QK_P!)D>;+_?H_X'^<3UO-&:6BO,/2$S1FEHH 3-&: M6B@!,T9I:* $/3BOPN\;?\$MOVBM:\9:]J%IX/LGM;N_GGB8ZS: E&D9E.#) MQP17[I44 ?@G_P .I/VDO^A-L?\ P=V?_P NZCH]K>K+J6GK$]Q %8;1*I:,@D8;(4GY M2<8YQ5K3M9M=3TJ#487>.TF0.K7,3P, >FY) K*?9@#0!^$'_#J3]I+_ *$V MQ_\ !W9__'*/^'4G[27_ $)MC_X.[/\ ^.5^[.G^)=+U76-3TJTO8I]0TPQK M>6Z'YH2Z[TW?5>:CU7Q9I.BSZ9#>7BQR:E>?V?:A59_,N-COLRH.T[8W.6P. M.N2* /PJ_P"'4G[27_0FV/\ X.[/_P".4?\ #J3]I+_H3;'_ ,'=G_\ '*_= M?7_$^F^&([-]2N1;B\N%M8!@DO(P)P .P568GH I)P!7$VW[1O@"\LI+F'5K MQPI@\J#^Q[T3W2S%O*>WA\GS+A'\MR'B5U(5CG - 'XO?\.I/VDO^A-L?_!W M9_\ QRC_ (=2?M)?]";8_P#@[L__ (Y7[=V_Q?\ !MU/X5@B\06KW/B@,VCV MXW>;=A49V(3&Y0JJV2P !&TX) I(?C!X/NI=92VURWN_[&OX=,U%[<-(EKRB@#\$_P#AU)^TE_T)MC_X.[/_ ..5^M_["OPH\2_!']F+PEX- M\762:?K^GFY^T6\4Z3*N^XD=?G0E3E6!X->^T4 )FC-+10 F:,TM% "9HS2T M4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FBEHH X3XBH M6O;/_KF?YUR7E>U=EX_4-=VG?Y&_G7+%<=3BO8H?PTCQ\0E[1MG!?%Y+A?!S MF"$RHD\--*GT-+&PU*VOKD7"3RQ6LRR,D<+"1MV"<9**@SU+@ M51\?Z?!HG@+PF-566YN;14BE._YB$@,LO7JS" KS_?-?0T(VA3C)=7H>!6<7 M.I*#V2U^9F7/A5/#*V&N^-=?NM4E?:ZV*PESE?WOEYS]Q2NYCAH_B-K^K7/BF#P]I&JR:*!$K2W42J=I99'9 MFR#\J1PL<#&3(O.*TC)U.7^9IOR2,I1]FY6>B:7FV>=^*+#1O!'C36+>2R:_ MLVCC5"6R89&0':23DGD-_P #7U%2^$O&/B&U\/M>6VMVZVE@2J:?,BL2@.=I M/7VX/ QBL:QL]7E234+A5-A#(O\ Q-;R;+F5PLJ@H 69\^4[!=W,:("H!QV? MPPT+2/%?BW[=961N-"LHBD9M6/QP-Z/M:>'[AM(0A)+P2@E3W.S'0?7_"NMM/B;X6OM26P MAU>*2Y9@BC:P4L>P?&W/XUYWIOA>#7/'NKZ#8W\T&@/+.TD,!! "+#N"L0># M)*Z_\ ([5E:9X1O;ZZU+P9:6]G));RRD:BY((5-F3@ D',JC'L>>*\^5&&K5 MU9)GHPKRTV=VT?0?E# (Y!Z4GE<]*^;-+@N8+B7R)]1?QU'<%6C!+LS C(;L M5Y&>V#5RS\4:\MG_ &JOB.[E\0&;;_9;)E2<_<\O'X8Q6;P\E>S6BN;JLG:\ M7J['T3Y/3CK3?+&!Q7SO9^*->@L+;4K'Q'=ZCKD[D/IK)O!]1LQ@8^G&*ETS MQ-KUI;V=_I_B&[U;6IV(DTUUWJ>,D;.V/;IBIE0G%/5: J\6TK/4^A3"!UI! M%GM7@7A[Q%K@GTN]M?$%SJ>KW5P$ETR0Y4@GYAM[ #)XZ8S5:V\3Z]*DVI3> M(KJ+7UN-@TG;\N7Z=L4O834K76UQJM%I-1>KL>_7]U;Z9:27-U((84&6 M9OY8[GVK"GL]0\37&GZE8:9(UK92-,[22(CLI7' +?SKR"WU?4]:N);C6=6G M.HBZV/I3?*D0&>B^V,5]'?#_ /Y%>[_ZY5^?9WCYK&1RYQ7*XJ=_-.Z]-4?: M93@XSPDLW-7] M:\2W'AV[\O4]->!,@,TY&?E_2NZ^*V MCKJ>GI>HN1(FXD#OWKYZ.?8B-.OB<,DI\RNVXM-1 M>S5W>WGN>=R2KXI\:R/$PEMH (8F'0XY)_,G\J]8\272>'?",5N/E9UW&O// M@KHR7%U(@7!MY2K<=!U'Z5H?&/Q 6D>&(Y ^1%]>P%?/U,14G3Q&83TE5=EZ M=/N5D>S"A!5*."A\--7?K_PYF^!O"EUXNM;R_%ZMK#:W?VF)6AWAW4 '/(X/ M3\*U]*\0?:=3DTRZ54O$!97C)*R 'G Z@\C@Y^M=%\/+(:7X)F1>JQ8+>I/) M/ZUXAXUO#:ZQ-<1:F^ESPJSQ2QGEFR!M]\^E?3Y/C*V'Q&%PM)I^UT=^O*M_ MN1\_FN%HUJ&)Q-1?P]5;S>OWMGM0BH\KVKY\/B;7]2O+^XUKQ!=:)?VRJ8;) M%\M3P"/E]^OXTR'Q/K^HM>W>L>(KK2=2M@I@LE3RE;@8.S'.>O3O7ZXJ$I)- M-:JY^9RK15[IZ:'T/Y7M1Y//2OGH>)]?U2XO;K6_$%UH>H6RJ8;)%\M3P,'; MWSG//K5=/$FL:E#=ZAJ?B.]L=:C8+#8QJ8QG@ !/?/3'.:%0DTFFM=1.O%.U MGH['ND_BS0K:^ELY=6M([J($O$TRAEQR:W'AF32=.M-#UC1VL+^[D#-J,K!E5#(J%N"\\%ZEHNC:C6_8V=CIUW\BBWR)XE)'1L]<'&<5B:+HOA_P 0:_H]E8ZC/;ES M^^GF6B8_[29[YJS\2H+GP]X\ MT7Q1-:F_L[15C@#-A(W.]9%)/"LX="K'@M&%R-PJ?7O#,'C":W\3>$=0$>H, MX9XMWEOYBC:6 ;[DBK\K*PPP ##H1$6N52_F5F_._7Y%24E)I?9::7E;_,PO M#^I)\-_'^N#6XF4ZD[2S7[Y8A!(Q24?],MKA6Q]PIS\I!KV6&2*Y0/%(DJ$ MAD;(P1D?H0?QKSJ^\90PZS9:3XRT>(/:,LPU#'R+(&(6=5YQ&01D@G:20P P M3C^+]*G^$NI1^(M)NB=,F^0PRR$C 5F6%B?O(0"$;[R' R5.!E4I^WDKZ2:T M[.QK3J>PB[:Q3U[JY[#Y->E>"!M\/0C_ &F_F:\[MW^T6\C>#1MT&$=/F;^=?.8JZ@D^Y]'A;&-0T1@Y8RB6XDA97"XP5 C;/S YQP>WHV:,T ?,6E_LU>*==U/1Y?%U MOX8DL+%]'C>S@N9;Q)8[*UO(2Y$EN@W,]Q&P4C VGYB0,\_X4_8\\3^'=(O; M>>;0[^7%FLD,]V3;ZZ(;L3M]L5+1-F\ @[OM+ NWS$9!^O'8T@O]/O_ +%:7"QQL]O:7D+_ .IL8%&YIXL$QEMJ MGU2?4=3FC+8<2Q M7>Z.%MF659+KC=M^4$\'BJ'Q&^&.I6_ASXKQ6%K#.?&)M+33;>R1BT+F)(&D MD 4! K9D+ D87)P>*]SS1F@!L*&.)$9BY50"Q[^]/I,T9H 6BDS1F@!:*3-& M: %HI,T9H 6BDS1F@!:*3-&: %HI,T9H 6BDS1F@!:*3-&: %HI,T9H 6BDS M1F@!:*3-% ''>.EW7=K_ +C?SKYZ^*/Q*%PFJ^'=-L+RY\DK'>W,USZUJ]U'1]4_LPZA_Q]P20^8C'&"P MY&">_7FO;'CFD&(Q+@N2/ M[D<2JQX' 3UJ"73/$_CJ6PU7Q5%IVC>'H@'6227ROW+,K,61B<.ZJ$Y8;59N MYQ7 WWAZ#1[;4[37-0NK;5[&1EMX)&(1X\G[H_NL.H'!!-=/K7C>Y^)E_P"& M[:ZL9]+TB21(3A)MJ5[]6^WH>#.FE=6MLDN M_J=+XCU>'QA\3?#\&D7B75I;LB&>UDW(QWB:7#*>0%@C4_\ 74"G>*["VO?B M7?:?:PM_:-]ILMNLI?Y1+-;R %O0*ML!QWES5CQ#)IWPTU:#2/!7ARP_MR>- M 79"6(58#G8#!*PO!]F[?"?QQJ;MA;BT)CF1\JSK"7;8PX($DCKD<9!K?O(CXA^#6L76H M(;VYTY]1:)YF8D!&F3KG/$;,H],#TK6I*TU)[1EK\TOR,X0O3DHZ.4=/17_, MH>+-+B^$VCV&F^$8$L+V^4J][(/-D(4HBC+$XR\R^P&[ R:=]G'P4L6OKZ6; MQ/K]^K@;%$*[0V]SW/S/(/4DE *M^*$/C'P/9Z[,PM)],NY;5DC7(XNEB! MR3G@QHQ^AI_Q')\5Z5X:\16$1-@"N[S<*5WW5J54@GJ3%MQZFLXRYN6,];MJ M7G8N45%SG#2R3CY+N-\ :3J6A2ZQXM\60QZ+YD;LT;RAMN^3>Y.,X&%B0#.3 ML)XSBLGP??6GB7XDZGXIM[.6ST:V\YI=1O(#"I588XR-S8[JY/H%YP3BO2OB M-;G5?A_J4UB1]ZLY;PCJMCK?Q+UCQ'80R6NB MVIG:YU*>$Q1$""%6&X@9)9"V.P7)QD97P3J-IKGQ)UKQ)8P/::';M<-/?SQ& M*,_NH%/+ 9.Z)V/H!SC-:?@Q7\8?"[Q-H\:&&^9IY8XV&.9@9D!^CED/NC5- MX(1O&GPN\0Z+$ODW4OVD(K#! GS+'GZ&0J?=&K:;BN?RLOEW,H*3Y=>[^?8R MO!%U;^+OBQJ6N:/:S?V7&\@EO9(#$C_N8DP"0,DLF?8+D_>%1)J5EXV^,-O= M:# ]S;V1MS<:@L)$6%6?<=Y&""LJ ?WNHX7-=9\'M0CUOPOJ.GR1M#(EQ)(Z M8PP2X)E'X@NZ?5#6;\%"]LNMZ!=KY5W&$)&W&2B"V?'_ *$-])%I2E&+G*W MPI)?YE0C)JG&^[;?KV.2\9^)-)\3^/9I=*5KE+>&"WDO4A/ELP:4X#XP>&&. M>>V0*]W^'_\ R*]V/^F5?/VG2OHVDWGA^X0I#GBR'>)=R\YXKQW5M&_MWQ-=6R+NF$$LL6!SO7!&/KC M'T)KN?@]KPE2.)VRCC::^(P,94IQJ5/@K&+.X!]YY]#Q^ MI_2NI^+.B/IFHM/"")(WWH?<'(KS;P_ QV+'^E>7?#; M65M_&FHV$B$+>Q;HI>V^(Y9?J1+D?[I]*^SR9-9OA$E?DA)_A_P3Y/-&GEF) M;=N::7X_\ Q/B/J=EXM\>:5H^BPR:AJMH&66:&(LD!\Z$@E\8&W8Y/H01U.* M3QYJ5EXN^).CZ9HD+ZAJ5D LUS#"6C@(NH'RSXP OE29/K\O4XK9^'H?PQ\3 M-:T6>,@7 D6.1E^]B1[A.?=+EA]8F]*3X:AO#GQ%US1)T*^8'6)V&-VR5Y5Y M[YCN5_%']*_;[JFM%?E5UYWW^YGY!:51ZNW,]?*VWWHQ_B3J=CXO\=Z5HVBP M/J&JV@99IHH24@/GPD;GQ@;3&Y)SQ@CJ<5+\=)+.^UG1M*T^W-WXED$RJEO' MN>-6B8QEF_A E6-N>@1CT%:G@)3X;^*.N:5<+L^T"58G8?>Q*]PG/NERP^L3 M4SX@QW'@OXAV'B2.%[BVN"#(D:EFRL925?J8]KKZF$C^(5,.558PCT3:\QMR ME3E.3M=I/R*GQ2%SXN\:Z'X5LTBM\%QJ4O]D?%RXM["[,NE>(["+]\8UQG! M FC0GGY) C D J?+8<'EPJ)1B]DD[^5^HITVY-;W:M_>MT,'QMIMGH_Q2-[K MMN+FPOH7B6ZEY\F!XUC?:3T,;#<%;G3KR;0M8&VUWAK;5-FZ M$-)A S= T2P'09$;(P' =%88W MUK&K.*4'NE?U7=&4Z49-S6TG;T?9E33_ !CJ6@>#K,ZQ9Q>(]&N_W:SB4.H3 M-N\+G.UCN'-GQ'X2T_6/#L/BGPG.]N;*/>8(V,;#RQAMH/,UT'Q7XN\.NQUO0K6VFEU!'7S5 5$9"PZ>8P:1&[L8@QYS3 M_AWX;U/7OA/XGB$JC4;V5H_L@E)P(U1=CMW,B*,MW# ^]3)*'OIVU7S3[H<' M*I[EKW3^379D7B_Q4?$?PAM=5>UBOM5BO6AMIT&U)'C#,[@?W7C1P4[EBM3> M/_"T]O\ #WPA=).FH6>CPQ222\O&&VH8YB!G* KM/7"2$]JQ['XB>'$^'5SX M8OK>[AN-,#BS>W@VE'3YX23C"2JWRMGC()Y!K M+7Q!J7@ZQT^#Q )H-3F$$ M>DJ!L0%PP"@#*J#V' QTIM\E[:T>"_BQH7C.:VM M(&FM=0FC+"WN8F7+!7@9*-*;?\\_\ TMGW M=145K*\]M%(\9A=T#&-NJDCH?I4E>0>H+5)]:T^.Z-L]_;+<@X,+3*'SZ8SF MKE?'/P\^!O@+XP?M$?M MXS\+:?XADM=6L8X)+M"7B5K7+!6!!&<#IZ5I&*= MV^A+;6Q]CT5\3R?$#5OV0O$GQ6\':1/-K_AO1_#17SQX)^.OQ+^)/Q#\5:%HO@ MK1CX>\.^))-)OM:O-0:/-NFW(CB 9GFP2! M_ >CQ7'B+Q;<:(FB174D, 8S3#>LCEBK,R DG(&3QVI^RD',C[*HKYQTC]H7 MQIX ^(.K^&/BYIGAVT2+P]/XEL]0\+RSR1^1"V)8I!, 2X[$8!].>.3\1?M( M?&O0/A5#\4[CPKX,M?!]\UM):Z5-=73:G#!/*B1/(P'ELQ#@E1MQGJ<8I*E) MASH^NJ*B$I-N),#)3=C\*^-X?VM_B]+\(Y?BM_PAGA5?!.FWKV][;&^G_M"[ MC6Y,)D@&-D>.!AR22"< 8J8P<]AN21]FT5\[Z#\;_B3HWQ;\&:!X\\.>'=/T M+QK'L8P#Z]^6^+?[27Q,^"[:IK&OW'PM.D MV-P6_P"$;CUB9-]4J(=*35I=*;4[-=3 MBM_M-V,9[U=AFCN8DEBD66)QE70@AAZ@BOD[QEK%I< M?M(>.]5DLH]0L7^$371L[DD)-']H9]CX.<$<'![U8\'_ !Q\1WWACX7>!?A7 MX6T"T\0:GX9AURX35)IQIFD6?"JH"$R.68E5&>V2:?LW;0.8^K**^6E_:<\> M>'O"WQL?Q-H7AX>(/AY;6TJ+I4T[VMVTL1?)+X8#&..HY&3UJS%\?_BMX7U? MX?ZMXU\+>&+#P9XQO[?3(H-,O9YM1L99T+1/*Q B921RJ],]32]E(.='TY17 MS%\:_CI\3_A->Z_J4M[\+++0M/+SV>CZOJ\T.KZA;J,_)R$61@#M7#-/#LFMQR:W=O EE@(E7%P+:>SGPZ26VX M;Q)D $.<8SSVKZB^"TOCV;PG"WCJ'P]%.8H?L1\/S7$@:+RQS*9E4A\X^[D4 M2IN*NP4KNQZ#17R%XLU#XJK^W#?VWA5?"\I'A%'MX-8NKM(3;?:>7<1H?WV_ M(X&-N.<\5U_AWX[?%'QM\4O%_A3P_P""M$N+#PSK,-C>ZS>:B\,:PM&CN$C M+/+\S$<*H &L?&OXI>)_C+XQ\!?#[P]X7=-#M;*[&L>(;J M=(T$\9?8T<0+.Q/ QM .2>!1[*6XPKY M5E_;%UM_A'X=U,:'I&G>--4\2R^$YUU*[=-*LKN)F#RO(!N\O"@@=?FQGCG# M_:GUWXS1?LS^-4\1V_@T6LIM(SJ6@W5T$N+660+(BHX+*V[RP,_A9=>'?AKX3\"?#S3/B!KT#ZB[Z0)H-*M=/A546:XQ&LLDA8E0!^?6IO$O M[5_C'X=>$OB58^+/#FCI\0/!UI:ZA&FG32OIVI6L\JQK+'NQ(N"2"I/7'-'L MFW[H^==3ZJHKYA\#=.\0ZG\/]#M7UK6M/TS2=(.JF2X=)]^[S MI D;Y"8P6 W'.<5$GQL^.EI\3I?AK>>%/!,WBJ^TT:QI^HV]__$'X8>,&@T;P]:?$7PQK$NBW M<-S=2II+21LA:8/@R"/8Q;!YXKD/#/[2?CB_^($_P^U&]^''B+7=3T>[O-+O MO">IS2VUO/"N3%=H2SH""2&7T/'H>SEKY!S(^J)YXK6%I9I$AB099Y&"J![D MTY'61%=&#*PR&!R"/6O@GX2>)/'5C^Q!K6J^*M'\*^)/ MOH]_-':W%U=M>W M4BW+?),,!0F0WW7S@+[U[0/C)XTU_P 0Z3\/_A3H/AV*]TSP_9:EJE[X@EG% ME8I-&/)MHTB^=F*C.2< #O5.DTVA*=SZ0HKY5US]KWQ-H/PLUZ^N/"=BOQ \ M.>)+3PYJFC+=,;65YG4)+#(<$*ZME=W3OFNH\.?&/XF>'?C+X8\'?$C0?#-I M9^++>YETN;P[=3RR6LL"AVAN#*H#G:?O( ,U/LY#YD?05%)7D'QM^,6O>#_$ MWA3P1X)T>RUGQOXE,SVPU29XK.SMX@#+/,4!8@9 "KR3W]82\+N- MK.Y.L>(;J=(D$T9;8T<0+.Q(P,;0 M#DG@4O92#G1]$T5\MZ=^UWK^M_#CPXFG^%[*7XGZWKUUX9CTF2Y9;&*ZMB?/ MG:3&[R54!L#YN<9[UI:9\?O'W@3XH77A7XI6/A:*RM?#%UXEDU/PU)ZN%OK]]@ZAO$+P31SH&*EHV# $=1 MQWJ'29KNXTJSEU"W2TOGA1KBWC?>L4A4;E#=P#D9[XKY#\/?'RY^&WP136?! MO@72(KK4/B#<: -(AN)(XIW>X=#+O9CMD/?*F M47'<:=Q:*2BI&<[\2?\ DG7BG_L%77_HEJX;]DK_ )-O\ ?]@U?_ $)J[CXD M_P#).O%/_8*NO_1+5P_[)7_)M_@#_L&K_P"A-7IQ_P!PE_C7_I,CS9?[]'_ M_P XGKE%)17F'I"T4E% "T4E% "T4E% "T4E% "T4E% "T4E% "T4E*[G1@QU:'2KJ2TVOM6\7Z3X?UC4YKJZ;Q!J&LK&T M]L=YV[I7^:(;,,"".23G-:OPDDT[3O\ @H[\0%M9HH]-3PI:I;N9/E,8CM=F M&)YXQ72Z44Y)7T,E-Z/N?5'C+XY_#SX=ZPND^*/&NA^']2:-9A:ZC?1PR%"2 M V&(X.#S[5I3?%#P?!X.D\6MXHT@^%T +:RE[&]H 2%'[T$KU('7J:^.?B9H M'AOQE_P4H\/67B73M+UK0Y/";.\&J0QSVS$+,02'!7(/0]J^?O$\=AHFC_M7 M:#X&E\SX96RV4ELEM(9+6*Z-U$"L1R1C_6CCL@]!51HQE;7M^+$ZC5S]/)OC M+X%M_"VG>)9/%VC)X?U&86UGJ9O4^SSRDD!$?."V588]C6IXL\>^&_ <-E+X MCURPT2.]G6UMFO[A8A-*>B)N/+'T%?D+\0K/7_@QX;\)?#*]\Z\\*Z]J&D>+ MM"NW.1$7CQ<1?]]N/^^0?XJ^I/\ @HO\+_#NG^(_AMX[AM)%\2W_ (DLK">Z M-Q(R&%1D*(RVQ>0.0 30Z$5)*^]Q>T=F[;'V9X]^*'A'X6Z;%?\ B[Q'IOAV MTE;9%)J%PL7FMW" G+'Z U:\&>._#OQ%T1-8\+ZW8:_ICL4%UI\ZS(&'525/ M!'H>:^,OVW-+N?%7[3OP=TKPDMC?^/X+>XN8--\0PJ^D20##M?MO$VS68[J[AM],AFSYNI7/[UCZC\;?'_X;_#?64TCQ1XWT/0]48*WV.\O4250WW2RY MRH/J<"NWL+^VU2R@O+*XBN[2=!)#<0.'CD0C(96'!!'<5\B_MNWOPX@T?4O# MMGX1TCQ;\7O&MNEGI\26TZJ6*CV%1*"4%+J4F^9H]+HI**Q+%HI** M %HI** %HI** %HI** %HI** %HI** %HI** %HI** %HI** %HI** .:\6) MNG@_W#_.L+R_:NB\2KON(._RG^=9'E5WTG[B.*HO>9E7^DV^I6\L%Q DLV2<5[SY M5'E>U=$:DH;&$J<9[H^1]"UK2?!>LZ3X@@O+K4[J$,=0MY2SLN5*D\]&R0,G MUQWKK/"&I)XN^*Z7NNZ:]G%>B2:S@N<2([K$BQJ>,?*JSL/>0XYKW;Q-X6LO M%6B7FF7L9\BZ4!V3A@0!SFN]8Q2YF]&[+Y'"\(_=BM4M?.YD7]A-\6?B)>:*=9NK70K! MI";?3Y0BLL7E 9&"#ND=SD@X$8P.2:77I]6U:YF^'GA"RM4TV,26]W<7TK%Y M$&PSG=@XRTH7.&))<\8S7)R:-JWA.QM]5\/:!J&DZIIT+&\N9X2(]AX.0>&' M? STSVIVC^+;GX::C!XC_M&/Q'-JB,+BV)"-O<[N"!Q\^,\=.U=ZE?X;-16B M\^_J<#IZ7E=.3U?EVOV.G\1^(+70/#A\"VD%[KFMW%R3>3V%JS1I*THFGP,Y M.-_;(&Y02*V-;,7AGX3Z=H^J7%O:ZS-);NMFTJ^8&-RLA &>0@SDC@;2:Y[X M>^+O^$.\6:CJGBRV&E0:K#++!.&+JA>>6=E/?GS HQU\L5)\+[?PY\2/B#KE M_J]M#?7"[[FVCOHOO[II!N 8?,%B2 ?PY/ M6B71)?F= B/;_ '1IE+1%%LI(B.#@7,90?B,?G7*VUU=:%-X(UT7,K_:+6+[ M27D)\SRY%@=F]2T<^X^\2UJV>EK\8_B)J$5YJ]VND:6\DD=G8W.Q%"2F*(87 MOF&20MU^9<$ 4WX9^#K'Q3XVGFU.66>/1852QTT2E8+<"YF0 (.H7[/'USEN M3GC%)PIPESO7=_-:?\.2U4G./*NR3]-?N-/XGI+X5\=Z'KD$K10.$::-&P&, M4BHV1[Q7$I^L:T?$42^$OB+HFLV\CI!<",S1 X5MLBQ/QTY2YS]8EJIX3T&+ MXA_%?5+SQ!=7%ZVF!S:V)E*PQ[;R:,#:.H7[-&>>I.3GC"^!]!B^(7Q,U74_ M$%U/?2Z;DVMDTI6&+%U.@&P<$+Y"'GJ1DYXQ%XQ2YG?ECKYWV^XI\\V^16YG MIY6W+7Q/67PGX\T/7+:1D68*985.%8QR!&R.^8KB0_6-:F^-UA84@3%U/& M!M'4#[-&2.[')S\N%U;14^(GQGDTK7+NXDTVP-P8=-CF,<9"Q6V-P7!.[[1) MD^G'3.9BXQG%-ZQ6OGV+:'+J.:Z@AD\K[KR!3^6:_(<\@XYY%MZ>R_5Z'Z=E$E+ M*)65FJC_ "6IXE\0+B6/7HTA$@>60J)89-CQ$?,&!^J@$>A-:_@6ZD\/ZPMN M_"Y#I[J?\G\JA\0VGVWQ=;Q@9#.QX^E=9X[\-?V3X?T76XQM:*0P2>Z-T/X' MC_@5? 0EB,10]E!>[1O)+SK:/RLOU.W^(.GC6O#T5XHR M2F"?>O$M!\Y_$D%M)RMM&(D'JN]F_FV/P%>FVWQ&TNV\-/8W FN[DCY8X%!V MG_:)( _,GVKS:/4TLO$L&H26TD=NS;'VD,0">./KC\ZZ\:U7J1E2DOWB7,K] MFGK]QRX3]Q"4:L7^[;L[=U;0]P\3O]F\$VZ],@FO%KO0&O\ P-=:G%++;S0Z MJD/F1,5.R8) QX]/-5Q[H*[WQ3\1M'U;08;6!YHI$3!$T149^O(_6O+-%L7\ M8^(M%\/W^H7-KHTMXLQM[:7RO-;;=.&)').ZU0#^[@D^_5::'QV?2=+)G3:]Z<]MGUU.Y\9>;XQ^%&C>('9[6] A:=X6VE1)^YEQC MTWEA[J*B\7>?XJ^%OA[6S*]MJ&^&&>6)L$&4_9Y"#_LNP.? M#_@PW4^E>&K?[(L=G:2&,."MPXR>I(-NBCTR3UP0WQIX>AU;Q_X?\&-=7&F> M&[4VHBL[64QA_P!W<2 EOO$[H% .>,$]3FOUR#BN5^LO^W>WJ?F=12;G9=H_ M]O=_0O\ C/?XL^$^A:^9&MKL+;M.\3%2!*!#* 1Z>86'NHJKXSMI?&7PR\-Z M\\AM[^-HH)G0XPTKK$Q'^[,(Y!_N>],\?Z)'J?COPYX+%U/IGAV%;0)9VDOE M[AMN6!+#DX-O&!Z9)ZX(C\?^'M.O/B'X:\)7%=>L=EO'XAACE; M3U; S))&D\8'<;Y1*OH5E[-6OXL\FX^.&E6V@I)+JH\J>^:%<1P[&0,S-TR8 M'=6'?,7M5>ZFT+P'\=4GU9+>T@CB,-E(ZY6WA:"+RM@_A4-#.AQT,@/\1JKJ M'C%?#7Q?U&_T*W;Q#9.IFN#:N,!)8HRP#="0T*,/:1AQ5\R;3AOR_?Y?(F,9 M*/++1?&YI($CLM/T=5,DA.9KEH99$&!_"-[2+Z[0?[PP>% MK8^(_C;JE[K5Q*]S9+*FGV9.V*+RI2IR.Y"21OS_ ,]<_P (QQ]CXDU36_&^ MN>)?#$\.C01%W,%Z S2%DC$H(]"T:G Z$$@\FLCCQ9K6H:WXCBO;?5[L+)8I M:1. ^ %4QXY8<#D9-2]%RMVO&R?8J,4WS;M2OZG5:#XLM?A7XY\0:/?6(+OPYXBDT;2;8A;:)L9E1A: M+\)?#FE6.GQ2Z9;7US:)M^U3P@N[9+$G\23[5R3QD%[RU;5GVT.J&$E\.R3N MOF>0^"_A;XDU/PRD$R64-CJN+B2\DR9E5N3\N.O.>N.:]DT3X?Z%X=E26PTJ MWMYU4+YRH-V/KVSWQ75>5QC'%'EUY]2O.K\1Z$*,:?PE/RSM.1SZUV/AP8TF M+ZM_.N:\OVKI]"XTV,=.6_G7#6=XH[*7Q,T:*3-&:XSK%HI,T9H 6BDS1F@! M:*3-&: %KY8;X!^+9=&U_3Q83FZ/BN;Q+:FZUMGTR\C75!>QV[6^3Y9D10A; M8=I)SD9S]39HS0!XM'IOC>3XPZ;XTE\%Q06B:-I]/>O O%G[0?QK^$FK7 M5]XO^'UG?^%DG9?M.F.3LCS\K;U9L<8^^H].">.:EB*=:ZTK^V;A;V\MCX?CT M^YMGLDB:0PL;H)*)6F2-=BA K-*/F4#GI?$/QR/B[X#W/C3X=L]Y>>=;Q"#[ M.99K15I5*%25*K&TEHT^C+UQ^UEXJL=,M[NX^$>H M^9/;-=):07[/,5, ECC"&W!,I.Y"N-J$ E^>+VC?M.>+]4TF*_?X2:A$LMS% M9+##J8GW5+<71C$,&ZT5I7V,K+OVE@N3CK716/[0?C?XA?#BZU?PGX5AM]>L_$ MMII3Z>[2S++$T,$\P8R1Q&)@)C&6(VJR[LD4&1E:)^U'XU\WO@ M_P"V:O:1W$]W,)Y7-O( MGJ5)&1^%>%?#0_\ &8/QE_[!NC_^B37OV:]/,/XL/\$/_2$>;@/X<_\ '/\ M]+8M%)FC->8>D+7RIHUE\6?A+\:_BWK&B_":?QCI/BC4+6ZLKV/Q!8V2!8X MAW+(Y<(?&,VFV_Q"\9Z M.-*L--L92]II=M'\\4'FD#>S. 7;&,].*RM=T[XP_%FW^$VF7GPIE\-67A37 M].O-4O+S6;5V<0J4=X8U;YHQR2/L/-8'B3QYH/A#4]!T[5]06SO- M=N_L.G1&-V^T3;2VP%00ORJ3EL#CK6BJR[$N"/./V>?A[X@\#:Q\5Y]++K4]/;SHY/.MG1 K_(QVY*GAL'VKQWPK^S]X^TWX6_!_2+G0?+U'0/'K MZUJ4/VRW/D69FG82[A)AN'4[5);GIUKZI\+>/=!\:76MVVBZ@M]-HM\^FZ@B MQNGD7"@%D.X#. 1RN1SUK?S2]I),?*FCYX^,_P #M8^)WQOM[Q[;R?"ESX)U M/0KK5!-'^XGG==@\LMO/ )R!CCDBO"?C=-\8-#_9GTSP+XF\,^'(-)LKC3-, MB\0VFM&>35@MQ$L(M[81@JQ"@G6]NO%?3WA#QWH7CR#4YM!U!=0CTV_FTR[98W3RKF(@21_,!G&1R,CT)K> MS6<9.!329X9\4?AIXF\2?$SX)ZKIEENLO#LEZ=3NO.C7[)YEH(T;:6!?Y^/D M!]^*^:)/@-\0[?X)>*_AY#\#;'4_&]X;DW/CRZU*RS?[YBZRI(Y\TN5P C%0 M.Y'2OOGQ%XCTOPEHEYK&M7]OI>EV:>9<7EU($CB7U9CP!1:>)=(OY[.&WU.S MFGO+87EO"DZEYH#C$BKG)7D?,!CFKC4E%:(EQ3/G;6?@YXPN_B+XFU2+2-]C M>?"W_A'()?M,(WZAN)\G&_(X/WR-O^U7,^%_A#\3?A%=?#7Q=X9T#3->\0VG M@Z'PWKWA:^U6.TDQ&P=98IP'0[6)!ZCIC.>/L#-<#\4/@1X%^,TFG2^,-"&K M3:=O%I,MU/;R1!\;@&B=#@[1QGM0JO1[ X]CY/T/PQXX^+.E_M76,FDZ?)XK MU=;&Q2PTJ\#VZW"VW, GEV*64%0Q.T;L]L5[E\8?A?XG\4^"/@]I^EZ9]JN] M \0:1?:E']HB3R(84(E;+, VT]ER3V!KUGP!\.?#/PM\.QZ%X4T>VT32D18 M>&_!$VCZI+]IA;[/=LL0$> Y+_=;YE!7CK7TWFC-)U6^@*"1\H?$K]G_ ,9> M,]2_:.6UT^.*'Q=IVFQZ)/+V= M;X0?#?Q5H/BGXW7VH69T0>*-66ZTFY,\,OP%^(+_ #O_AS9? >Q7QB'4W_C2XU*RW:@PN YFBD8^8SN!T)M1T_P"SZ'K&GZ3!8W7GQMYSPPLLHVJQ9=I( M&6 SVS7MF:"0!G-5*JY)K^OZT)4$CY)T'X:^+O!7PM\1:/KOPDMOB)IVK>,= M3U&ZT2:^M/-%G*^Z&XBWL4+9_A)5QGL:X-/V:?&MY\*_BW8^%O!-YX.T+Q"^ MG'0_!%[JT4TD4D4RM<3Y:4QQ;@/N;\_+]!7V3X5^*?A/QKHMAJVCZ[:W%A?W M,EG:2RDP&>9&97C19 K,P*MP!V]*ZG-5[64>@,=#\53Z MI!H^JVFI3:7='\MRUR'";-V\_*,YVX]Z]DS1FH4VE8?*CXO\C4_B OB&/16OXHQK>FKLW0EPY";]OW7P?EY'2M?P3\-?%.O?'OP'X MIMO@[9_"[P?I.F:E9RI%OM"AM_%_BWQII>N3:%# M>PM_9]E;2(%5I2P1W"!F.TG.<#)XKVOXJ> ->\0_'SX0>)=/L?/T3P^^I-J5 MT9HT^SB6W"1_*S!FRPQ\H..^*]ES39HDN(GBD :-U*LI[@]12=1O^OD'*CRK M]GGXK:[\9-%\1>(=0T^SL-!76+FRT-K"]%7Q3>Z!!=:=J&@BY2WFN;2< EH7D:/90:;IEG&(K>TMT"QQKZ "M#-+FM*Z0[75F?,/Q,LOB5\>?#_AAW M^&UUX632?&&EZBEO?ZI:O<26L3.9YG57VH%RH"!BQY(%=#\;/A7XM\:?&SP= MK>@1FUL;+P_K5A+JPG1?L=Q<0A8#M+;S\W.5!QCG%>^YHS3]HUL@Y3\]G^!7 MCV]^"6F^ =,^ =CH_B.PNK-]4\53:E8^9?-'<*\DL3Y\R0N 6.]EP,@9.!7U M)\/?A]K^A_M*?%7Q5>V'D:#K=GI<6GW?G1MYS0QLL@V!BRX)'W@,]LUZ3XU\ MOB)X;TO3O$V MF:?I\/C+0/'FK:UI^D:E?1I%JEE=?*4$J%@CL@R,\C!R!5:ZT7QA\;_VFM9T M/QKHVF^$[F]^'5Y8&QTS4#J#V4\_M':Y\&6\/VN MA?%[5M(M[":5;JWLKZ]>&8NN0)$$;"3C)&X<'?$?B+3XTLSXCA.F+87:IA1GV]O>7A8GSYDC59),GD[F!//K7R MC:?L_>/HOA-H.C-H.-2M?B@?$4T'VRW^6P^U/)YV[S,'Y2#L!W?[.:^R M)/'N@^$-4T'3M7U!;.\UV[^PZ=$8W;[1-M+; 5!"_*">=&ODR2J@C&PL&;)!Y4$#OBO9:R/# MGB_1/&$-[-HFJ6NJQ65U)8W+VLH<0SIC?$V.C+D9'O6MFI;;LGT&D+129HS4 MC.=^)/\ R3KQ3_V"KK_T2U<-^R5_R;?X _[!J_\ H35W'Q)/_%NO%/\ V"KK M_P!$M7#_ +)1_P",;_ '_8-7_P!":O3C_N$O\:_])D>;+_?H_P"!_G$]>2CW)D^57/KFBOD#4_C;XD_9 M\3X/?#?PKH5S\0M4\5Z;)=1W.OZT5N3,5$F&F=2"H+GKT5<#-<2W_!1+Q];_ M ^O?%4_PKL5L/#^M#1O$%P-7&V.4M@)"F"Q/JQRN<=<\:*C-[$\Z6Y]ZT5\ MC?$W]LOQIH7Q/\4^$/!G@"Q\1#1O#T7B%KN[U/[.4@,22.60CYL!\!5.2<5B M^$/V]_%.O:S\*[O4OAQ;Z5X.\2W67'RF1496*YZ@$'WKY0F_;J MU6+X(_$GQW_PB=F;CPGXB&B167VM]EPOF*GF,VW*GYLX -7_ !Q^U[XYLOBC M#X'\'?#ZP\1ZE-X6A\1![C5/LPCW)N<'<,,%Z Y)(ZQG*IO$%]HOPI%[/*9IHK:QUF"WE)-*^%VH:K+''"\ZP:["-D:!$ 2/454850.!VJ_I?[?\ J?BSX=_#R3PY MX*AOOB#XQU"XTVWTF>],=I \+ /(TF,E3N4@<=^>.?-?VF?VF=<^)'[/'Q+\ M*^(-$_X1#Q[X1UC3X;Z'3KPRPRH\WRO'(,$ XZ'/!!SS@=,?;72;L8ODL=AK MG[ >N>)(M*CU+1OA?5+T2,V57DMGC'2L71?VH_%5[JO MB+X8^/? D6@[_!-QJ]A)9ZMYTLT"6Q.)'085F ;E>5(Z'K7#^#OVS%^#OP)^ M$VE^&_#-K;7'B87DL=SXFUF3[%9*EPZGS+@KN8D^N H(ZTOWKT'[B/5?&_[, M?Q)^(VB^&=)\10_"O4;'PUL_LE3IVL1O;;%55 =+X,PPJ\,2#@$Y-8GQ._8Q M\9_&/Q3)XC\867PQU?69(TB:X\C78!M084;(M051@=\9KC/C9^T1\9+KQ/\ M N[T>RTS3VUJ_E3['H7B-;BPUB02JHC:6/(\HKM.3G&]@>E>D:Y^UU\3+OQC MK'A#PG\-]+U+Q%X5TE-2\3K=:MMA@D*!F@MV"_.0#PQZG/'&2K559IH/<>YB M>(_V)_&'BGPGH/AV^LOA=_9^@JR:9)%9ZTMQ:JS%V G^W^8P+$G#,14UO^QA MXQMOAV_@=-.^%0\.27B:A-;K8:RLLUP@(62287XD8C)X+8YZ5=@_;XO/B#:? M#W2OAKX+76O&OBVWFN&L-3OO)MM.6)G23?(%RXS&Y&,< 'J<5Y[\;/'_ ,4_ M^&BO@3=:AX-AL_&B?VE$OAVTUE?LEZ5P$D\XC 0@[L,"1@CK37M=F[ ^3='5 M?$#]AOQ1\4O%%QXB\4:9\+]3UFX2..6Y\G7HMRH@11MCU%5&%4#@=J^B/V;_ M (4WWP7^&Z^%[R#0;6*"[EEM8?#RW8@2)PK'=]JFFD+[_,)._&"H &#GY[L_ M^"B<^F?"7Q!K/B3PA;V'C+2O$(\-C2H[_;:O.03O:8@[$4*^X\]!@\\3^%/V M_KR_TWXD6NHZ1X>U'7?"VB-KEK<^&]5:ZTZ^C!4-'YA4,K*77/![\#',2C6E M'E>PTX)W1]H45\1Z+^W7\2]1\1>!]-D^$EB6\<:8;K0(XM=0-/(!G=(Q7")P M3@C=C'4\5Q/Q,_:F7XQ?!32=1\6>#Y++6=(\>1:'=6.FZO)!&LH1CY@=5)8# MD%#P<9S6:H3OJ7[2/0_1*BOC3Q)^W1XBD^-OB'P+X9\.>&HUT*\%DR>)]>73 MKK47S@_9PX"?0$DG(/?%8?PM^,OQEOOVQ/B;H;Z=%JFA6$MN+K3+K6#Y.DVA M*_OH%QAW9/F*C')Q2]C*UWZASKH?<]%?#^B?MU_%#Q/\(M8^(>E?"&RF\.:, M\RWE^VM+M/ELH*I$!YG ;<6(QQCWKUCP)^U>?BC\:O#G@[PQH\%[H]WX;B\0 MZGJC3G=9^:N4A"@8+99 RFL_P KVK7UA-TD M7&>#5'RFKK@[11S3C>16\KVH\KVJSY34>4U7S>9'(RMY7M2>3[5:\IJ/*:E= M!R,J/;JZE2,J1@@]"*YF_P#A9X7O[&[M3HEG MTN))+>%8WZY!# 9!! /X5V M/E-1Y34U*VS!P;W/&=>_9SL-1TB2*/5[^YO(E'V1KYU>.(@YQA5&0>G.< \5 MS/B/X+>+]:TJ:5SI]E>6=L8K=-.D;=CEMCX7T+4?#VJ6UM*ES=7:-%&Y*MA02 &))&,9P M<'C%9&D>#-5BAME\-Z?K5EXQ!;[3FZW:>- Q^T7#QM&!G)8NY&,$YZGG-/T; MP?JL:6O_ CNG:S8^, Q^U7$L;Q(/[Q=CQ@G/7J3Q7U[Y)P.*/)/I3>/F[WM MJ)8.$6K-Z'R7X/\ "%_;:EI1TG3M8M/%JW2F\N)XG5 N[+F1CP01NZGGM56S M\&ZJDT_VK3M:;QZ;C<+Q(WVDY^_YG39TYSC%?7_DFD\GU%)X^;;E9:H2P4$D MKO34^/AX2N[.\N)=;T[5'\3FZ9[FZ,#NCQ8.Y@X&-O"\] !6A&+:2=XHXD** MH)8#(^F:^G/%.L1^&_#]]J,H#"&,E5/\3'A5_$D"N6\+?#/39O#JR:QIMM:6)2Z-)S@$CC&>G8YK\UXBP$\ZQ]*%&IR24=>UNGS;N?>Y)C895@ZC MJ0YDY:=[]?N5CPRRD^QZO!/9>7OB!W*R[H^?8$8/T-=?XH^(4OB+PX=,O;>. MV=8RJ20DF-VZ@X/*GOW^M8'B/2+KPEJK:5<(B/&0WFC&QH^@;VSCH>]6O#7A MN;QGJ<%G;1--;-(IN)T^Y'&#ELMZD# '7FOA<++'+&?V?"#Y4^5NW9WO>W1Z M^FA]EB(X-X58R4E=KF2OY;6_#U,F2VN+#3HQ)975NSP>8N^!P&!&=^<8/7K4 M7V74VN[6RETC422J.I2U=_-. 000.5]_SKZ&^*"_9?A[JZHH0&$1J .!E@,? MK71:9:>3IUJ@7 6) !] *^JH\,8)9A4@VW[M]]FVUIIY:'S%7/\ %_4JQ:K]D;3;^29XQMM1:OYC<]=I'3W/%99^'\VF7^H0ZSHNKG6 M01_9[6D;R(.XV.HQQD].A)KZ+@C(^,,XQ_S!%X_[;&NS\@GG%>[PM@J64NO. MBVWS2C=]D_U_0\GB'%SS148U$DK*6G=H^1)_!NJC4[UO%^GZS?>(75?L5Q!& M\H.!\H5E]/;HWA\5:=K=UXG95^Q7$<;2YP/EVNO''MT.:^P!"1V MI/(]J^^6/DK:+0^.^I1>MV?(,G@W5?[1O&\8:?K5_P"(F1/L4\$3R@@#Y0K* M,9'.<=ZLS^ =<_M.ZE\8Z)JVNZC/ @M+BVB:=5 485F4$ CG.>^3[U];>0?2 M@P$TOKT]-%IH-X*+OJ][GS)IGPD\6Z5?&^U#1T\0RWELD:F:X4O;87:$8L>P M Y&>]=-X:_9ZO-$M5DM]?;3;J[0_;HH81+'DD\1DD$8! YSTS[5[J(3GI1Y) MSFLWC*K23=K%K"4TWH>>6GP.\(6\%LDFEBYEB0*\TDC SG.=T@4@,2?4>W3B MNVALH[>)(HD6.)%"JBC 4#H *O>4U'E-7,Y-[LW4+;(JB' Z4OE>U6?*:CRF MI72'RLK>5[4>5[59\HT>4U/F%RE7RASQ6]HXQ8(!ZG^=9?E$5L::-MH@QBL: MCNC:FK,LT4M%_L]*B^NWS))?P* T >Y45X;Y?[1OB,\S?#KP3;OZ1WFL7"C\[= ?^^A1_ MPH#QSXA^;Q5\ - UVRUNYCUOQ)K5E*L]OJ'B/7KS498Y%.0P\V M4@$'VKTCQI2WCN?0MA5'L /UKN;BWBO+>2">)9H9%*/'(H964\$$'J*Y_P"& MEM]D^'WAU/6QB?\ [Z4-_6NEKER^'L\)2B][*_JU=_B=.,GS8FI)=W;T6QX! M^SQ\)U^#WQ-^)&E6E\SZ1=/;7=E9;2!$C;SU)Y*[@O'8#->_5P<(\CXV7&.! M<:.I/OMD_P#KUWM&#JRJQFIO6,I+Y7T_"QUYI7J8JO'$57>4HQN_2*7Z"$9! M!&0>QJII6CV&A6OV73;&VT^VW%_)M8EB3<>IPH R:N45WGCB44M% "5\K7'Q ML\?6'AGQEXA8Z@(;7Q1>:!9W=Y!8?V1:1#539QS.$<7),:'<=V%)4Y(!%>\^ M(/B1!8:H=(TBQGU_65^_;6I 2'_KHYX6N>\%>'?!VKZYX@AN_A[H>B>(I-[Z MCML+=VNTG)9V>0(#)O));=G.FWNB7VI/)+9PQ3))'+:H@)C & M,2R'H.",YQDV/@_XJ\0^(O%WC&WN-6'B3PK8&W@L=;^R) L]Y^]^UQ1%/EDB MCQ$N[DA_,4LQ4XZ#_A2'PYQ;C_A /"^+ 20#Y:C(R2>?6N\XSH:*6B@#P#X M:?\ )X/QE_[!NC_^B37OU> _#3_D\'XR_P#8-T?_ -$FO?Z]/,/XL/\ !#_T MA'FX#^'/_'/_ -+8E%+17F'I"5\S:)XI^*G[0'B[QM<>#?&MC\/_ IX;U67 M1+13HL>HSZA<1 >;)*9&&Q-QP F#COZ_35?-UE\,?BU\&?&'C"3X;0^%O$'A M?Q/J3ZNMIX@NI[6;3;J0#S<&-&$D1(!QPW;W.L+:]R)' ^)_VEM9N/B!K?@_ M5?BUHOPRE\+PV]G=WT.BB]EU6_:(/*Z)("L4*D@ ?>))Y%9-K\7K_P",[?L^ MZOJKVUQJ=CX^NM,GO+*-HX+PQ6\@6>-6Y574JV.Q)KU"T^%OQ?\ A=XUUOQ9 MX/;PKXCD\516UQK^C:C//9QQ:A'&$>:UD5'_ ';8Y5QG@)?$L^LV8M'=FCA=$4+ M)N50>5'N4NBL5. M,X.",XS4*TJGR_0IZ1,+7OVC/'W[/E[\1?#'C34K/Q[J^E:/:ZQH.JI8K8&Y M\^<6PBGBC.T!964Y7D@'\.@UOQ9\7O@+=^"_$'C7QGIOC3P_KNJ6VDZKID.C M1V1TV2XX1[>5&+2*K\$2A/#+_ /9:\4?&&U^(&N?$C4-,TOQ5XDTZWTS3 M;?0V>>WTF&"431DNX4R.90K-P!@8'7B[=_"GXP?%W4O!^E?$IO"FF>%_#FHP M:I\9%N C=@&@8 XY[C9M?@W\6?&WQ8A\<>,Y/"6FQ M1^&;_0X=*TB>XD:!Y]NUFD>/#C(.2 NT !N33O!W;%:6APUC\2OC'K_ .RI MJOQ1\2:QX8FTM_#$MS;Z-'I(F:>;(VS3L_R=C^[5-O(Y)%0:SH7CKQ1^U;X" MGT+QO:>&KN]\ _:;>0:#%';_3=7NI;>*1#L/FQ2+&QX93P5&10IQN[6ZCL^I0T']HG7/ ?A?XS M67CV[@U#Q)X#F::VGCMU@%]:S1AK-@B\99CL..]>U_"23Q-/\-/#D_C&=+CQ M//91SZ@T42Q*LKC<4"C@;/HZZAXOL;0[K M>6VMIEDME8G!(,^5&1DJ*^Q*RJ6LK=2HWN?'%S\0_C9XS@^,NL:%XXTCP]I/ M@35[Z&SLVT2.YFO4@C$GDRNQ 1-O&Y06)8\C J2/XP_%W2-$^%?Q,U?Q)H]Q MX:\8:G86%QX1L]*"):Q70.R1;IF,C2#&2" O. ,#GTWPE\"=?T'PK\;-,N+O M37G\;:GJ-[IS1RR%8DG@$:"8E 5((YVAN.A-9^N?L\>(]3^!WPE\&Q7NEKJG MA+4M)O+Z9Y9!#(EK_K!$?+W$G^'!O%WB5++ MX_:5HM]9H9['P=:>%EU-T"Q@B.YE0-(A#9_#WC M+4;O4?[?U=[C[=;>>N&B>)%Q(5Y"G=@9R?2N8^/_ ,+;[P'^R'\-/!\FH11? M$32+_3M.T2ZTMF6I[K^SU\1-?\ BNOC M+Q+>S1GPL^M36/AV%(54FU@/EM,6ZMOD#$9Z <5S'QK^(?Q*M/CWX-\!> KW M1K%-:T6]O)YM9MVECA:-T E 7#,0"<)D D\GBO8/AIX&LOAG\/\ P_X6T\ 6 MFDV<=JK?WRJ_,Q]V;)/N:Y'Q%\*M6U?]H[P?X_AN+)=&T?1;W3KB!W<7#23, MA0HH4J5&TY)8'V-8IQYF^AHT['A/C']HS6K#XAWOP_UCXMZ3X!G\,V-LNI:\ M-#6YGU:]E3>WE0ON2*)5*YZDDX!%8<_[8GBN^^&.@L_B+3=##^*KCP[JGQ"3 M2VFM(H(XP\5RMNWRJTH91\WR@AOP]G\4?"[XB> _B]X@\>_#+^P=7M_$T$": MQH.OSRVW[Z%=D<\,T:/@E3AE8?CZ7M4MOCQ=^%[2>?3_ (>ZIJ,EQ+]O\/S2 M7(M'M2J>6B3LC$R*P MFV6CZ;>V(TC19KB66,S!<,9'0!R2.1\NT 8W9.$^3>_<%S'RWX:#=^ M,?!WBB?Q!!!//,+*[2264^49/+#*VV0<[<9!^M?37@RX\07?AJRF\4V5AIVN MNI-S:Z9<-/!&=QP%=E4MQC/ YS2JR4MAP5MSY)\3_'CQGX7\'?%34/#@TBRU M>P^(\.@VCM81I&\,CQ*?.VC+L=QRYRV*[[2O%GQ2^&/QZ\$>&/&GB_3O&>C^ M,[>\VQ6NCI8?V;<01B3$;*S-(A!(^GS5ZI\1/A7JWB[XT?"_P 7V=Q91Z;X7>_: M]BG=Q-)Y\(C3RP%(.".=Q7CIFFY0V]?R!)E_]H/XLK\$/A%X@\8?9TNI[&)5 MMX)6(1YI'6./<1R%W,"<"XU^,&D_$8:_J,6F:GHECH2 MVAT\S A9[:0#++&^ 1)NR/2OJ#XX?"NV^-/POUSPA<7;Z>;^-3!>(NXV\R.' MC?'?#*N1W&:X7PM-^T3%=:7IFLZ?X %E:,BWNLP7MVTEY&N,^7#Y8$;L!R22 M!DX!X%3#EY==QRO<\Y;]H+XGV6N7GP:EMHI_B])J02QUS[$!8OI#$O\ VBR# MY> /#GCS3O"^D>'K'3IO[3FT2.\NVDEA);:A M*IAF!)+9QP% YJE?_LH^,]0:3XBMX@TV/XY+K U&WU!9ICIL5JN4&G9V;_(, M1.3LR6.<5C:9J'Q-LOVL?B]+X)T;PSJ=^VFZ,+^VU>_G@2-S V#$Z1G>H.[( M95)&,8Z5I[KORVV_'0G7J1Z3^TU\1=:TK2_AU%-IXUUK7=:QQ M6T8EDO!!D N49<)G;G/;BNIG^*7Q,^"7CR]\'>*=4M_B7)J/AR^UK0;Z#34L M;EKFU3<]K)%$2K C!!7![53A_9+\5Z+X8T7Q%INO:5/\7+#Q'<^*)[JYCD73 MKJ:X79-:\#>L6P*H;&?ES@9XZ'2OA3\5?%WQ"G^(OBN?PWH/B32M%N-+\-:5 MILDMW;6\TO+W%Q(RJ6S@#:H^[WS2;ATM;]?\@]XYC]G3XJ^*/BI-H.M)\[@ M;Q59VFHS17 MT$8:&>1(\IT.%4?6J]O\"OB!\0_BSX,\4^,_#G@;PG)X:O&O MKC5O#$LLMYJKE"HB):)"D1)R0[,?3O7.2?LZ_&S3/A'XI^#^BWG@Q?"%ZU[] MCUR^EN3=M!/(T@A:)4VJV6(+Y8 "?!W@[ M5-#T\ZUX)CUN\N]6M#*L$Q=0TJ(F"S0UC]IC5]2\9>(_#=_\ M&71_ATWA5TTIKC^P5NYM7O4C!GG97W+%#O)4(OS<'GI7M'A;X(:[HGQG\(>+ MI[O3GTW2/!:>')XHY)#,UR)$;>@* &/"GDD'_9K%F^&/Q1^$GQ#\8:W\-(O# M?B'P_P"*[P:G=:/KUU-:2V=X5"N\4B(X9&P"5(!!Z5*<-AM,[/\ 9B^+5[\: M?@_I?B/4XH$U/SI[.Z>U4K#-)%(4\V,-R%< , >F:X:\\6?$OXT_%CQQX>\# M^+[/P!X?\&RPV$MXVD1ZA<:A>/'YC B0A4C4$#CYB>_I[9\/U\6#PQ;GQLVD MGQ"SNTRZ&)/LL:ECL53)\S87 )(&3G@5X[K'PR^)OPU^*7B[Q3\,8_#>M:9X MN:&XO]+\0W,ULUI>1IY?G1O&C;D90"RG!R.#4*W,[?(IWLCP7XL>/_&WQE\! M?#^"_P!8L=#U_1/B/%X;U6.#3A<6T][&Y\J[57[/EW]D#0 M['QUK?Q-^)6MVL6H^*;WQ1>Z7'/_ !3K M?PK;P_KGAKQ/=G4KWPYX@N);5K2\88>6WEC1QM?J58?2I-9^$OQ9^(\O@K4O M&6I>%HKS1/%]GKIT_2C.(;:SBC96B21D+2REFSE@J^A%7="[3PL+]411E8+F>/Y7\5 M?M/^)O!@^-SF*VU2Y\/ZYI^B>';-XPB":ZC0*)67!8!V+'O@8XKF_B%X1^)7 MASXM_ 2?QW\0+3Q@ESXHRMG;Z''8BSF^S2$A)$/Q5KV@Q>)O%6K66N:;>:0DWV>UN;95**Z.N0H90N06)'/!^6MBY^&/Q MN^)GCSX:ZYXU'@G2-.\):O\ ;YK72;BZEGNOW3(TBLT>T=1B/CJ26X IIQ6U MOZ0M7O\ UJ<3?_';QSHOPXU>\\,G1;#6IOBO+X9A,FGHEN\!<*/-5 "S'C<_ MWCCK7HOA3Q9\2_AW^T+X=\#^-?%UCXVTOQ3I=W>V\T&D)I[6$\&TLB[&;?&5 M;JQ+=/QQYOV6?%7_ *K/G8'W<;?]JO4O M%_PKU;Q!^T%\/_'5O<62:1X?L-0M;J&5W$[M.JA"BA2I VG.6'MFI*?\ L%77_HEJX;]DK_DV_P ?]@U?_0FKTX_[A+_ !K_ -)D>;+_ 'Z/ M^!_G$];HI:*\P](2BEHH 2BEHH 2BEHH 2OD_P#;T\(ZQ\4- T?P?:S^+K?1 M9\W5ZGASPB-:CG97'E!Y/.C:)E()P"=P;GI7UC15PER2YD3) 89X&8?#S[/_ &@CY"#"7.(MB[5Z-NQD\FN5OOA5'>_" M3X@>"/["^*2?\)7XD'B#[=_P@#G[+APWD^7]J^?IC=N7Z5^DE%;>W:Z$>S/@ MLZ7&?BEXO\8_\(G\4O\ BH/"8\+_ &+_ (09_P!Q^Y2+S]_VCYON9V;1UQN[ MUSNF?#V/3O"'P;T/_A'?BE)_PKO5I=4\_P#X0)Q_:&^82;-OVK]UC&,Y?UQ7 MZ+44>V?8.0_+KQ%\$-9U:S\=Z!ILGQ9T?P7XHU3^UWT<_#M;@K/OW?/(9U8@ M=!M*YP">G/KNF1QZ;\;H/B%_PA_Q2D\KPHGAC^SO^$(<9VH%\_S/M'MG9M_X M%7W110Z[>Z!4['YG:5\'#X9\!>#[+0])^*UCXT\)ZM03)'+.YBD4/MRI.< Y%?I11259KH/V9^:%S\'UT;X*_#;?% M+0?$WB32DTSQ1'?BWX3\8^$8);>/6;CP3]KCOEE9FD$L)E &6D?&"J M_$GX<>.O%]E\4_$FN^$YKN:;_BWWD)=B;@1IMN,1*@X'RMGVK[ \;_&OPOX( MU[2M!GU2RN?$&H7UK9)I,=W&+I1.X59#&3NVC.>G(!Q5YOC#X$C?4D?QEH49 MTT@7F_48E%N2^SYR6^7YR%Y_BXZ\4>UD^@%_%NC^*[+Q_?QZ MUHTND0?V7\+(;%8"[*3._ES*96^7&TD#D\U]P3?&7P';^'8-?D\9:$FB3S-; MQ:@VH1"&25<[D#;L%A@DCL!D\58U+XK^"M'U*TT^^\6Z):7UW"+B"WFU")7E MB()5U!;E2 2#T.#BCVLNP?_P *_<[,!A]G MV_:^?O??R.GW:^^;;XV_#V[TB35(O''AXZ;'-Y#W;:G"L2R;"^TL6P#M!;'< M GI4>J_&OP;8R7UK:>(M(U35;-4:73;?5+99E5G12.H[D BJR7 M0.1=SX/^+OP[UOXU>,+BX\1:5\0I_#LM_P#;$1?A?"-5@BW$BV2^\WS-@!P" M<\8X.*ZJ*UUWPU^T!J?Q"\(:-\4-&TK7([:WUG1KKP']J>XAB"J428S KN"? M>QD9/6OM6U^*_@J^UJZT>W\6Z)/JMJDKW%G'J$32PK&<2%U#979@[L].]54^ M-OP^DT1M97QOX?.E+/\ 9C>?VE#Y0EVEO+W;L;BH+ =2.1Q1[65K6#D6]SY7 M^!6H6'P/^".M> -0^'_Q1\56-_+>3SS'P6]L&290&CV><_0 \Y[]*YO_ ()P M>';SX4-K%OKOP_\ &]AK7B*\$,.H7VB2QVMI9Q*QC625\;#O#'B'Q+=VF MC6NO7,=K XOH9H$9PQ#><&",F%R64GJ*PY9=C2Z/1**\[\#?'KP=XYGOK2'7 M--M-4M)[N.33Y;Z(S^5;RLC3;0\<6LUSX>UNPUN"%_ M+EDL+A9@C8R =I.,@@CU!S0XM;H+IFU12T5(Q**6B@!**6B@!**6B@!**6B@ M!**6B@"CJ"AG7V%5?+]JT;E-Q'&:C\D>GZ5:9+5V4O+]J/+]JN^4/3]*/)'I M^E.XN4I>7[4>7[5=\H?Y%'DCT_2BX2/3]*+ARE+R_:CR_:KOE#_(H\D>GZ47#E*7E^U'E^U7?*'^1 M1Y(]/THN'*4O+]J0Q\]*O>4/\BHI_+@1Y)'6.-!N9F. !ZDTI245=ARW/.O' M,7]N^+?#OAT#,'F'4+E?5(_N@^Q)Q71>+O$EKX1TB2\G!=R=D$"_>FD/W56O M*-1^.7A*P^,5Y]EU*#5KH6"V"06LBEO.+[MG. <\@>&/"FHZYK*>)/$V MT7:?\>.G*=R6B^ONY]?_ *V/CZ>(JRKXB.'5ZLY6O;2,4E9WV?6R6[/JL1@G MAZ5&6,CRP4;V>CDWO;\+OL/\">$[BPMKG5=859=;U)O,N"P!$2_PQCV'^>E= M8ENJ !551Z*,5H>4*/)'I^E?383#T\'25*FM%][?5M]V?/5ZLL14E4F]^BV] M/D>>?&$%/ =X,?>EA7\Y5%=E!%MAC&!PHZ5R_P 9X]O@.Y..!<6Y/_?U*[6* M,/&A X*@UPTW_P *-9_W(?G(Z:J_V*DE_-+\HGG\,8_X7-<#_J!K_P"CS7;" M/@<5QU@AG^,^J,!_J=)B0^V9"<5WPA X_2C+'I6?>I/\PQRUI+^Y'\BGY?M M1Y?M5WRAZ?I1Y(]/TKV;GF\I2\OVH\OVJ[Y0]/TH,(]/THN'*4O+]J/+]JN" M,'H,_05'7[5P7B;]I#X5>$)7AU3Q_H M$5RA :UAO4GF!/0>7&6;)^E<^_[4.C:J=GA?P9XY\7/NV*^G^'9[>$GU\VY$ M2$>X)HN'*>N^7[4>7[5Y"GQ ^,VO'&D?".PT.%C@3^*/$D2,%['RK:.8_@6% M*/!7QT\0D-J7Q"\,^%8SG=!X?\/O=28[ 2W$Q /OY9^E%PY3UWR_:J&LZYI7 MARS:\U;4;33+102T][.L,8^K,0!7F"_LRRZSM/BWXG>//%.1AX1JJZ9 WU2S M2+^=:.C_ +)7PBT2\6[C\ :3?7H 7[7JR-J$Y ]9+AG8_B:+ARF=J/[6?PCT M^YEMH?&EGK-Y'@M:Z##-J7X0^#_COQ)S\MQ=6D.D MP-[[KN6,X_X#GVKV'3M'M-)M4MK&U@LX$^[#;QB-%^@ %:$ Q&*4FV4E8\0 M_P"$F_:$\3\6/@GP9X)B;I)K6MS:E*H]?+@B1<^V\CWH_P"%2_&/Q ?^)_\ M&W^S(6^];>$_#=O:8'H);AIW_$8^E>YT5 SPS_AD#PEJOS>*O$/C7QLY^\-; M\2W7DMZYAA:.(_BIKKO"?[.OPO\ TB2Z%X \.Z?<)]VX33HFF'_ &T8%OUK MT6B@!D4,<"!(HUC0?PH,"GT44 %%%% !7,_$UBOP^\0D=?L4H_-2*Z:N2^+' M_)./$'_7JW\Q7#CW;"5G_=E^3.O!J^)IK^\OS-;PB@C\)Z*@R0ME !G_ *YK M6O6?X>_Y%_3/^O6+_P! %:%;T-*4/1?D8U?XDO5G!S?\EKMO^P,W_HT5WE<$ M/WGQL;OY>C_EF2N]KAP#O[9_WY?H=F,T]DO[B_4****]4\X*X'QAXEO]:U@^ M$_#O_ ,CH/\ (TOB!XMG\/VEM8:7&+G7]28PV4/8'^)V M_P!E1S5OP1X/@\&Z.+97-S>3-YUW=O\ ?GE/5C_05X^(G/%57A*3LE\;6Z7\ MJ\WU?1>;1Z=",@G[9\7_$TZ?ZNVL;:V)]6)+5W-S<):6\L\K!8XE+LQ[ #)-<1\(H9 M+O1M1UZ<$3:W>R78!'*Q9VQK^ 'ZTJT(1K8?#4U9)N7HDFOSDATIR=*M7F[M MI1^;:?Y)G=T445[)Y84444 > ?#3_D\'XR_]@W1__1)KW^O /AI_R>#\9?\ ML&Z/_P"B37O]>GF'\6'^"'_I"/-P'\.?^.?_ *6PHHHKS#T@K+UWQ/I'A@6) MU;4K;3A?7265K]ID">=.^=D:YZL<' %:E?*G[7GP^T ?!_P 8+:2_\)#+ MXUTVS:Y:ZF9/*PYVB(OY:_='(4$XZU<(J3LR9.RN?1'CKXC>&/AEHPU7Q7KM MCH.GEQ&LU[,$#N>BJ.K-[ $TG@3XC^%_B=HQU7PIKMCK^GJYB>:RF#B-QU5A MU5O8@&OG[]JBXU/0OCG\'?$'AO3XO&/B6Q>^2'P:S[);F!XQYEU'(PV1M& / MF? .0 Y\'WL317=HL4947$PP%9I2 M204+# '.36GLUR_&7[+XI\,WVB>*9M-+PP:E;+'+/9EQ\Z!B-\6X8 MR.,CUKH]L:?8WG]GLT\,U["C_9CC#.I8?*<9Y&.*^=OV9[2V\9 M?';XK?$KPW9K8>!M3%MI5A+%&(XM3FM\B:Z10 "N[Y0_\7/O4I)Q;[#;=['T M]1116184444 %%%% &=!X(4 M\.R6UPB*XD>1D2<8<@PL4;#9S\I&,@BNJM?C#X$O8M1E@\9:#+%ISK'>2+J, M.VW9FV*'.["Y;Y1GJ>.M>,:K^RUKEY'X4FM-6L+&]L]7N9M7*/)MN;)[N:XA MV'9GSHS)QD ?/(,]#4,G[.OC'Q!8>&;'58O#ME!X:L+/28/LUU+,-1BBO+:9 MY)%,*^7\EM\L?S_-(V6 Y._+![,SO+L>QR_'CX;0RI$_C[PR'>/SE']K0%+#6KB?3YKBVNA,\NXVZBW+(-@$<1'0M["4&W<&V>WP?%OP1 M=:I-IL/B[1);^&W-W);IJ$1=(0@AJI8?'/X=:I=V]K9^._ M#MW'YH]!L]/&IZCKD M>IK?2R7+S74,ZBW9/( "J]P5,NXY1%^0$X&UJ?[/^M7=MJJ0SZ5&]UIWA^SB M8NXVO83F28G$? (QMQU/4+1RP[BO(]-M/B[X'O[G5H+?Q?HDLVDH\M^BW\6; M5$.UVD^;Y54\$G@'@US*_M,?#P^)XM+/BK1ELIK-;F'56U*$6\LAE,9A4[N7 M&,D=@17DFJ_LV?$;Q1JZ:AK&HZ;=7UG'-MNKO7+RYCU"3[;;W,2FU:(16L16 M#8RQ[CSGY\5WOB+X5^+_ (@3^+=2U:QT'1KW6/"LV@6]K;W\MTL+;ZZO_$5SHVBKH9BUPTPEA<* MIV0 %"&^5N17LU%5&3B[H35]SYITKX(?$B*.'3M2?P[=176O:=K^HZPFH3BX MWP1PI+$D7V?#9,)96+KPV"!UK-T?]EWQ!;:3I&DW5GI\TNBO;1V^MW'B6_N1 M/ EY!,X6RDC,<)=("W7P=\7>'_ (BZEXRT2'0] M8FGU"_DCTS4+R6WC\FY@M4WEQ"^)%>V.5"D%7/S \5E>!_@E\0OA5X=UK0?# ML^@WC:Q90#^W;JZDBFTZXCM5A^2'R'$J!D5DRZXR--7^-GC. MTMY/&UWHFC:A:10Q: ^CI8Q(;:*5DF%SBX;+,Q/E@\' YJHR9O(M;R)F\V>)<$O<1LJ+A5 ;&"!G6E^# M_C;_ (0+6_ D=KH#:5-J$M_;:Y)?RBXEWWPN=LD @(5@"REA(V<+QR=L?AC] MIC6O%IT_3;'P_HH\4:G="WATF?5;B*2P_6'@NRDA\/::=1UI;C661X_+N;B":.W MR)2#;.RLQ0,",@&J?M M+ZH7ND7B_P#9HUWQ/X.AT9-0TRTF&L:WJ#S[I"#'>+<")<;!D_O4#C@8#8)P M,Z5G\&_%VO\ Q-TKQKKD&A:1+:WEFTFF6%Y+Y&%V@*J M#YB>*S/#?QY\0Z%>ZIZFT4MMY<4D\:R1^252$+$5 M+;RPSG:<%[1O$DU_:6=@'N;NVLIUGAGE$I>XM(Y0JK M;2'?$MMK/DP7&KZO-J$<<&J7&I-#&\, M*!7N+A5DD<&-CDCN,>@Y;1_VE[VZTGQ7-?\ AB"WO?#^D7NI30V^I-+'*]O= M3VYC5S"I 8P;MQ7(W8V\9.WX,^.%YXH^)MSX7N]+L-$1 Y@BO;V9+ZZ18U?S MH8F@$-=9\,Z-H%RV@6,'AO2I=+L; MV"[E=]1WSP/YDR^2/)PL&2H,F7;J ,GV3XN^$]9\3Z3H4V@QV=QJ6CZQ;:HE MK?7#01SK'N#)YBHY4D,2#M/(KO**AS;L5RI'S;XL_9G\0>+? T&BMJ&FZ?=- MJVMZA--#+*P5+U+@1J"$4L094#?=X!P3Q7H?P:^'^H>$;G6+_5M'@TW4KV.W MA>:/Q)>:RTZQ!\9:Y1?+4;SM5<\$YZ"O3Z*'-M6!12U"BBBLR@HHHH **** M"BBB@ HHHH **** (9Y"I':F>=[FH[]]K+]*K>:?:K2NB6R[YWN:/.]S5+S3 M[4>:?:GRL5R[YWN:/.]S5+S3[4>:?:CE87+OG>YH\[W-4O-/M1YI]J.5A:?:CE87+OG>YH\[W-4O-/M M1YI]J.5AS:YJWAOPV786VHW#RW*J<%XHU#%3[$D?E7:>:?:N& MU1_/^+^BJ?F\C3)Y!_LDL%S7C9K%NA&G_-*$?DY*_P"!Z>7NU9U/Y8R?W(X? MXX_LI>$/'GAG4KO1M(MM(\41Q&6VO+;]T))%'RK(!P0<8SC(ZUV_[/L^L/\ M"#PVNO70O-5B@,4TP;<6VL5&6/4X R>]=Q(V^-E8\$8XKB?@](5\%1+GA;FX M 'MYK5M*I*GBJ>'7PN+^]62^6IWSS#$8O+'1KRYN2<6F]6KIW5^W6WD>B^=[ MFCSOGRL^>N<+^T1J5WIGP=\1WMC9-J-S:P"=8!G^%@2W'8 $ M_A5+X*_'WPW\5/!VFW46IV=MK'DJMUIK3J)8I /FPI.2O<''2M7QCXTG6\'A M[0[=-0UFX3]X)/\ 4V\9XW2?GT_R?G+7OV68;+XAVY\/-I:>(98/MZM>QRK8 MQ/YF&S#$RL1C.%#*">N!7SL\=0AB7[*-Y.T7+[-^B;OYZV3M?4^UP.'P=7+I M4<7/]M^+?%>NQG=:S3):0R#D.(UP2/;)ZUZ M%Y^U22V .YKP+3?@U\2;FQBM-5^+DNC6:Q[/LG@W0[:Q53W*O/Y[_F:L#]E3 MPCJ)+>)-9\7^,MP >/7?$EW+"V/^F*.D0]\+S7HX#"RPM!4YN\M6_5N[_'\# MY3%5U7JN<59:)>B5CT?Q1\9O O@A2WB'QKX?T0 XQ?ZI# Q]@&8$GZ5P\O[7 M7@6[7Z9QG_6I'Y8^I;'O70>&?@=\.?!DGFZ'X%\ M.Z7-G)GM],A$K'U9]NX_B:[>/;"@1%5$' 51@"O0Y6VW/M1M_:"U_:);[P!X-A;)9;:"[U>=?3# M.8$_-37KOF'VH\P^U'*QW/(1\"O%^M@'Q-\:O&%[E%_!48C\/^'=*T1 , :?91PYJGYI]J/-/M1RL+ET2X[T>=[ MFJ7FGVH\T^U'*PN7?.]S1YWN:I>:?:CS3[4K]F MK?S%=;7)?% MC_DG'B#_ *]6_F*X,P_W.M_AE^3.S!?[S2_Q+\T;GA[_ ) &F?\ 7K%_Z *T M*H>'O^0!IG_7K%_Z *T*Z:/\*/HC"K_$EZLX/3<3_&?66Z^1I4"8]"SDUW=< M%X3)N/BOXYEZK"EE"#_VR)-='XU\0KX4\*:IJK8+6T#-&I_B?H@_%B*\_ -* ME4F_YY_A)K]#MQB;J0AUY8?C%/\ 4YCQK\9=,\+7LFGVL#ZIJ$?$BQL%BB/] MUFYY]@#COBN3B_:+N(GWW>APBW'+&&Z)8#Z%1S7D44KSJLSN97E'F/(QR69N M22>Y))IES;_:0JEL(#EAZU^7X[BW'JM-8>RBFTE:^Q]_A.&\&Z476;;:3>I[ MU\)=4M/&FN:KXENIT?6)/W4-D?O6=L"0N,]=QR21QVKU.OD#2=9N_#6HP:GI M[&.YM3N7G =>Z-Z@CC\CVKZCMO'/A^ZAAD76;%?-19%1[A P!'<9]Z^XX;S" M&,PCNK33][S;UO\ /\-CY//,#/"8G36+6GDET,+XLZA-+I%IX>LFQ?Z[.+,8 MZI$?]:_T"_SKL=.L8M+T^VL[=-D%O$L2*.RJ,#^5<'X,'_":>-=4\52#?86@ M.G:86Z$ _O)!]3QGTKT6O8P?[^I/%]):1_PKK\W=^ECS,7^YC##=8ZO_ !/I M\E9>MQ**6BO6/-$HI:* / /AI_R>#\9?^P;H_P#Z)->_5X#\-/\ D\'XR_\ M8-T?_P!$FO?Z]/,/XL/\$/\ TA'FX#^'/_'/_P!+8E%+17F'I"5\]?M'_#'X MK?$[Q)X6/A>'P'=8M=_\:^!_B?H/_".GQUHVG3:9JFB7%S,-/NX92&989_+WJRL M,@LG/?&.3P5\(?B##XD^(GQ%U>[T32OB%XBTM-,TJRT]WFLM.2)6,1ED>,&1 MBY!8[, # !KZ!HJO:.UAO>&I]7R#XN$]S<6EM MJBC&(8WAAWK&QSN 5"1QGDUW'P-+ M$RX"*$EC5 FW/0YZ5ZW10YMKEL'+K<2BEHK,H2BEHH 2BEHH 2BEHH 2BEHH M 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH M 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH YOXD_\ ).O% M/_8*NO\ T2U*?^P5=?^B6KAOV2O\ MDV_P!_V#5_\ 0FKTX_[A+_&O_29'FR_WZ/\ @?YQ/6Z*6BO,/2$HI:R-6\3V M>C3+%.QWL,X [4M@-:BN7N/B+I=O$[L9,*I8\=@,FO.]/_:V\%ZEK7]F0K>? M:,DV45Y7JG[2'A/2K>>65KIC#U1(\L?UJAHG[5?@?78V$ M-Q,ER%+"V=0)&'L">:KS!0D]$CV.BOG"Z_;O^'VGZFMC>VVK64K2>4&GMMJY M^N:]ILOB%I5]9PW4;MY4J*ZDCJ",BIYDQRIR@KR1TU%_$;2=/MGFF9PB^ M@JM!\5-'GMO.'G!/0KS5+4BS9V-%>/:Y^U9X"T#5HM.N;Z4W,F?ECCW;?K70 M:'\=/"?B,,+"^$\B]8Q][\J;36X^5GH-%'CK3"/OM^5'_"C-1= =#16%8^,;"^N5@1B'8X&>];H. M0#ZTP"BN,^*'QA\*?!K2K74O%NI'3+*ZE,,4ODO("X4L1\H.. 3^%.Z_^UO\ #'PS MJ9L=1UN>"8)Y@;^SYVC*^H<)@_@:L^"OVJOAA\0+J:VT;Q1!+/$JL8[B-X"P M;IMW@;NG:I=6G'>2*5*;U2/6:X74/@KX7U'Q/?>(&&MVFI7\D\7!8?[*$FN*\6?M+?#KP1J<>GZOXAC MM[UQN\A(WD9!C/S!0=OXXI?6*<=>=?>)4IST4;DQ_9Z\&,CL\&K2WQDBDCU2 M77+U[Z QAUC$=RTIE10))!M5@#O;(.36*G[,/A<^*9;J1;H>'_[,MK!-&AO[ MF..4QS32NUQMEQ#-;TR;3K[1$N+*:^GU*2!IY=K7$T;QROP_\22.-OW1G@ @5RFO_ +.&A?\ M".7MIH$*_P!J74UK*]_XAOM0OY/W&\1;9?M22Q,HD<*R., D$$5TT'QM\'W$ MWE_3Y> M?PH]NH_:$J4I;1*_A_\ 94\(6OA&RTC6TN=2N$BNH;J>QO;JPCNH[B9II(72 M.;+Q!W.U9&RJ?RL^@**\8L?VPOA3J:73VGB1KF.V95D>*RG9>3@8(3D9/4<5 MV\OQ<\+0Z8-0?42+4E0&\E\\G XQGJ:<:D)?"R90E'XE8["BL[P]XAL/%6D6 M^J:7<"ZL9P3',HP& )!Z^X-:5:$"44M% "44M% "44M% "44M% "44M% &9J MTA22,<;53S:/-HY NRWYM'FU3\X9QF@S@'& M:.0+LN>;1YM4_.I?.'K2Y&%V6_-KBKA\_&"T/_4&?_T<*ZGSAZUQMS(/^%M6 MC=1_8[_^C17BYI%I4/\ KY#\SU, W>K_ ()?D=[)/MC8\< FN,^$;>7X+@S_ M !3SMS[R-70ZA<".PN7)P%B8Y_X#7-_"_P#<^ ]*)XW(S]?5B:=57S*BNT)_ MG%#INV J/O*/_I,CM_-KF_''BUO#FG1I:QBXU6\;R;.W_O.>,GV&)-0T778=6N"UX+?* M+%<.7*QG[VTD_*?3_P"O7RV/XGP_MW@:5U)OEY[:+HWW]#W\'P_B/9?6ZJ4H MI%U\,:>[3R?:=4N6\V\NVY:5SV^@["LGPK*=<\?>(M:'S0 M6H&E0OV.T[GQ_P "(_.K'BOQA#I?AB2]M)1-6/YDU[JP]/ZS1P=!>Y27,_7:-_-W;OY'D.M45"KBJ MOQ5/=7RU=O+H=/YM'FU3\^CSAZU]-R,\*[+GFT>;503 ]Z3S1ZTN1D\SO8N> M;1YM4_.'K1YU/D*NRYYM'FU4\WWH\VCD"[+?FT>;53S:/-HY NRWYM'FU4\V MCS:.0+LM^;1YM5/-H\VCD"[+8F^E:VG-NM5-<]YO!K=T ":\#\ M:_&/7/$NE7UH(+6QL)T*-"BF1]OH7)'/T45U_P"TK>M;:9H")\S&Z=RGJ F# M_P"A5XOYD5[$R!\!ARO1A^%?FG%.:8RC-X7"OW>7WK;ZW7R7F?>)I1Y*>^\#+#V"Y^E>(W/[BTPK;1\J;L]!D#-2QHL**BC:JC %?.8?B M7,<+AO?GS-Z*ZVL>[7R+ XBO[D>6V]NIT6F_%+Q#;:WK>H6L\-K+?S*TP6 , M"57 W9P />F^-_B;KOBS0+?2M1^SM";A)'FA0QLQ&<*PR0>2#QCI7-P0"V\ MPEOO,6)/:H=1MI[NUWJC)"IWJ[#&YAR,>P]:X<)FN85**/D= Q]CW'X'(K.^+'V&XAO96M+=Y0C8=HU+=/7&:] M2>34GA8XFM)Q>W=.W4\^&:5(XAX>E%./3I8\DCMEG"R7&)F(R%(RJ^P']?:G MW43-;F.(*I;C/3 ]:BT&"\NHECA"S@# 5FVL/;/0UTL7@OQ!<6YF31[AHQU( M>/'Y[J^>GA<5BY2=!.44W;EZ?(]F.(P^'C'V[Y7;J5O#'B/4O!MVD^E7+P!" M"\)),4P[AEZ<],CD=J^J]#U1=V^G_ M #X7B2%&4H5Z4;#\9?^P;H_P#Z M)->_UX!\-/\ D\'XR_\ 8-T?_P!$FO?Z]/,/XL/\$/\ TA'FX#^'/_'/_P!+ M84445YAZ04444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 444 M4 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 M 4444 %%%% !1110 4444 %%%% '.?$G_DG7BG_L%77_ *):N&_9*_Y-O\ ? M]@U?_0FKN?B3_P DZ\4_]@JZ_P#1+5PW[)7_ ";?X _[!J_^A-7IQ_W"7^-? M^DR/-E_OT?\ _SB>N4445YAZ05YI\1?^0RGKY?]:]+KS;XBKC6(?XBT?3\: MF0T>"_'_ ,>KX-\&O;1RJ+S4_P#1XQOVD*< MZUY'\$]$G::\UJYA3[+8QE? MM#'K@$GDUZU\2?A%IGQ.URSU"\O)(5TTNK1G&T9.3S^%>,_&7XHV?AG2K?P/ MX13SWN9Q#*44L6&5!(Q^-6.YTG@Z__P"$U\0WTZQF2#=UZ@BN M]UGX4:9J2PW<%NEGJ,&#%<1C!!]\5F?!NPM=&T>&V!C6\ 'F=CFO7[>)'M6Q MR^,DCUS7?=-),X)N49OE/+[JWTCQ8XM-9L+>YN[;"%7C +$QH4#MYNALYVETB))90$"^8GN: MV]E&UTK$3G.2LV=M>VT=_#LF&Z-AE<>M<;XFDN+31+[[%+NOUA/DQ@?=X-=' MH=Z7M1]H+1HR[P!_",BL34%QJ%S)#*OEH2'9N&Q64(OFL+FL>9_"+P?HVL>' M+>\N8HFU*3L2V5E=AII8W4,NYNX^M.B^$R"&.34-:N=1N'?S?+.%5F&. M"*TG!RTN;QDHM-CM4^*]Q<:C8Z1HL,U_K5RB7,H\S8D*ET/QG M_9/B+3-NGR*H%]#(=B,W0'(JI:Z?!X1^(&L7UU$%6\BB87$72(* -I/Y5=\; MZYH]QX0U*XM[R&];R\K$C L'QP?SJ''D22+LIR/:(2KQJ0V01D$]QZT_N.*X MWX2W=[?_ ^T>75%,=V\(+YZ[<#%=B""<@Y&>*YGJ82LFT7?#/\ R'[;/02K M7K:C"CZ5Y)X:_P"0[;_]=*];7[H^E:+8S/,OV@OA_I'Q,\"R:%K-ND]M<%E4 MLH+1L5(#+GH1FOAOX _#R]\$1>/;32+HF]2ZEBMQ=VQAW@,/F*G@ @'&.#7W M;\;K6XF\,)-;ZG_9+0&1S<, 57]VP!.>P//X5\R?!74KC6M#EO-7GCU:_6YE M07T;AO-1<#GIQD'%>-B6XU;^AZV'UIM'$_'+X!W/BKP['>:==QV5VB&68[R< M*4 ('L2.@KX!\2QZKI6J?9]46Y74$Q&A=2@1%X!7IG&.M?IC\8?$6LVTID\/ M2K-+:JK3VF1RI]CP:\6\0^#(OCEX=O\ 4M6TF&UU2QMR\AX]I7[8/Q'\"Z'9Z%#J'G0?+]GN;R/?/M'&,D]#CC/; M-<3-XRUC5/$VJ:Q>6C:MKMY*&FN'NLH) ,GCVR..U<'\5K][SQ#?&=6LY+>4 MPK%D%5VKP?Q.3^-2> KZPU -:ZA'/'>'<%N;;<79FQ@/[4.FJ<>>QTQG[27* MM+GMNB:IXC\1^&_[0O-1MY;_ %7476>6\/[M D.Q-ON!G'T%?0GP4*>)=/U7 M0M0U&0W6D310R_+F&1(GP&&3C#?*?UKR#Q1\+93\*K_3 DL=]H\T5P)%7'G( MZ+N(7^ZO(_.N\_9]L8/!_@_Q2^FSF]GN?+BC9W!=Y,*7V^N!SCVI892]HFMW M^IGB91=-J^B_0Z3]I/6X]*T>RLK!PVDVTJAX8W(484;5QGH>3]37RC-J"^-- M0SK!G>-;@O+#,>RD$+C^[M&*]E^,P/BSQ(MGI4L4XBDBW1Y^6:<\$'MZ<]LU MYU<>%/$NKZP=,E\*W>F:@T9C'FQ%6G8MA=O')]Q65:IS3O;X=CHP]-1A9;O= MG$^*4T>S\6:ZF@+'-I%Q:!(HONK'(^%.!['%>?8G.L2V^]H9[&V=7>-B-QC) MYR/PKVWXN?!G4?@S?-I]^JR7%_IB73'&/*=BV5'N-@KPS6'6TUR8VY9UVD!^ M[@J,_F1ELDYYS7 6&AR>([_6)],'DV,"/ M=L&.#Y>8PX _X$#^%;^K^ M%RLJ:K926]P$,<8ER86;. -IP<=ZZJ M=J3M'1/<\ZO!SC=[H_1?]GU47P"WDRE[8WLK11D\0J=I* =@&+$#WKTRO)_V M9+K[;\+89A;BW#7DX 5]X90VU7#=]P /XUZQ7L+8\.6X4444R0HHHH **** M"BBB@ HHHH Y_P 2OMN(/]T_SK(\WVK2\5MMN(/]P_SK"\P^U=].-X(XJC]Y MEOS?:CS?:JGFFD,I S5\IE=ESS?:D\VL?7-?L_#FDW.I7\RPV=NF^23&<#I@ M#N2<#'J:\LUC]HBU&BW[V&E7UO?&$O9&]B'ERD=3\I.,#+<^E:1I3EK%$NI& M&DF>UF7BLJ_\6Z3I=E=7=SJ5LD%JNZ9A(&*#W YS[5\Y:AXA\:ZAIL-K9^(V MUFZU>-D>R@55=!C+;2 -O /-9NE^ K;QK=6NC:+:3:9J%LA>^GO%95!5L8(Z MD[\# _I79]3M?GE]VIS?6[VY5]^A[%J/[1GAF#2;JXM/M-Q=H (+:6$Q?:&) MP-K$=.O$NC:7<'4- M[6[N(-]B\3EU4YZR*>$?" MP^(/B.YTKQ!'!%!H\+QHED2ID=9I8"V[ (PT18<<[E^E7/A?'IVE>.-5L==15VK/Y'/]9F^5RDDG=?, MJ67Q"\::*UM-%K2>)KB]MY7^P+$I,1"$AAM /&,D>*U9DV^: M98RI4'C;(R$#IY0R,8-2?"OQ%HOA_P ?:C;:B([;4-20&UNVBPESFYG?*28P M0ZRQ8.>>!U&*WE02C*48*UE;\;F,<0KQC*;O=W_"QSMGX\\46&GV^LVGBFYU M;6+AB&TB0&5#Z@1#ICVQTJ73/'7B>PM;35;'Q-<:YJ]R3YFD29E4\>%ZKBG*DK2M!;)H4*[ M]R\GNTS T;Q]K^FP6&M'Q=+J-]/-B;2[E\Q8S@C9_#W^[C&*T)/$6N-XF&I2 M:G.;MHR%D3 5%)^XJXQMSV-8U]/;:#KOBK1K^Q:#6+\J\$CP'$B"]FE8A\8( M*21B>"_AO!XCL3*U_<6_EH6"X#CCL,\_K7Y'QG+$UL;1P6$GR-) M3T]?TZ'Z5PHJ$,)5Q>*CSJ[CK_D<9>^(O$MWJ5Q>?\)'J!@52K1;P(FXY78! MC\>M+#J^KV6F(8=9OK9(X-BPK*?*VXZ;.GXXS3KO2Y=,\03:6)XWCW;TDF3D MANO3WS7H"_"VWB\-KJ4EVU]-_!M3UW2DGTQ4G3;N:"1]A'KM)X^H.* MQ[VW:#5I;*^5H'B52(&88;.>>#STKTWX5ZS#I6B:]8.0MS;N&3/7RWS_ %!_ M.O/YYX]7\:3F5%E0[5(<9'2N/&4L+3HPK)/GFKW]6E]ZV\SIPT\1.M*DW[D' MMWLKOY%!K...XCG4"$1C@I\I#9R#FFS>+M:8WE^GC.\@N+0JEM9-)E91CNO1 M\GC)R37L6M>"]$LO"T%U%IENL[ Y,:'K&D>%_B%IVI:S;&*U\^6 M-;YX-T:L8QL&[!QM^8D=MX/0$C[CA#"RPF93H.;GSP^EOP9\CQ-B8XC 0 MK*"AR32^5Q?^$Y\3ZE+J>J:CXHN="U2TD(CTE,H@]%,9^]GWS2_\)SXHUFZU M*_U;Q-<^&]0LROEZ5'F)!QT*'KGK\V>M=%XQU73/#7QBTW7M:@!TJZ,9MM0$ M/F1 &!U'S 'HQ)/LZGL2'^/=2TW0_BSHOB/58?-T:?[.8;]83-$!Y-RO4 _Q M2Q'WX/\ #Q^RJE%N-H+6-_FC\K==I2O)Z2M\F)KGPY?6B MJ8=-CS"C<<90_>SUYSUJ.W\=^*-::_U#5/%5SH5_: >5IR#R4;CC,9ZYZ_-G MK73_ !#U;3=)^)GA_P 2:I"+G0I_LOD7\<7G1X"W*D9 ./FEA;'<#(SMIOCK M6=*TKXHZ!XEU*(3Z%<_9C;:C'%YL6/+N /F /\4D;8[@@C.TX4*2:C[BUB_O M[ ZW+?WGI)?=W]#G(_'7BG6Y[^]U?Q/<^'+ZS13%IT?[E&X!!*'KNZ_-FK<7 MQ!\9>(K^[>_U\^%Y;*)&2T$03SOE!WL&!)W=<=!FMOXB:GINF?$WPYXEU"!; MC0I1:^3?QP^='@+<@\@'^*6%O<#(SMJ+XC:GHVNI@D*1Y6.WF,;30I!$8P"I&X,T[MGTB4>M4_^ M$;D?XIZEI'A1H=(LW0PW D0NJB.*/S' R.\L2X[G><\5B\-3T4ETNV:K$SU< M9=;)'LEK\5?"MS!92'7;&W:[0/'%/.L<@SQAE/(.>.>XKJ!.&4,I!4C(([U\ MI6WA1-$\7:WX>M]+/B:XD++'W *X X88/4CFN>6"3LH2Z7U.A8QJ_/'2]M#ZS\VCS> M:\*TCX]:S)#';#PW+J$]G"OV^;S/*._')"X./Q[UZ;H_CS1M:L+"YBOH86O4 MW103R*LG7!&W/4$$?45QRHSBDVMSK56,KJ+V.I\WVH\WVJF)21FE\P^U8\A7 M,6_-KIM".=-C/7D_SKCO-.*Z_P .'.DQ9]6_G6-96B=%%ZFE12T5QG4)12T4 M )12T4 )12T4 >"?M,7&_5?#-L#]U)Y&&?4Q@VD-TF>D MR!OYTG[0\_G?$#38>T5BOYEW_P#K5M?#2',D.!W%?DN+;J\0SMTY5^!^DX5> MSR2#?7F?XDGC[P'X?L[62.WTR"$LA7*CID=:\6T6)I)VMIYYD9&*'##C![9! MKW_XD2[6DY[=J^?+F?[-KTAZ!\-^/0_TKCS^O*%9QI_9UM;3ST.K)J2E24JG M72_7R/;_ !X$T"XC,EQ;F^N N4:Y;&/\ L%VO_HI:][AC_>\5_P!N_J>1Q!_NV'^?Y(Z"BEHK]$/B!**6 MB@#P#X:?\G@_&7_L&Z/_ .B37OU> _#3_D\'XR_]@W1__1)KW^O3S#^+#_!# M_P!(1YN _AS_ ,<__2V)12T5YAZ0E%+10 E%+10 E%+10 E%+10 E%+10 E% M+10 E%+10 E%+10 E%+10 E%+10 E%+10 E%+10 E%+10 E%+10 E%+10 E% M+10 E%+10 E%+10 E%+10 E%+10 E%+10 E%+10 E%+10 E%+10 E%+10 E% M+10!S?Q)_P"2=>*?^P5=?^B6KA_V2O\ DV_P!_V#5_\ 0FKN?B3_ ,DZ\4_] M@JZ_]$M7#?LE?\FW^ /^P:O_ *$U>G'_ '"7^-?^DR/-E_OT?\#_ #B>MT4M M%>8>D)7FOQ$F,>LQ>@B)R>PS7I=?.'[7?CU?AKX)U36V62218#'&D74ECC^5 M1)I*[+A%SDHKJ?/?[1_[2EAX/COM TN53?RC<\D0SN_V1[URO[/WPVU$>1X[ M\3;3=W WVMI+G,:$9)->1_LW_#/_ (7?X]NO&>N.[:'8RE_L\SDEVZ@&OLB\ M\56=C="VCM?M$2C9%;PC( QC!]JQHP5:5Y;'KUW]6A[&&[W+ATNSO@-0L[F. M*9QNVQ9XYP*T=,U[5-*D>.[@$]NAV^;$2>1V(JKIZ:Q%;-+%96]O;1X80MUV M]<9]:9I&M-=:9+.WFJ_FD%"1^[.>?Z5Z+5,\=E6*6DQEDD4[/W"[BON*NZS'.=.5C*66=A"-OH>]:-IX7TZ!4 M#1AG"@$LN2WXTE*SL+U*=OJUOJ%@EYI\TDH<>6(W&",>M7U6.YT^::5$,S'$ MJGG&> 16+9VD>@ZO?I9KYD/#!,9"DGFKDD1N]DH8Q.6 8#^( GM^-:+75$,= MI$<6F6=ZMY=+%9QMOB\SY0..U-TK6=+UF8-:7T%[> YVI]Z/BN2^+TE^;5+6 MS8%]HS$>/,'>N93P6/#6CV?B/0)OL=]&T9NHV)Y!/.142EU-H05M3U._@@>] MGL[BV2Z25=TNX8W'IFN?L?AGX;T-;K5)H?)3:6D@D;Y%Y]/RKKX1%J36=S++ M&CO%YAVC+-GO61XZ\/7&N>"+^UM)C<7$J%@5.&8#M4/6-Q0;Y^7H6+'QE:PZ M?=75D@N4AMLI;QO@@#TKRK5?VF]9ATF]NK71X4EB.85D;(88'7'?K7'^"SKU MKXJD\ZVGLF%HR+#=-A'P,8%:WAKX"CQGHJ:W/H'X _$"Y^(=CI^I75FUI>&0;XP,*>.HKZ20_(O' M:O"?A+X=_P"$9_LNREF629#M,D:;0V!CI7NR'**?45UPYK69Y4^7F?*>._M2 MZSIVG_#>6RU"^%@-1+VT;E"Q9MA) Z\ U\;ZOXUN/AYX$LM.L4S!*[E+OR3 M&JKD J0<')SFOMG]HWP]_P ))\.;N!-HN8P\L#LN=KA"1_A7YI?M*^*KU?"& MC:3=O)#'-<#SI+=-Y 1<[..A)YKSJJ?M9-JZT.ZA9P44[/4Y/QY\VND23VEO?( MT5TR$CS4;JIQVXKS[<[M%'KN"@DVSV_]J?PSI_VK1==M-)M[=-3M%BDFCYB= MSDK*"..5!_*O#_#4&I>$M9L-9^S7$^GA\EE!(D56_3D=Z]RTNX?Q)^SDEW(\ MMW>Z#=Q(]EM#,(MQVLPZC&X#/3 KK_#>@0>+OV>O%9M((EN]&A:(>6 7E1YD MD+,>V!N&:F53EM%==QPBK7?0[OQ#XIM=$^%&G^.&9KF"6127))!C(X7'?DX M'O7*?LQ>+7UK4KC3+?27FURUE.HQK<+Y<8C:11Z\L%R>:\?\.ZY?WGP#U73U MNG_XE.K1A(9L-B-LE3COAN?QI/A+XNM/"?Q/LKFUO+F\>4);[BQ!N"592HXZ M@LO%=+G-N_6)RJE",6NYWXNK74/&7B=='DVH;^2_@8'.%W*&7GME7PZ M^)RZYI-E)=P12SO&&BF3!(XZ<]Z_..&_O8O,L9M.NK?4M,DDLUN81E@58\,O M7D=:^I_V:[NZO]%D%RC*Z2"(EP5;H#G:>E>34TJT@^SP2:Z$>.&7=C8#ZGTZU\[>(/V(M-U#Q%'9VD]]%4%*7- MM=./+T1\_\ PN_8^\(>#IKOS$FUR[N(1%(MQ\@A.X$[1Z' Z]A7N-A; MZ1\5_AUJ?A_5+1XK.='M&BN8MC;5)577UP1D'VJW:1![PRD@R[/FV< @=,^] M7M%M'TPZFUVL3VYD:Y1XU(<*5^8$$D?>R>,#D<52CRNYG.I*>K>I^6GQ[^"< MGP<\3ZEIQN8IOLQ6XM9\[3<0OD A>AP5(/O4?P$OK^3QK8::LD BU)]LMTD( M?:[\(C <5&C 812<\\GOZ5-)N6D>KT/1JM.G>>Z6I^IO[-"7$ M/PLM8;JU6SN(;B6)XD& -I R!VR #7JE><_ -O/\ K=@,%O+A[E.'VW=K_US/\Z\:\2_&.ST+6YM,M=-N]6N+4 W+V^ L/&<9/4XZ^E> MMAX.<$HGE8B:A-N3/1[B[BM89)I7$<4:EW=C@* ,DFO&?%/[0'VC1-0_L73+ MU%D4Q6NILHV;CQN"]>G(]\<5YMJ7B"/Q7!JNJ:MJ]Y%J$DC1VEH'945#PJA> MF,<'UYS72:CH6I^ W\.6>K7*WFB(Z7+Q1Q8)*,IDCZG)"EG 'WA&U>K3PL6_ M>U;6AYE3%22]W1+Z5I-IX@O;F\U$%[\RR,Z@*-VX@GG! X_P#K MUV/A2UGM_B=:Z-K]S%=#3A-#:!8MB/)Y2,I.>NY))"!ZQMUQ6CXITC_A)=**>WMF==LGE,F-H/1Q(NT<\K@8/$^LMJ_A;5 MY_'7AA+/5]!N@\TYEE,;)$Y3S,KMS\K1[L]1N<%36?X9U:6Z^$WC33[MVF%I M:GRT8EO+9HL$+G)QYJ.0.V<#I6T\_P#9?P8UR&Z<027SZE'$DWRDAGF) !_V M0S?05;BH2T6ND7YHSC-S6KT^)>3*6NZ*]YI1\>Z%JE]X?O5G(O;&%D=0_G+' M<*&(Y^9<\@J2N< L:N^)=(T[QC\-K#Q+JNFV$] \.^&K20 M2VSLA>25069DN;<*WI]Z4&E%R;A;^9V]$#22DY+HK_XF6;B=[KX%:2\[M/,? ML:1R.=S;OM,:H<^O3FN0CW:XW@/1((_WBVD7F<,()'4"[FY\,_#WQ'KUS(UYJ$1F2)IF+9:$&,=>FZ7S&_X'CM4O@JYD\*_#W7] M?N'>^NXC.4:9MQ80 Q#K_>9&8_[_ +57+R:+[.B]6+F535_:U^2*GQJO4U/Q M9HMG&N[^S8VFFD_NM+\J)^(CD/Y5ZE\-T\CPY=.>#Y>*\(M+*>+1[*>[NI+N MYNKV9"TCEOEM_P!T3^+F1O\ @8]*]^\)+]G\&W+=. *_%\[LN(916JITTOGJ M?K&4)_V'&35N>;?Y+]#Q+QS=O'XGCF49"$[V] 6 '_CQ _&O9OAUJ*:WH,MD MYR63*@^HKQKQ%>A-0U2(8,US$($R,X!<,3_XX!^(KI?A+KKV-_%'(=K(VUU/ M8C@C\Z^,P]2GAJ]"I?XTU+YR:C^"_ ^JKPJ5Z-6FU\%G'U44W^AG^*_,\,>( M'N%RL;AHI/0AO_KXK(T[3GL/$-JTIS-2ZA>5 M4S'*N>G:O)_#EW3R;I>,+'CY511Z!%7\MZR+/P;]CCC\^[D MUDW2Q 9)$*1L/^^I/*3_ +:5[IXD_P"1(MA[&O*_A9I\ESXJUB]E;-M;((HH M^WF2,&<_@(HL>G/K7W>0/DSJ,GTI_DT?%YY%RRF45UJ6_,F^(MU_PB7P^\-: M,P%S?Q9\0]8U2YE M=[:VWF& L2F&=H4XZ<+;%OK*:_7K+F'@WX/ MZ)H][@W3"!9449QY9\Z8@>RHP'N147BFX;PE\(_#VF7: W;O!-+"!DKY9^T2 MA1_P J/=E%.\&7$WBSXE:MJ5Q([V5MYC10,V5&9&MTX^D$K?63V%'@.>;Q5\ M0M8U2XE>6TMQ(T$+-E0&D,2<>RVY;ZRGT%'P:M_#[WS9/QZ+[7N_)$OBZ4>$ M/@_H>DW8W7++;)*@'*^7B:8CZ!& ]\55\7W8\(_"OP[I%[$);Z5H;B2$#)7R MG$[@#W;;&/>1:D\'7$OBGXG:Q>W,KR6UGYIBA+$H/WC6Z<=.D$K?]M?:H_B/ M<7/B_P 83:E3E-= M?=1@6NEKJ7BSPAHUG%')J.@P16TM_'V9&CDGPP_A0+Y8[%IB/X6K=\3@:'\; M-.OM$N94N[H10W]H,-%)YCH#P>C>5$[DC_GDN>O.IXOU^P^&]Q;6^@Z9 =6O M!'YBHN3Y0?"KC/+.[E5]V9CPIJA';Z9\,;R#7-=N)+[7;Y&9T7#B)R 9Y!TR M.$3..BHH&3R*;=I6T::2[^OD#@MKZIIM]NF@6DUQX$^-I)D8]1C/T:XG\; M>/)_$5XK6&CZ;MF5K@; $56,2DGH3YC2MZ#RP>:U"V6L+J%&<[,D*QP. 2K8)QG&1P:[+PA#!KOC+Q=?Z:TFE:'J- MM*+QMQ1$#(HB?!X5S^^E[8612?O5)\-?%,^@?"_Q'>K:PKJ=K+O,X!$;AT3R MG(ZA50KQV5?>JG'E3E'^ZDO7);30X9[O1X[O2; + M;W%P93]H.W@MZ$X'3OCKS7M&E^)=,UEMME?V]TX0.8XI59E!]0#D5X'IW@6V M/P]U/7K[6[R&*^622W@BP?.9AMC+*!DO(YW;%QC<%'3-07^G3YDO54^2^&"LN_D$$_*<9!S7'5PT&WR:6T]6=]+$R:3EK?7T1]9>8"# MBNV\,-NT>(]?F;^=?.O@_P"*.KZAJUA9:]I<%I'J()M)[9B1D G:P)/4#J#U MQQ7T/X3(.B1?[S?S->)BZ8>D+129HS0 M% M)FC- "T4F:,T ?,?QJG%S\5KI!_RQ@A3\=N[^3"NZ^&$/[R'CWKS#XH:@7^* M/B.Y6&2Y\N9$6*$#B? M$J;YYN?6O,-&\*?\)%X9\8WT:%[K35M[B(CT!D\P?]\9/X5M^)?B1HOBF]BM M[*6X6:[LAJ-N+BVDB$L!"'T;439NEK%*L1DP[M@J-HSNQC!SG&36/#4Y3<\,]5_5C;/HQ2AB(Z/D[6DQW).:Z3X*:&]WX>\5>(+A?F6REL8B>Q"%I"/_'/UKSH?%&?Q;<:-CV.KP26\<+3[I8]1C;+0DD ,'C8.F!D@'UKT?X/:]]DTOQ=X?E;"26"%9!^6P_@:ZLMPT<%F_LJRW3E?1&C?\BU+]!7R-XGU?4_#OP]UW6-(O18WVFV4MY&[0K*KE$9@C!NQ('3 MFND\6_%SX@^ XM6TFSA36K**^T^%-8ELAMMXBT/VE)=N%WR"=%CZ?Q]=O./" M]&4X5)W6M_S*XAJJ+@K=OR.K^('+RGM7T)\.O^2?>&/^P7:_^BEKX\TWQUJG MC+5?%L6IVT>%XXVA1\,6^^V222..1C(P3]A?#H_\6^\,?]@N MU_\ 12U[?#M-TL=BH2_N_J>9GLU/"X=K^]^AT5%)FC-??GQ8M%)FC- '@/PT M_P"3P?C+_P!@W1__ $2:]_KP#X:?\G@_&7_L&Z/_ .B37@W[8'PH_:+\6_M( MZ#JWP^O-4'AA$MQ92V.HB"WL9 ?WIF3<,Y.220=RX'.,5[&-@IUH)NWN0_\ M2(GE8%\M*;M]N?\ Z6S[XHJ*U$J6T2SL'F" .RC +8Y(_&I,UXYZHM>8?$S] MHWP9\+=>MO#]_+J.L>)KB+SX]"T#3Y=0O?*_OM'$IVK[MC/;->G9KYG_ &08 M8M5\=(\B*7<%C;!&7!9C@GH16BIJ5FB>9K<^V**^3OA%\8O%7CKXG_ M 1?4=4F%MKW@.YU/4;.([89[I7C E*#C/)^F:R_B-\>_%?P[U_]HNYL]0EN MWT8Z-:Z);71WP64UU&$+A3QC0,5+Y887Y3DC)]JN>$/B!I'C>[UVWTLW)DT6^;3[O M[1:R0CS5 )V%@-Z\_>7(KY(^+/P:U3X=Z[\$M3U7XC>+O&-_=^--/6\M];O4 MEL_.*NQDAB" Q8.0 &Q@\YZU3\>_%;QU'X$^*[Z=XLU#3]0L_B?;:-I]XK;S M:6SR1+Y:J>"GS'Y>AZ5:I)I68N=K<^YZ9+*D$3R2.L<: LSL)O&.E>,H+^+4K7Q%<)-''-#$)%EMU5%$(SD;5XQ7T]< MVT-[;2V]Q$D]O*ACDBE4,KJ1@J0>"".,5C*/+;S-$[G)^#?BYX3^(7B+Q!HG MAS6(-7O-!,2W[6IWQ1M(I90)!\K' .0"<$8-#->U;2Y4US5VT4 M@:Q>:+HUQ>VNEY&<7$L:E4(') R0.H%<-^SEX>TKPM^TK\>],T73+/2--ADT MCRK.PMU@A3-LQ.U% R23P.]>2V>H?$?0I/CQ?\ PBTFS\7^ [[5KQ;E=2;R MKZ&_,>V[>U&=L\2<85RA8@!>Y.RIQ1:A MIE]"MQ;74#;DEC895@?<&O(_'/[7G@#X?^(M4TG44\07']DR"+4]0L-"NI[. MQ; /[V94V\ @G;FM;]EEO#?_ SWX%3PE=W-]H,>FI'!/>)LF8J2'WJ"0K!P MP(!('8D)='LM6TN[BOM-O85N+>YA;--;\+6QN3JVCQPRW0DM9$B"R#*;)"-KG'4*3CO67\$/A])\*/A%X2\ M(S7 NI](T^*VEF7.&D RQ'MN)Q[8KPSQGX]^(P^)'[0VE^#[NZU#5-(T#3)M M"TW D6&:2-C(T2'@N0"0.Y I**DVE_6H-V2N?5=%?)/[,GC#PMKOCG3K6S^+ M'C^[\6I9.VI^#O'#2!I6V?,Z1R1*%*-DXB8C Y'>O2?VJ?'FO^%O#/A;0O#& MH'1M9\7:_:Z"FK+&':RCDW&21 >-^U2!GH3FFZ;4N4%+2Y[;17RGK>B>)O@7 M\5_ _AFU^(?BGQ+X=\>)>Z3<+XAO1=75C=+ 7CN;>7:K)WRO3],J8N?N?:%%? M"I^)&L?$_P 3^-C?:K\7;>ST+4YM#T>/P%82O;)]G 0S7$B*?.E=\L58X P, M(-;L=7BUEYM/"32^0 $F-O( JR,@W D$* M7R >!5>Q?5ASGVW17Q3XN\8ZW'\5[OX8W_B+XH:KH7A'2[9I[[P;:O+J>HW4 M^Y_,NIX4RB*F%55 #$'/2K.D:K\7+WX->)]6MM3\3Z5J7@;67O\ 1Y_%UNUC M+KNEJ@D:"\5PHBVET-UNT9'FW4VTG]Z7)"@]%&>X-:7C2P\;?!+PI\/_ (H+\4/% M'B>\O=1TVVUG1]5FC.G7,%T51A%;J@$;+N&&!)XY-'LGLWJ'.?9=%?(OAN7Q MSXY^*WQDNKCXDZUI'A7P;KJ2PZ-I\<9>=4MTE,1E<$K$<$%% R6))Z5Y=IGQ M-\=>/_AJWCW3[[XPR>/[U7O],M-'T:5O#JX^ _#WCGQMXP\+7FE7.MWGB3P MG:FYUJ_B$YCAA+QIF,*_$'Q=XSGNO%&V>+Q#?)<0++]FD M)DA0(#'GD;0Q&#TXS7TC\?\ 6K[PY\#_ !YJFF74MCJ-GHEW/;W,)VO%(L3% M64]B",U+@O=MU&F];G8Z%K-MXCT/3M6LS(;._MX[J$RQF-]CJ&7 M15ZOC>&^\9_%#XK?##PJGQ"\0>&]*U/X<6VKZF^DR(MQ=3%D#,KNK>6[%N7 M)QD#& ]9\0ZCXIM?">L0PZ=J6L2B6\:":$2!)9 !O*G M/)'>B5.RO<%*^A] T5\S_M<^)_$6@>(O!*S7WB[1?AI+]I.O:KX*B9KV&4*/ M(#NBL\<1.[)4<]/2O-O$7QM@TKP-X,T#X?\ Q*\6^.M+\6:[<0RZW;6QO==L M;6&%7EMHE,:OYA)&&=-RJQ/. :(TG))H'-)V/N&BOAAKKXFW%WXJT#P->_%2 M#1;GP]-?VFH^-[.=)[+4X'5TCCN)%!9)D!4H2>>E=]+\==2^,%W\$K'PSJ5S MIHU6T?Q/XB:S?:Z6MLFU[=CV#SDH1_LFFZ3[B4SZIHK\^-+^*7C'XJ^!=2\< MVVH?&"+Q==O<7&B6OAG2)7T&W".P@A**A2=3M =FRK:K86ELIGBN6F*R+&LH(A?/!8J2 ,<=:;HM;L.>_0^PZ MX_5?BCI&C_$_0O <\5V=:UFQN-0MI$C4P+'"5#AFW9!^88 !^HKY-^+&N6PU MGQ?'X:^(/QI\4>(="B,4K>$R#I.F7$4(^6<#UH]E97?]:!S]#ZP\7>+M'\! M^'+[7]?OH]-T>Q027%U*"5C4D#) !/4CM6I;7$=W;Q3PN)(94#HXZ,I&0:^? M_P!O71VU?]EOQFZZA>V'V2*.X*V<@03@2*OER9!RGS9P,NVOB"]2>.!+F)4@D4+&@54D ZY/S=:F,%*-[ZC%\]2!C%:WCGXH>,+C5?!=]\6K_P ??#GP9<^&8+B>[\(VTT'E M:J6(G%XT<;21@ JF,<]#S3]B[VN+VB/N>BN$^"%]I^H_#'1KG2O&5QX^TV1 M7:WU^[96FN$WM@2$ 991\IR *?^P5=?^B6KA_V2O^3;_ '_ _P#0 MFKTH_P"X2_QK_P!)D>=+_?H_X'^<3URBDS1FO,/2%KX,_P""F7B:YT_P];Z= M'.(XI(S(Z8Y;YL 5]Y9K\ZO^"HD874M"9F5$EB$;,_ 'SGO^-95?@9W8-)UE MTRWB-L^IA)YYCQN) KZ*T'PI8^'[(33.AD"AGD8]_7->:^ M&+&SU_P;XXA$>"UNF[ QW(K M9)0BK]3"O*52I)];EGQGXTD-NT-FR3+(/E96ZFH_#'A378=/6X-]'%+<)F2! MD) )KB(FCLK&QAGF,,D$N&$R'(P?I7H%S\2&NX_(L;%[EHUQY^TC(SQBNJ:C M%+E.=*47J6-!O=^DZAIUY$XGAU23Z3K7G1%-2=[$??&,E,C]: MKZ1#+#;7&JZO+]F:9P!&>I']:VM/\1Z0+G[/'HP:7;7#N5 MF=TW)*#PQ([?G6AX,+N3S))MPX/UJN906O4C>[/-_&%[+XOM+% MYDDL[N"8I.RMRH_*EU+PSJVF:&+JWF%U:N^9(ILC* ]3ZUV>DV::J;V[DMT\ MJY8?*S %<#&?QKE_$MMXHB,FF:?&LUBP.V5N21V%.7*]$M#2+NT6-/\ B;IZ MZ1#+=V#HR$0B6$\*.GITKTK2;RRO-'C^R3FY@D4@31CH<>OXUXEX4GL-/@N( M]8VKJ%F65K69MJN2>"!7:>&M3AL]?O(='W-:;4D=8CE$D)!*D]*XY.[Y5L=+ MCRKF%^(G@&[\3P0W-E>):ZA:QE4FZA@?8>E:.IPWG@SX;J=+E\V^MX%#F-.7 M88+=/7FNGN48O#Y%P8=PW.) #N/H*IP++)>E490F,R*C DGITK-TTVVB/;Z1 MB];'FOP.^.OB&^^*.A^'=8L'E2_9Y$FP1Y.!T/')-?;L9S&IZ<"OE?0O$VC6 M'QBTO0[>TC;41*A>4\-@]P:^IXR?+7/7 S4T]K#K23M96.9^(47GZ0B'H6(_ M0BOSD_:E^$MMI7PYU76--GN!=-=J\D ?(R6*N1QZ/7Z.^/'5-,B9CA0YSGZ5 M\>?';PUIFL:)J6BBZ\HW*NEF&8NSNRDG ZD8_E7GXCGYVH=3IPSBK.7<_.'6 M4T$Z[9Z1&T-KIR3'S+Y\NY4* 3Z')!(]S6,/+L6:[@N&2+?Y=M$8LJRG.[)Z M9 Q^=;_BSP9J_@'Q9)8:O"]C>88QQ(ID;R<<,"!W!Q[8-9MJLBQ+BT4)@OYN M2Q'4 $C.WGMC)KA5XZH]G25KZG2^%KNWTJ.5;W4KJWDOD6TD*\1M P ).!_# M@'GTKZ'_ &2[F70M5\46$9A62>Q8/:NZH"$<;F^8'=A"6 [U\H:O!K%Q9S7, M4Q"DB%A(XWH6& ,8&<@=NE=-X:UC6YM6TE=\]OJUE ;2;9]XJ%;#$?[GRD^P MKEJ1ER7>[-U&$FXK8]_^#_A[0?&_@_QEINK0"VU @E8XV!=T5!\X&,#&0*C^ M"7[-=C8>+M/UJ;5X=4T[2;TO:))&4)D;H6)/.#TQU.*I_"V^U7P7)XJ>#3TG MNK;0"SM( R2H3^ZSCCGD&LOX#?$'Q!XK\=0Z7J<0O/#5U(T4UK9D)Y#XWJZG M&?E('-=:G'E4)7N^OD<#IS;E*.QV7QN\$KH7Q&O9+(".XO-UW#*@R&Y^<./J M3@]LUZ_\)M-&@:/I>KK?1W::B=LVULD2*""F.N1WXQ7F'[4?@?5],\0:?X@L MFG.FRP+:S&3^'E@FMC?7PN9$$GGM\@*J20O M0?6O+Q"DII[G=1M.E9;GW;83+)$K( %Z;LX:G[_-!,?RH2_NHHQDN6&<\?AFO4;:ZBU"V@.O/&:TM?\9Z+X7TY[[6;V+3M.R(C/<#:K,21C^?% M7-'L8[II%D*E5 ^3 ]*_/W]M_P >:C/\8KCPW=Z@5T:R$O"-OX1^*NK)HVHIK&E7]>TUY)^S!;6$/PP$VFP-;6US?3S^6[;F#$@-D_45ZUFO?B[Q1\W+XF+129H MS5DBT4F:,T +129HS0 M%)FC- "T4F:* .+\?'%Y:?[C?SKYY^(7@N\\._VU MK^EZB(+6\9&O(FBW&-20LD@.>@!+D>@-?0'Q$?;>6G_7,_SKDI"LJ,CA71A@ MJW((]#7NX.3IJ,D>)BX*HY19Y3';:)XR\":1H\%SI]EX@M%$?V&ZF57,FTI- M&V/FVN&?Y@#]X,,U4GU_7]'DL="\"*L?$OX=Z)HVDQZEH]C%IMP;B."1K<%05D(16QT!1V1P1TV^]'C^^M?%? M@3PI/=W M+B^5)=VTE@LL!B5J/)\+;]5Z'S\^=-\^DD MEZ,9J>A67PZ^)>AMI$"V5C=,A,2?=&YQ#*N3V)E@?'JF>]7/%$\&G?$VZU2W MN4:[LM/DNOL^TX:2&WDRCGC&Y;B$@C.?+(XQ4GC;5[C1_'WA@3R*;.-4/F% M#\S^3)D^FZ2W;'^P#5/XCZ;=Z/XOB\00:;0 U=C\=%">&M,E5@;2(S*7W?+EK:0)D]/F/R@GNP'>O)=/UK49; M*339;>*?2)9ED2&X#171D5?*RI5L1LVT(P.[#N-R@/7<_#/6+?1O$JZ =4EO MM%NH2UM'J,WF'84BDB.#T^6212!@'8O&WB?$'1M-UCPG+%KGV(-YEM:R*9$+&.1,J2",-"H(ZX8D XQ27=U M%\;=.C%GY_A[7+!6/DW\08;68 XVMG*R0CT*L@RN#SS>C>+-(\'_ !*U.:SC MD&B*\\+R6T7[I PB8* .RR+-C'3><=:IZ1XMU?3=9U3QC9Z? =)GDF'D2OA] MKE">1QG,>>G\;5S64%[B^%73]>_0ZM9/]X_B=FNFG5=3O_!NNWWC*'5?"_BY M8)[F)H,1)20HW.>""(W5ACAUX!%9/A'3I-"\8ZGX-GOY]6T&Y\^(VMXP M8HK1))P0!@9=U...5. 2_P?IG]C^- M-:\(M>3ZIH%TUR'M;Q]^T&.&1B&Z\F9@?7(/7)/":=HE_$D<^DQZJOB\NWGR MMN!Y^]N+<=N_H*FTC1+ZW:WFT2/4T\6;F^T22A@,D?-O9N.<=^N!WISJ+WO> MZ?CW)A3LXMQ>_P"'8U8]&70/'6I:);WMW=6=I.)8DNI=_EF9$=@#ZD\D]^,\ MY)^B[ ?9? A/3=U_*OFSP/8-;:DOGIN:/)X/\46,X!6WOHEF&/[XX8?R/XU)\*=%?4M165QEI&W,? M-UBX*D?W>C?X_A7Q=##1JX.KB)=;GX?H=G?(GB/P*WGLRV8I%\Z. M/)7UQ,S ]?W?ID5]"^(^/!-OGDD&OF?4M)M;W5;V>.*];6E=19O:JQPPY'(X M!R:^_P"'G%9W&_6D_P!#XC/%)Y4[?\_%^IUNMZ3_ ,*\^)-A<:'>7,4.I;#< M:<9-T)SGZKH=[<6HU')N+#S-T#_Z3"I& MWMDW,A]F.1C)!XN?1+^:_OI=?CU23Q/YF;:2$,1URNPCH/3'2DNM%U"YU&[D M\41ZE-XA&W[*T(9ER,$;"O Z#IW%?KT:BNKOIKY]C\OE2T?*GOIY=SMO&VE? M\('XXL-8T.\N+1[X,9[$/NAE(GCXVGH&,S_1F!&,G*>*]*'@#X@Z?J&AWEQ; M'4 &N-/\S=#)_I4*E0IZ _:'(]&.1CD'BKC1-0N=1NW\4IJF?V-?W%URUO0[VXM9;X.US8^9NAEQ/'D;3T#&9^G1FR,9.9 MOC3:+H.M:1XDTNZEL]:3SF(C;*3*D#%=R=#EO+C]PX'7:1PEQH>H7-],,P' V[2.,@CMW]Z@ET:ZE-S+KZZI)XGC8- 65G)P05VD=>@/'' M%.,U>,W*[2:8I0TE!1=FU8]%^)AN/"'CW1?$ZI%?63L?M%JYQ(GE0S'>G8X1 MW.#_ ! ?WLB/Q0\5I\9M-.OI*-/N"ALI]NZ$E HCC8_P_O79CGJ?*]..&O\ M7=:\2:?9>(M:O(+NRMF"-81 (3'O1G [Y;8 <]B1T-:_B'QN_CWQ#HTTUC+I MN@>:L*W4QX(:5&9CCID1A!Z;R2>*N.G*I=G=_E;T,Y+FYN77567Y_>;OC>[A M\4_$K3@ M'K71AZ<)TXKLOZ^\YL1.<:DNS?\ 7W'IVD>&M9\6^#K6!1:Z!HJN9'1P^V[R MQ9IG#_,X VX#D;SEF&,+5_Q-XBT?P?X5/AS06&HW&H1XDN2?/W>:.9&(_P!9 M(X)VH.O'11D0?$K4;WQ#XMT[PA%.EG;W4:R!91\L^1(S%A_$J"/[G1F==WR@ M@OUO6]*^'GV72-$T]=3UR-P3=(CN/4>'_@W9V0FCL=1%]YME9R/GRS*618LC^)5D+9' 9< M]!5KQSXDCE^''A73[*V6TLM9MXT$!(4$!4"0!NVYG7YASL5B.<5;U#P9>^)- M8M-3\5ZC%:6G&3CIHDN[_R.Z\' M_"ZV\.2V%W:G>6B$)Y[KY2,5(9E4 'N0,D_G7O?@TYT&$_[3?SKS"V)@ MMXXV@/\ M-_,U\MC&Y1NW?4^IP:4962MH;U%%%>0 M>L%%%% !1110 4444 ?(>LO_ &CX_P!?ER?WE[,,CTW$5O>$_P!G3PSJOAZW MMKSSKEK+1O[+M)9@&\D@EEG &/W@+9Y..*Y30IOMVM7%SD'SIWDR!URQ/]:^ MAO!J"/1IF_V*_)@%<[#>37Y2SP?)@G>11_M,$ M#?H@KTKXCW0B$[L>!DUPOA"P::=69HD]9VC\MW^27S/:R MZC3C2IMKX/>^?],GU[2'TT6&H*,1R?NG]F'*_IG\A6OX1\*6&JZM-<7,\K0W M%Q;79M\C:LT0*%N>SQD(R]"H/J:]%U#P8NM_#[4XMG[Y8O-AXY\Q3D?GC'XU MYCX(U4K)'S^%=DZ57*L10K1T4TD_^W?^ 5E*C.-3!36^ MAR_@Z&.Z/DS1K+#(NUXW&Y6'H0>HKZ$TO3[6?PS.)+>*0.59PZ [B.A/J1@8 M^E?/G@7*W.QOO1L5/]*^BM&_Y%J3Z"L.'(N#J)]F;Y[:4:;7='B?CV&.*>X9 M$56*^A_AU_P D^\,?]@NU_P#12U\]?$#_ %DM?0OPZ_Y)]X8_ M[!=K_P"BEKVN&=<7BF_[OZGEY_\ [MA_G^2.AHHHK]$/B HHHH \ ^&G_)X/ MQE_[!NC_ /HDU[_7@'PT_P"3P?C+_P!@W1__ $2:]_KT\P_BP_P0_P#2$>;@ M/X<_\<__ $MA1117F'I!7A7BO]GKQ#IGQ)U;QW\,/&D?@[5M;5!K.FZAIPOM M/OW0864IO1HY .K*>?Q.?=:*J,G'835SY^U/]F[Q?XUT:R3QG\3I-=U2#Q#I M^NJT>D)#:0+:EC]GAA63Y=^_F1F8\#(.*S9?V7?&ND:AXSTSPI\3T\/>"?%= M[D:1X;N?%_BOQ' M:3Y455[X/6NV\):GJNL^&["]UO1CX>U::/=<:6;I+ MG[.V3\OFI\K]CD>M:<\TK]/D3:+=CP23]E'7O#FB_#*?P9XYATCQ;X(TN31U MU*\TH3VU_;2 ;P\'F94Y (PY_K3M._8\DU#2OBA;>,O'%SXJN_'D5K]HO5T^ M.TDM)H%.QXPK%2 VTJN!@* 2W)KZ0HI>UEW#D1\U']F;XC^*=5\$W/C?XMPZ MU:^$M6M]2M;.T\/I +KR@1F9_-+>80<9'RCGY6)XO:W^R1_;.B^+]/\ ^$K\ MG_A(/&4/B[S/[.W>1Y;QM]GQYHW9V8WY&,_=XKZ'HH]I(.5'GGC?X2?\)E\4 M_A_XR_M7['_PBC7C?8OLV_[5Y\0C^_O&S;C/W6S[5W>H17$]A-Z=^SU<^$= ^& M6@>#O&6H>&]#\(70GO;5(S(=:CSEXYF#H!N8LQ.&'S=*X[4?V8/B'%\7O$WC M_0/B_:Z9?ZPWEPK?^%([^2QM1]VVBD>X&U!U.U5W'DYKZ'UW4I-'T6_OX;*X MU*6V@>9+.U ,LY520B D#<<8&>YJOX4UN;Q)X;TW5+G2[S1)[N!9GTZ_4+/; MDC[C@$@,.^#34Y+47*MBIX"T?Q!H7ABULO%'B*/Q5K498S:I%IZV*R@L2H\E M68+@8'7G&:\^U+X#ZK_PG7Q&\6:'XTET#5O%=G86UM-#IZRMISVO1_F?$H?H M5(7@D9->Q51US4QHNBZAJ!C\X6EO)/Y8.-VU2V,]LXJ%)IZ%61XUX1^!GC*[ M^*7A_P 1UJ[\&OB.OQ>^% MWAOQDE@=+36;070LVE\TQ9)&W?M7/3K@5V=4Y24M=T))6/#?"'P&\67OQ)T7 MQK\2_&]MXNO_ _#+%HUCINE"PMK=Y%VR3N-[EY"O'8#M4UC^R_I5C^TK=_% MM=4D8SVI"Z'Y'[J.\*+$]T'W?>,:A<;?4Y[5U?QE^+2?"'2O#UZ^F-J@U?7; M/1 BS^5Y1G8KYF=K9VX^[QGU%;OACQ;=^(=:\0V%QX>U/1HM*N5MX;R^15BU M!2N?,@())4=.<)-:^%OCZT\,V'B.Z-_J.BZ MQI OX$NF #SP,)$9"V 2IR"?TV[/X$ZQ<>.?AQXLU_QJ^O:QX4@OXKB5]-2' M^T&N0!D!'VQ! &R .>]>Q44O:2'RH\6^(GP)U^\^)+?$+X>>+X_"'BBYL MDT_4H;[3Q>V6HPH28]Z;T977)PRGIQBJ.M_ +QM\0O!T/A[QU\2QK-C=:G'> M:O;V&C+:)=6J $64967*1EAEF;>S=.!7N]%'M)(.5'R-^T7\"4^&?PK^-VO^ M&M56P\,:_H1DNO"R6?[J.\7:OVF&0. FY0 R;#DC.170>#_@#XT\?6/@&?X@ M>/[77?".B+::I9Z'8:,+-[B9(P838VX)GHH 8C)Q7TS15>UE:PN17/-_A MY\&X_ OBCXCZM-J0U2'QEJ2Z@]HUMY8ME$(B,9;>=^0,YPO7&*\Y\/\ [.WQ M-^&FGR>&?A_\5[71_!0ED>SM=4T!+V\TU'8L8XI3(JNH).-Z\>]>_P"OZU;^ M&]"U'5[S?]DL+:2ZF\L9;8BEFP.YP#5#P)XST[XB^#=&\3Z3YW]F:M:I=V_G MILDV,,C<,G!_&I4I;CLMCRSQ?\)_BUJ-UJ-MHGQ6L8]"U.V2WGM-9\/)=2V_ M[H1R/$ZRH#OP6VL" 6..*SM,^ 'Q"^&NA:-H/PW^)=KIGAZQTZ*P.FZ_HBWJ MAUW%[A'61"&8L24.5KV#Q;XKNO#-SH45MX?U+7%U*_CLI9-/166Q1NL\V2,1 MKW(R?:NBI\\DO^&%RH^:;#]C5O!F@^$+CP3XSGT'QQX<%T!KL]@D\%^MS(9) MXIK?< (RYRH5OE]SS6YK'[/WC'XG> _$F@?$KX@Q:R^I+"U@=&TA+*+2YHGW MI,F79I&W!<[F P,#&(_&7@;Q!X[^*L&O?\(EJ M(O;:PLM 2VBN/W;(6=A*6\PY'/*CD!>OWJW/A[\)/^$#^(7Q#\4?VK]N_P"$ MNO+>[^R_9O+^R>5#Y>W?O._/7.%QTP:]#HH<\UY?#^QF?\ A')+M_&<]M\26\0/ MXG3Q596"1QPWK($95M=Q4PE!M*%LMU)[5]+T4U.459"<4]SR[X<>#/BAIGB) MM0\OF'*CYTT;]G;XC M?#-;W1?AK\4+30?!MS=2W-OINK:"M]-IAD8LZP2>:H9=Q)"NIQ[UW/AGX*W6 MB?&"/Q]>^)9-6O/^$:A\/S0RV:QM,Z2^8UR75L L<_($P/7M72Z-\3M&UWXC M>(?!-M]H_MK0K:WNKO?&!%LG!*;6SR?E.>!BK?@KQ7=>++;4Y;KP_J7AYK._ MFLDCU-%5KE$QB>/:3F-L\$\\'BJ02SKB58IV?&UO=20.G/-=!\//V8_P#A M?^&&I_\)+]N_X0 MGP]<:#Y7V#R_MOFE?WN?,/EXV_=PV<]17N=%)U)/0?*CC_B[\.+3XO?#3Q#X M.O;F2RM]7M6MS-=(^)/B"R\9W%S M;PZ;HPTK3392&^Z3S-C9&,;3Q7U311&;C8'&Y\C?&WX8CX2_\$^-7 M\*HQDO;33K=KN<_,TMT]S&\SD]R79CS79>'O@%XS\7Z_X/U;XC>/;7Q+H7AR M2/4=,T?3M'%B);D)B.6X;S'W% 3A5 &>?:OH>BG[1VL+E1\\67[/'Q ^'.H: MQ;?##XDV?AWPMJE[+?\ ]D:OH:WYT^65MTAMW$B?*220C @?C6[K?PR^,%O/ M:2>'?BU9E#8Q6M[#KOAY+A))E!#W,?ER)L9L\IRO%>U44O:2Z_D/E1P7P/\ MA)9_!+XRQB,SS2N7D<(.$!9CA1T&.O6N]HHJ&VW=C2M MH8 M>D%?(W[=OPD/Q1\,$6\9DU"P3SHD_O#)S7US7FGQ$"OK"JZAXS%@J>_-1-7B MT;4JCI34UT/SY_9-\;7EHVH>$/$H>TN+-7EM)IT^38H)89'IBO>]$^.OA?4[ MS^R[37[>XG63RP-C;"?0';S6[>?"_P *6.O?VBUN$:3>CP%?D<.""/QS7"2? M ?PM;:P+JRLDTV*VNEN$CCX&?3GWJ:?,K)K1'34=&K>;=F>E7>F:3JUY!]H@ MB25E#$[?E)/J/6IY[:V;_1[.)($C..5^\1Z5D>(;R#PQIB2SC>20$9.3GZUF MZ9XUO'N@L=FLT$B9#'U/O7;==C@>I+%#'J'C KJK^5! @:%)#\I/>I_B*MK< MZ7B&2)K@3*+?RAR>1VI+Z-M5BD6ZTL&15!CE5B2#]:IZ1IT5GKJ0O 4O -T/ MF-N&*M-29-K%O6K=)]2T/3[DA551N3H" ,U?\87ZQZ8+8 A-NYTSQM%9?BR^ M+:QHMW/'NPY65NG/2I_%<23S6R*I\R>)XP%Y/K5[\HTM")-"UN'2X-42[9I@ M/,%L,;2O8?E26$UGK]S?3SO+'."'6,.000.0!]:D7QZD/A"X=UV7%J-K0G@@ MC@=:;X=T :OX>@U2-&M+P99>IW@G/;ZTFW9W*C9'$6^BV7B_5=1.M6>>M=G!XG\.>")TT2RLI;JZG42,L>[+*/XF)JY>#2])A,UYJ%N;A ML!U(& W8?6LCQ#X0UB?5EU72HXS"D"QS1,26<<'(-<4](W6YTQDI-*2T+^C> M/].GU%H;R:33Y;=BQCF4D;?J*Z&PUO3U5=4M%%S#-)M66W._ ZPZHNYKZYDFA@D/$*\D ^E94JDI2U6 MA=2E346XO5'?:9X.M+WXOZ)XF29(Y%G2-E"-EL9]J^JD.44^U?.WPZUM+[7+ M2*6TB:07(+M$$VO+G#*K$*A. M"YP?E'N:^1_$FL6NN:&NI7%DT5U;A7MI(BK21/D@#/0<'D>E?2W[26E-J?AS M1S]LAL8H+[?)+/C;MV$8Y^M?(FL:;HUAI]QX5TE?[6UC[0\L<]S(423<"2ZG MD' '2L/=51M^7W&D4W%6/D3XZZMK6K_$ZYN=<=TW)#$8(#L\Q O4-TQSTZ9K MC+J2RTV^/]G%O(6XP@GP[,!POB34[/3U\F"ZF9W:24!5SG(.YL $DD>V*]"\&>&;F\UAKBU M6V^WP^;;"-FP'PN\%I.^[I^)KR!XI]";S)3);@L@2;^'H21GZL,U]&_![P'? M:EK5SXET^2&W\,VBJLL]WGRII/XMOL 6Y]2*RY)<[ET-93BH'YK36;:77#K>GEKZ6&9%MPR\(F<[AM 'N:YGX=_#/PKX!\>CQ99W&HR6T M >."U$1>*!@NUB[CMZ$BLSXZ?%2?P?J.B0>&IX[F"]@8"%8MR [^ N>W3K7$ M^%_BMJ?B2+7M.N+::RU=K.1=MOA5E0*"R8!'S8WN] MM#TWQ[^U_H>LM<:98Z!_;R$O8R+-ZGX1N=6\#P:QH; M/J6GW%Y*L-G;(S74Y(ENK4N/WG7+J>SC)_"H]I&-HR5S;V$E%N#- MGX$^.V\%:ZUQJ%S=ZI#-'Y26X#M_N[1QGUS7W1\._$-A?Z5$UO)'/&$ MYW-G;['WQ7Q9\0GL-3TRV\0:;=QB":0L+B),>="PX&[OQ'>$1P!D0 MHASD%L9_+G'M7Y[?M*>%M&\3?M#>(9M8>"/C!I?P^M; M'5O#]D^K7$!,UPUP/+**^ R;LG=G;G\33HU)0=VK+J=-6E"K#W'=GZR_LLZB M-4^&#SB19%-_+@JH4#Y4/0=.2:]@KQ#]CWQSHWQ%^#<.MZ)8R:=;37LPEMY$ MVE90%W<9Z=*]OKZ:FTX)QV/F*J:FU+<****T,@HHHH **** "BBB@ HHHH \ M_P#B4VV]L_\ KF?YUQV^NM^)[8O[+_KF?YUQ7F5[V&7[I,\'%2_>M'*_%F>Y M7PDR6S*HEGCAVVL3QE9R^.?AQHFHVL;R2I&LLBQ+ND"2 M0M')M7NR%]VWJ3'BNYUC3[;6]-N;"[3S+>X0QN <'!]".A'4'M7DWBKPE=_# MB$:WIFNW[H9L2I<2_NT=CE7** A5GP'!7.'+ @CGVL-*+48IVDFVO.YX>(4D MY2:O%I)^5BU<^+=,^(:V.C:_8ZEH=_'B(7S1JJEW&P_+(-WEN> 63&=O1L5& MFH7/P@\76=K?ZW>7^CW(R9+V5Y79"""=O.&C?9]T#*N>,KDYWQ"\6Z?X\MO# ML>ES1Q7\V[S6<;3 K*"4.?\ :VD'L8QBH+/3_$6N>+9KJXAB\1R6,2PLP9(T M^8L1C) )SG/X5T.<5'56B[W79^1BH2YM[R5K/R\RKXJ2+QWXTU6XTB\BMK", M1SFEP61FU>QAFU"65I6$;L%3.,+P0& QW&.37=0JEO$D4:*D: *J MJ,!0.@ KB>(ER**Z:'>J$5)M]3S73?A'J5A8/I8U: Z7,0TK>3F;W [?\"S^ M%=-9_"SP_97"R1PSF)6#K:O,3"&'.=O?Z$D>U=1YGTI/,KF,YQSZU7\RCS*SY44I-%D28Z<4@8#.!CZ57\RC MS*=D#FV86N>'9)]9BU6V*R2!0DD+G;N )P0>QY_'CD5%X_\ &RZ[X8M-'MK. MX@,5UY-R\NS (^;:"&.>@YQVZUT8D!(KD396\FMZKI]T3&MP4NX),@$,!AB/ M<$?EFO@L\RRC&2E22@ZS<92\^5V]-58^SR?,:DH\E5N2I)22\KZ_@[G?_##2 MTTO29;UUQY:RT2[#/#NAZCX5N]UE2%900=F(;>ZT=YK6""Q<1F:*!M\F1DD9QI7C5Q_*\-436GNN234K:Z.U]=K7.16'XRZ#MQ=^#_&,:@Y\V"XTJ M5CVY#3J/RH_X6MXXTILZ[\)=7,2KEI]!U.TU!,^@5GBD/_?%>C6.HPZC:1W, M#AXI!E34_F BOK(*-2"G!Z/;K^/Y'S4Y.G)PJ1LT>9_\--^!;//]MSZKX7D5 M0SC7]&NK14SZRM'Y>?HU=CX<^)7A3Q@N[0_$FDZN>,BSO(Y6'ID!LBMO>,=! M_*N-\3?!_P "^,69];\(Z+J0#[\)^)HQG=)INISV,A';$VH0R* MY901\P7[WOR*S-&3P_X,UO2KZ2YEU.T?][-;H,GS0"4..^&.<9QG!Z@5Z%9? MM)_#FYF\B[\2P:)<[0Y@UV&73I #G&1.J8Z&M'6=#\.^/]'4Z'?::95E%S%= MZ>R2*S $?-L/S @GOWS79'%-WN]SCEAUIIMT[G.?VS)\4OB%IIAM);*#2V$J M/*NV2- Z.[Y]7*)& ,X7>3U J]I+1V?QTO\ 9LO+:='VL>6MYS&C28]1MCC! M/;>HKFO%NA:WH^NZ;=:CJ2V=O>/(W'56LEUW.+D:DN;1WNWT-W3+ M.7XI>-=3.I7+I::9(T3VJ,5:,;V01#^[N"%GD'S'<%4@ Y]9L=.L]+4BSM8K M8%54^4@7(50J@XZX %>8_">&?7-I+GH M17J'F5S8M^\H)Z)+[SHPRM%R:U;+ DKU#P(<^'(._P [_P#H1KR<2=/K7JW@ M$Y\,V_\ O/\ ^A&O#Q:M#YGN8-WJ?(Z.BDS1FO'/9%HI,T9H 6BDS1F@!:IZ MQ=_V?I-[==/(@>7CV4G^E6\US_Q#F:#P)X@= 2PL9N@.?N$5$Y#$D2]< "OHWP^GE>')FZ94"OG_P #1;ID)ZYKZ#M/W/A=NV?\*_(N M&E=5*C\S]*SW_EW'T/"OBC=;[B.U4Y:5\D?[(Z_K6)H_BK3O"NL:=::I%=VZ M7BLT5U' 9HLKRP;9EEP""68!1DJQZY8W'@ZRO--O(;VSO(5N(9H6#+)&PRK ]P1WKYZ9OC _NGG].1^%87C'X;W/@K6]1TZV74IKF^NK*&SU8!FVV,((*[XF18&0 MRR%592I4+PS%B-75H;J\N9]2CB9[>T*K/(/X-Q^7/U(/YBO6XB7M7&A1]YI- MKRY=;_-71YV1MTTZU31-I/SYG;\['N_PZU=7"HS###!!JK\1-' :3CZ5R'P^ MU?;)'ENXKU;Q3;+J>CQW Z[>371@Y1S'+'#=HQQ<7@LP4UHF?/>@J;'Q2(2, M"<8&?4<_RS7T1HY_XIJ0>U>#0K!=^+XGA82):LV7'0N01C\C7O&C#_BFI/I4 M9'3=&4J=3XDG_P #\"LWJ1JJ,X[-K_@GBWQ!_P!9+[U]"_#K_DGWAC_L%VO_ M **6OGOQZKS3F-$+R2-LC11DNQ/ 'OFOH[PAITNC^$]$L)QB>UL8()!_M+&J MG]17J<,4YK$8F;6CLOSN>?G\XNA0@GJK_H:]%)FC-?H)\6+129HS0!X#\-/^ M3P?C+_V#='_]$FO?Z\ ^&G_)X/QE_P"P;H__ *)->_9KT\P_BP_P0_\ 2$>; M@/X<_P#'/_TMBT4F:,UYAZ0M?'_PY^$F@_M0Z[\4/$WQ!?4-2U&P\27FAZ5% M'J,]NNCP0!0AA2-U"N2=Y8@Y/XY^O\UXAXO_ &6+#7/%.NZUX?\ &WBKP)_P MD)#:U9>'[J-(+U]NTR8>-C'(5X+H1GZ\UK"5KZV(DKGR;X1\.V/QR\4_L^R^ M-Q=Z]>3SZ[HEW?M?W$4E[!9[Q Y:-U(;U9<%OXB:_02[B@\#>![A-,MV^SZ1 MI[?9K=G:0[8HSM4LQ+-]T#)))KBM*_9P\'Z!?_#NXTI+S3HO L=Q'I=K!*IB MD\]-DC3;E+.QY;(9>22NEM3DUR/5KB&6U?S6VQ0JCA$1 H7;M(X.?;SCXN M:)X;^)=M\2_&'@?X5ZUKEQILUZ9?'UYXIDT\6UW"I+O:0[V+K&5X 10<8KZ& ML/V1K+P]>S6_AOXA>-/#'A.>Z:\?PQIE]&EJKLVYDC8QF2.-CU16[GIFJNH_ ML8:'=R^([*U\<>,]'\):]-/=7GAC3-02&T\Z;_6,I\LN%).2F[:3UR.*U51* M5[D\KM:QY.VDO\WS)XW M=D<@G?G P1Z<5Y+HWPF\^(?C#QMHB6DMC%HFNW<3VAAD0QL)0D M:F5@I(#,>/K67H?[)G_"-BSTW3?BGX^M/"-G(KV_AZ/48A%&BMD0B;RO-\H= M-F[IQFA5$MW?[P<;]#SWX7_"JV^*GQW^,]]K>N:\;?0_%,$ECI5MJ4D%FLPM MXW61T0@O@@#:3MQGCDUYYX8\/Z)\,/$%B_QQ\">+[#QC+KH*?$VRU&6XL;B1 MY\P;G27]TA&U/+9",=0.WV9X,^$NC^!]>\:ZM8W%]-<>+;X7]\EQ(I2.01B/ M$6U057 _B+'/>O-XOV1[2ZGT^SUWXB>-/%'A33[J.\M_#FKWD4D!DC;=&))! M$)9$4@$*6[#.:2J*^KTT!Q9Z;\9)7@^$7C>2-VCD30[UE=3@J1 ^"#7QUX5\ M*0_%3Q9^SCX?UW4=6.D7GP_GN+VWL]0EM_MFWRODE9&#%3GD @GUQFON+Q/H M%OXL\-:MHEV\L=IJ5I+9S/ 0)%21"C%200#@G&0?I7 ^%?V=_#?A#7_ VKV= M[JLMSX0T230;!)Y8RDL#[(+72KDSZG)JUQ*VH,]NZNTZLY1\D[N@P0,8KMK_ /9Y\):SK'Q" MOM32[U./QS;6]KJME<2+Y"I"A1/*VJ&4\YR6/(!&*Y[PC^S))X9N;>.[^)WC MC7M$L[>2UL]'U"^B,$:/&T?SE8@TI56.W>3@@'!Q6CJ)K1V_70E1MT/!/V?+ MVXAUK]DVW2>1+>7PMJYDB5R$V'AG M1_L;%B5MGD+1F55Z C=N^H%>R:I^R3X>F\$^!-"T?Q%XA\/:AX*1X]&\06,\ M0O8T<8D60F/8ZL.HVCH/?,_A7]DSPCX>?QG)J&J>(/%DOC"PCT_69-?O1<-. MJ!AN!"*58[N@.T8&T+BGSPOS?UO<7+*UOZV/ ?C!^S?X,^%G@_X4^(M*BO[K MQ-=>+=%6_P!9N]3N)WOV=]SO(C2%"2W(.WCM61\8=4U ^#_VG4CU&\MVC\8Z M1%#)#.RO"K?9P=A_AZGI7NUG^Q9I+C0(M:^(OCOQ#8>'KZWO=(L;[48C!;>2 MV41E$7[S@;)]/\>6=UJ&LQQ>,M4MM6U PS1!HI8-FQ M8LQ':I\M>% M+R2]L4MW18Y'>(QD2@H21@_PE3GO7R%\7?AUHE]K?CS2/#GPP^+L6KZM/<(N MFZ?-+;^&+^Z<%5O)&641[,D.=V!Q]TT0GS==>_S"4;'U%^S!<2W?[.WPXFGD M>::30K1GDD8LS'RQR2>M>%_#WX8Z#^TCKOQ5\7^/Q?:OJFD>(;S1M*M%U&XM MTTF"W4!/*6)UVNQ.XMU/YU])_!_P;-\//A7X2\,7,BRW.DZ7;VO2&,;6N&CD50,G:Q. MWH3SFH@[RE8IZ)7.7\&:MX9\0_LO_!GPOXD\-:W\1_$>KSWLFEZ!8ZD]K]I, M4LH>2XF,B 1HI'WB><<&J7A/PG\1()OCI\-?!>C3^ ;MM&TZ_P!-\-)XA:]6 MW9W83"&Y;'E&5%(X. 2.?3VCP)^R&'^"7PPTG5-:U3PEXW\)P2RV^K:!<(); M5YR6FA)965T^8*>.=O!QUZ/3/V0-!TR7Q->CQKXVGUWQ#;VL-YKS_JY/*]#P'1] ^%*_"EU\./%WPP\:S> M%KZ9M+U:^N/LNJ+$F]I$E69EE9'0-N^4GD'()%9^J_##0? O[ .F>)_#L=[I M/B'6[#1Q>7\>H7#DEKF(DJCNR)R>BJ!VZ5]1>$OV9[#3/$DOB#Q5XL\0?$'5 MQI\VE6TVO21!+6VE&)51(HT&YQP6.21Z5A:=^QSI5OX O_ U]X[\6ZIX0D\@ M6.FW$]O_ ,2](9EF18W\G)Y4+\V?EX&.M+VJ[]4'(^QQ?Q2^&%C\(-0^$?\ M9.KZ[J%YK7Q!TR34KW5M3EN9KIA'*.'?VH4\:^./ MB+_:&MZN?$5]IEA NI7%NFD6\#[(TA6)U"M_$6ZDGZY^C_'_ ,+-)^(USX3F MU*XO8&\-:O!K5H+1T4231!@JR;E;*'<<@8/N*\_US]E6SE\4ZWK/A;QYXN\ MQ:]/]IU;3O#]W$EO<3$8:5!)&QBD;NR$9J%4TWL^Y3CKMH>SZ/IB:+I-EI\4 MLT\=I D"RW$A>1PJA078_>8XY/-Y/YC7(V;[BY;GEB3LW$ GYJN M_MF>'=4\6_LU>-=)T73KS5=3N8(5AM+"%I9I")XR=JJ"20 3P.U1%)3CKV*> ML6>-_$OX3:-^S_??"CQWX/NM6A\4:AXCL-+U6XO-5N+E]7@N 1*LPD;?%K2_#_CCPC\0?B'\/?A;K=Q]BFO+J/XBWOBF2SDCN(G)>6VM][, M\:L" NU00,<&OJ/P5^S%;6?B+P[XC\4>,O%/C6;1$$NDZ;K]Q$UO82E,%]J1 MH7D49 9\D?7FL2]_8B\/W>G:YH,7CKQKI_@G59)YF\+V.HQQ6D,DI+/L/EEM MFXE@C$KGJ".*VC4BGJS-Q;Z'G]_X8A^./[0_PXTWQ5?:G-I=]\-HM2O[*ROY M;6.]D,J$B7RV4E26R0",X';BN$UC6-5^%6C?%+X9>%=9O]%\/-XYTC0K&X%T M\DNE6E[&&G6*1R64?*0#GC<>]?8N@_ W0?#WCG0/%5M=ZB^HZ+X>7PU;Q2R1 MF)[965@[@("9,J.00/\ 9K(UO]F'P9XD3XA1ZI_:%[%XWN+>[OT>95^S2P(% MB>W*H&0C ;)+)="UKQ-JWBWQNNC: M+>W]SK#"1+><*S16Y8B.W) \M7 & V2<\U[W8_LN--I>KZ;XB^)WCCQ5I]_I MD^DI;:C>0!((95VL^%A >4#H[AL<\!GDUXW\1]/TU?AE>?%7X; M?"W7- MH+R.]LOB#J?BEX[R8&Y53(+3>Y>-R2NUMHP5J$$+919%DC;!'(W+@X-0:A^REX,U/P5KOAN>XUB^-_%WC_Q5K=BNBVBZQ=1+#9Q2R*KS*D:( RH68N&;)FDMM+LX[59')+2%5PSD^K')/UK"6NM[FB[6.BHI,T9K,H6BDS1F@!:*3 M-&: %HI,T9H YWXD_P#).O%/_8*NO_1+5PW[)7_)M_@#_L&K_P"A-7N44F:,UYAZ0M>9?$D'^UX@O>/^M>F9KRSXLZG;Z+*]]=.([>"$N[GL,TF2 MU<\R\8:?,LL=Q'-L4'@$]\5B:89I5A%Y.L\?W&23DO\ C71Z_+#JVE6EY XD MAEVRQ8R R'H:Y&^O8[6":+R'EDWAF$8[9X_3-=5*3:L@:MH:NHI9ZQ;B"Z3; M:+N&['"MVKCPUIX> AAUJ%-A)"LF<^V:UI99=7$&AH#;RR2,[/W Q3_$,6E^ M&](>TC1)+N1=H!Y8]B:M1:=AICK?6];M[%HU@ANT?E)8W Z\U3MAZ6&8MF-">7V^5$S&?X5%4+[P M$E_J<5\NJQ"9#M6,,,'VQ3O$CZAX.L?/U!X(X"WSR[]J@4E4BM&5R-[&[;PV M=U/(C6JR27$VUI'0%9/>NDD-G9'["T@1O+)01Y X/08^E) M'$P7R57D#('3\Z=8^,/#^H:G!;K?"-S\JF0X)/M4U91;M<482EK8Y#PW%:ZM M!XD%[:"6[^WR$02@LQ&X[2N?PK:U_7KW2/#VEP7$K0QL +AHSAD'0 XKF)[2 M6W\0>*);K6GCN+2?S8(8\95<#&?45!K%W!J6CO?W=P;>:>&KX)=6 !GMYP^6 Z\FNL\N?05Z) [W%A&P)-IY&:F"]UJ^IE5E:7-RZ'"? +QA;:'X[L[-A<3-K%Z(T1U(\O!.2:^X4QL7' M(Q7SQX*T6QLO$VDM);QB=9AY9V#*\]:^AX_N+]!6D(N*.6I4567,D>*?M5O9 MIX1TBZ=H]S=&,$71"%P3@[#G '4XKX@_;AU--)T;0ETM8TUO59 MI((VC;8"FT%^.V?E'XFN'$2<9;';ADI:,V=1_:W^'OARU?[-;W'B#7+B)?M, M]M (D#9P%W'@)+^ZG\0:"4BDN3%$^H+%,(9L XRHSM/][FOG M'3/!.KR7$4$=G)#/=N2Q="J-AL[/3(/3'K7K'PL^ 6L>-;^[69%3^SSYABN> M5D9 ,J>^#FO*G4DI*,)7?4]:%&'*YR7H>B?#CX'E4.GDS M*T+MO ).!@DC)QQ]*]NU'P[%-<:IX;M)-.LK%H$GALA%ARX.3@< C;@ =,U\ MN?"=);;X]3:.4GT;2;U&86]K<&,,\:G!XZ@E><>M?5/@?7+47-CIUC<6\5S: MQRM<65[F:4J>5*R$D@=\'UKT*$X5+R:29Y]>,Z;4;MH\X^+/P=LOB#8Z9?:3 M;FQ$%L9)6**A !Y) S@@C.!7GG@#]G>ZU3Q*_B2QULWWV6YB C@#1&0C&?F/ M48_G7IWQ/^)W]C>$-7N;9]1T[S+<2-:VT)C5&+X&"1C#'&1[UYUX#^+OB%M- ML;^_T^2VWQF%_P"SML;21'T4\*>.OZ43A2I5'S]/N'3G5J07(M=O,R_VCOA= MXE^&]M>Q>&[-+_P=K12:Y$<>_P BX!&X]> VU>G'%>'^%+;1O$LNK6GB(I"S9:C"M:MX;JSO3)%!-$ )+ZMY5 M8.02R+@ MUP#QTKZ!U[P)<^*OAX^KZO!;VUZDF^.:*+&(R,KM4=2V+]NJ4DHO/=<\<_!=[^SMI))K:!O"WQN^%4EJT3Z?J$X_\$WF1OV _L2^!=4^'7P5&CZ MNL*W2ZC-(%MY Z["L>WD=.!G'7FO?ZUID%K"L7DQ6D;_-G/WRR]#QV/<]*[ MO2=*LM$M1;V-LEM%G)5!U/J2>2?K3]]+YGTIRO-WD.+459%C?[4>9[56WT;Z MFS%S%GS#Z4>9[56WT;Z.4.9EGS/:CS/:JV^C?1RAS,L^9[4;_:JV^C?1RL.9 MEG?[51U+2K35@@NH1)L^Z>01^52[Z0M6-;#T\1!TJT4XON;4L14H3]I2E:2V M:);:&.TA2*% D2#"JHP!4N[VJMO]Z-]:1IJ"48*R71$3J.J:>!A%D$\:^BL.0/8& MM\/[5E_84&J"^#$2^5Y3 'AAG.:M[Z\G+<+4PE&5">RE+E_PMW7YV^1Z.88F M&)J1K1W<8\W^)*S_ "O\RSO]J-_M5;?1OKUN4\SF99W^U&_VJMOHWTCQ MN0?).JB]A&.VRZ24 >PQ7.7OP?\ B5I&KIJ>B^,]#U:15\KR=9T8P9C]-\#@ M9]_+_"O;]_O1O]Z:IJ&L-"G5.^%=0^*'P^LI;?4O NG>((Y;AYY+CP M]K(W#(&,17$<791P&_&MD?M 6-B%_M[PAXQ\-C!+R7FB23Q)CKNDMC*@_.O2 M=] ? ZU#A.]^8:J0ZQ.,T7X\_#S7Y5ALO&>C--RK#\17TG\ M,[N&]\)6TL$T<\9=\/&X8'GU%>$ZSX5T3Q) T.K:-I^J1.,,E[:I,I'H0P.: MUO"?[)'PPU;0X;^TT2Z\-:@68?:_#.IW.E2 D#'V>1!Q]*X<8I*GKW/0P4H M.I[O8^BJ*\,_X9V\6>'_ )O"?QM\:Z?C[L&N_9=8A'M^^B#X^KD^]+_9O[17 MAL?N=:^'_C:%?X;RQNM(G8?[R/.A/_ 5'M7BGMGN5%>&GXV?$_0./$?P,U>> M-?O7/A76;/44^NR1H9/P"L:5?VQOA]I[>7XGB\2>!YNA7Q)X>O+9%^LHC:,# MW+ 4 >XT5P_@_P".7P[^(*QGPUXX\/ZX9/NK8ZE#(S?10V:[B@ ILD:31M'( MH=&!5E89!!Z@BG44 >/:A\%+C0]1:Z\//%/9$[OL-PY5T]D?!!]@V/J:=JGB MN>+P]K>GP:/?_P!H:5 TEPI$96/]V64DA^1@=LFO7Z\]TFWBB^*WBK3YU#QZ MC80W&QNCJ,QMQ^('XU\]6P>'PM2#I02]I*S^:;_-)'M4L36Q,)>TE?D5U]Z7 MY,^>_!U@USQ.2W%[5=+T9YRH4XP..]< O@>3P-XA^QW7%C M+)BSNV^XZY.U&;LX&!COU'?'H/B2[&EZ/%;@X^7+8]:^2RO+ZF6.M4Q'Q*^O M<^FS#'0QZITZ.SZ=CRSQ[J^6D&[J:[KX.^!;2Y^&TXU2V69-<8S2(PP?+'$> M/3IN!'][->6R:->>._$T&D62L3*P,TBCB&//S.3VP.GJ<"OJ.SM(K"TAMH$$ M<,*"-$'90, 5WO5QU9;^ZO3=G'G>(C1HT\)2>VK_0\M@^ <.F7)?3M MV05_E1X]\+7?AKPQ%J3:I=:K;6,\'A\17Q6(IPJR&S6WF,:^7 ,>V:](TNT-AIEI;$ M[C#"D9/KA0/Z5Q/CB*Z\+^*M/\7VUO)=V4<#6>HQ1#+K$3N60#O@]?:M,7'V M=.%=1L[KFTZ=?N_(SP\N>4J-[JSY?7H;>@_#S1M O!>1PO=WX&!=WC^9(O\ MN]E_ "NEK+T/Q/I7B2V2?3+^"\1AD"-QN'U7J/QK4KTZ3IN*=*UO+8X*BJ*5 MJE[^84445L9!1110!X!\-/\ D\'XR_\ 8-T?_P!$FO?Z\ ^&G_)X/QE_[!NC M_P#HDU[_ %Z>8?Q8?X(?^D(\W ?PY_XY_P#I;"BBBO,/2"N?\2?$+PMX-N;: MWU_Q+H^AW%S_ *B+4K^*W>7G'RAV!;\*Z"OA;X<^$O&'Q6\;?&2]_P"$8^'G MB:^/B2ZTNZ;QB]P]Y;VR +#$BK$X2+9RN",G)[5I"*E=OH3)VV/L[Q'XW\.> M#K&&]U_7]+T.SF.V*XU*\CMXW/7"L[ '\*63QKX>A\._V_)KVF)H6W=_:C7D M8M<9QGS=VW&?>OC;3_V:OB/X)?P1JATWP=\7;WPUHL^C7/AK5+T[((VN7DBD MMI)HR VS$1+J.$P,]L_PCK/@WXS?%;X0:#)X+@\*^#(Y-!6OLENG']1R MVZA?O$R*2HQWYXJO:?$3PI?ZY'HMKXGT:YUF2,2IIT5_$UPR$;@PC#;B,T+2_ 'Q,^./A_PA9V^E:#?_#274M4TW3XQ';17@9TCD\M<*C-&3G M&>M,^*'PJ\&>!?V1OASXE\->'M-T;QM%/H=UIVIV<"I>SWDKQ;P9?OON#/D$ MD8'M0J2=M=PYV?0?@C]HBRO?&/Q,TWQ?J6A>&M-\-:Y'I5A\,:7%J>LZ]IFDZ;-CR[R^O(X87R,C#L0#D<\&OES MX2?"+P7\0/C-^T1J'B;PQIFOWD6NK:12:E;+<>5&UJA8('!"DG^( '@<\5P/ MPO\ %B:A\"/@EX$B\&:'X[\4:I7Y I-;GW+X=\5Z)XOTW^T-"UC3];L,E?M6G727$61U&]"1G\:R].^*G@ MK6+]K&P\7Z#>WJS"W:VMM3@DD$IZ(5#$[C@\=:_/OQS!XH^&4O[1.E[- T.> M71]%EO[?P5!):V4$4LYCF=48DJYB)W,,9SG%>Q?&SX?_ U\%WW[/;>#]&\/ M:==2>+-.%M:/9)==_\KASL^JM?^(GA7PG MJ%M8:WXFT?1KZYQY%KJ%_%!++DX&U78%N?2G>)_'_ACP3'#)XB\2:1H$%_ASXCOK_ ,1:AI^HW'BQ[EM1 M@",4CB 6%Q&BIM*!2/7K726FB:W::AX ^#[^$?!'C_XAZ!X;:YN_$GBK?<6% MG:>>8U2)3'YDCG:H/W<;>31[))VN'.^Q[M\>OC8WPZ^"=YXZ\*2Z7KP2>UCM MY3)Y]K*LMPD3$-&PS@,<8/45ZW7YLW=A>Z!^SK^T!H5XNE0?V=XYLE%IH,;1 M:? S2VS.L$;$E$SVSUS7Z+2^(M*M];@T:74[./5YXS-%I[W""XDC'5UCSN*C M!Y QQ4S@HK3^MAQE)]&UF>T!-S M%I]_%.T('7>$8E?QKR#]N;4;NP_9^OXX;B6TL;W4K"RU.XA8J4LI+A%FY'0% M3@^Q-<9\=_AWX1^%7B[X'ZGX#T+3/#^N2>)[;2HQI-ND+7EA)&PG238!YB[0 M"2V<=<\THP36O4;E9GU+:Z[IM]I/]J6VHVEQIFQI/ML4ZM#M7.YMX.,#!R<\ M8-<_JGQ?\!Z');QZEXV\.Z>]RBR0+=:K!$95;[K*&<;@>Q'6OC'7M0OO >F> M/OV;M.D>#4/$'B2&'0,=4TF_)EN&7_9B"3J?3<*[?4M B^(?COQGX6\"?#/X M=O9>$(+;1=2\0>-K5KF68K;C9%#%&NX(B #<7 )Z5?LDMW_PQ/.SZUF\0:7; M/9)-J5G$]Z"UJKSH#. NXE,GYL#GC/'-/[K4_B+8Z5IJZ-?^&+C39+PZ MI!JT;W'FK)LVK ,ED]9 < \5\+_#OPO8?$;P?^RMX?\ $D9U/2Y=1UZVEMUF M=$DBCW[8\AMVS"@;W\4(B=AE5;TGTV"W_M.V6X6)7M!OVHX*@G:/FQGWH=** M5[_UI_F"DWH?5EG>0:A:PW5K/'&AR^,= BUHR>4--?5(!& MS<#5M>TS2S;PBXF%[>1P^5$3M#MN(PN>,GC-?!OQ-M[CXQ? WXD^.O#?PY^' M7AOPANOY1JNJ6SS:[=2Q2,'N%= HBD+J=NYF(]QU[GP1X(T#XH_M/^%Y/%VD M6GB3R?A?IMZD>IQ">/SVDP9&1LJQ^9OO XSGK6SI)*[9GSO8^PM*\0Z5KFD1 MZKINIV>H:7(AD2^M9TE@91U8.I*D#!YS7D7B?]H_31\5?AMX8\):OX?\26/B M*^O+34IK.\6YDM?*@\Q=IC?"DG(.X'BOE;Q+!'X9\$?%3P7I[?V/X+G^*UGI M5W;VI\J*VL)Q&TT:XP$1C@$# P<=Z]G^)OPS\%_#S]I']GM?"_AG1O#\TE[J M,4ATRSB@>6-;3Y0Y0 L 2>3GJ?6FJ<8O7S_(.9L]S^._C^^^%GP=\7>+M-@M M[J_T?3Y+N&&[#&)V7H&"D''T(K<\*>++;7=)T4W%U:1ZO?:;#J#6*2@2!752 M65"=VP,<9_6O//VQ?^37?B9_V!9_Y"O./ KB/]K+P$&(4R?"V,)G^(B>,G%9 MJ*<+^I3=F?2MQXLT.T6]:?6=/A6RD6*Z,ETBBW=L;5DR?E)R, XSFH-)\=>& MM>UB[TG3/$.E:CJMG_Q\V-I>Q2SP^)/PR\*_"GXY?L^7'@WP[IWAN>?4;S3YWTVW6%KB$V MC-ME91F3D9RV3DDU7LEW_JUR>=GTAK/Q'\)>'=7CTK5O%&BZ9JDB[TL;S4(8 M9V7U",P8CWQ6W97UMJ5I#=V=Q%=6LRAXIX'#HZGH58<$'U%?#GPP\*^!?%G[ M+_Q4\7>,M-T35/&T]SK1U;4-:ABDN;:Y0R+#&&D&8]H$>Q1CMBOI?]EC_DV_ MX:_]@&T_]%"IG!11497/4Z***Q+"BBB@ HHHH **** "BBB@ HHHH **** " MBBB@ HHHH YSXD_\DZ\4_P#8*NO_ $2U<-^R5_R;?X _[!J_^A-7<_$G_DG7 MBG_L%77_ *):N&_9*_Y-O\ ?]@U?_0FKTX_[A+_&O_29'FR_WZ/^!_G$]V]G:[G@D&0XW?RY%>[UXQ\=_#5KXPL[[1 M;Z,26E]9O#(.X![_ .?2DRHVOJ?+>DZW\1O'_AR/4;>[TZRL+I!-#;1 ?NH\ M951CGH173>$O&&H^'[8VGBJW6W^7"7T:;MW;G\ZXKP9JVK_L[7I\*Z]97.JZ M)&"MCJ,2940XX#]P1QUKLM?\7Z=X_P!"%II=K)IM-=MC; M\03[K,ZC;EA/:+YBO&GWXFZ<]^UZI/%HVGB62%@)9"Q"J1P:Z$VEH:Q;S2*UC"I.]/,R2<=,5=MKN.U2\\JR1;N M'?&'QGDJ,?UK)O=6LKC3;<6T3*CO8OZMIFEP2116]\ M+6X<$B1OX2.YK/O? LOC6S^SWFK_ -JZ8B@2>4.[O[)"\>BB)E2$MD9.,;?6L^939T\LH*YWWB MO2/M.A6<=E:F-(1M\@\]!@?RKSVVT*6&2X?R7-^$Q#%+&0 _4$&O;?M2W&D1 M3WK*LD8W*/N[N*Y'5O&$MW9K=_N8S:_,MN@!>3'TZUC5<4_,=&!K# MQ!96ESJSW%CXCN84$XLV/0<[6]\5OIH7A35[O3;:K%?&+<3))'&=&/FW2-P,UYM\9[JXL6CNTMFF MM$VO-8TVZ247:"0!'1MV,'N:][ MC^XOT%?*G[,FC7.EZ38BX+0BXNS+%$QR%0]!7U6G"+]*WBVU=GGS2C-I;'EW M[0/V2'P[IUY>;A';7)<.N?E)1ADCOUKXG^*FL:#X@^*$5EK\D'D06"/%%. 5 M8M(=^W/?Y5YKZ=_;-^*H^$^G?#^]N=O]D7^O"QU#>NX"%H7R2/8@5\*_MJ:* MUAXY\+Z^&V6=QNMFGC7B,;@5/_?+@_05XN,O[1\I[&"2LN;8^F?A_O0]%\'Z+!?:GK$,WE&* 121(P6,+MR-P]<' M.?>OS[\'>,)/A]K=A>I=BW<,8OM*J^)8'&'(!X Z=/0;NE8]6O2>K4M#3O/'>G3?M%>%;73+ M0-:V5TV^X7EI-V5P!_=&3]>:Z2^\(:H^M7/CS0M2%P_]I+%);H""H)/!_4?3 M%?..B>(KGP+XA:_>S83C=.C,P9L!63&1P/F+$5]F_LJQ:;K'@G6=6AF-Y%*- MGEN.I&6Z>H/%=<5*+E;3_,PJ-LX(WTZYF MN?.:9.JH6VM^18?F:EA\#2:GX]6"T,9CMS&L5P&W23+M!W-Z'/'TKT<7:5)5 M%&[V9Y^'?+-P;LMSVKXA?LQ^&O$-H6LK..*627S5C5"1OZ\'MTKYON/#7CGX M"^,)M;M8I+>R>01S6UP"T#(>IXZ9 [=Z^Q/%WQ-F\"7%A$FE2:E&Z(MQY3'? M'QV&,'CWK4/B7PSX]TVXL]0A:*V>(.\>I0F'Y2<9&X#O7%=).,78U4Y:2FKH M\.^'G[1%A\2KK3;*UNK#2KR*9DO-/O"=TB;>#"W?Z'FNQ\2ZMIVJZ%J,FFZK M:W B"B>&4;TAVG&X #@CK^%<#\3_ -C#1I\:GX:G-M,)A.)(I-I4?[!'?IS6 MSX;\(7_PV\%3V=S=M&05G:[*K(^,$!9?B'X(&C:^EC<6$D1>.?3QLD\Q@=T@]#G/3CFOD7Q1\*_&_P"S5XYO+G1M M=-]9F/J]"1@@^]?7_P#PF&AFUNY/"5]:PW$4!,%Q=';8K(2N4=@< M*?8C@YJSX@\/S>)C:SZYH,6J3&-(XY+23!!.1(>?X1U'UJZE*&(5X[,=*O.@ M[2U]3YC\"_%FQN%NM&O[QH([]2$OKZ$QM$K'G&!USG!%?0G@K3_%V@76@'[& M+OPPMPDRO:L)?,4YPY(Z\']*\P\7_ _3/$MM+/X=L%T2\B:6!)-9D"R7;*O3KTL1#1V]=V?HC^RRM]'X,\21ZC$T5U'XCO58.VXD?)@_B,5[-7S[^PZ MGB9/@G?] M<6_]"KSS?[_I7TV$5Z$3Y+'2MB)(L[_>C?[U6W^_Z4;_ '_2NSE9P\R+._WH MW^]5M_O^E&_W_2CE8&^9UYKV_X7'/@ MZU_WY/\ T(UYF/5J7S/6RV5ZK]#K:*3-&:\ ^E%IK(KC# ,/0C-+FC- '"^, M/@/\./'[._B+P-X?UB5_O376G1-*?^![=WZUP_\ PQSX"TOYO"UYXI\#2C[I M\.^)+R&)?I \CQ#_ +XKW+-&: /#?^%,_%G0>/#OQVOKB%?N6WBOP[::BOT, MD7V>0_4L:/[:_:(\+\7/ACP+X[B7^+3M5N-(F8?[LL4R9]MP'O7N6:,T >/> M'OCEXKEUVQTKQ/\ !OQ;X2"8E4]V4$>E=%\1XI?# MNLZ/XPMXFECL";:_6,9;[,_5O?:>?Q_$=_FD95=2K ,I&"",@BN/%X?ZS2=. M]GHT^S3NG]YTX>M["HIVNMFNZ>C1YM\0?&=EXDT&+0= N8=3U'6P(46([Q%$ MWWY'_NX&>N#^5;D/PJ\.I9V]O):2N(HU3 NI55L#KM#8YK"%4+=^2!6EFL:&'J.4JN):;=E9;)+UZOK\C2K6@HJ%!-):W>[;]. MQ0T;P_IOAZV,&FV4-G$3EA$N"Q]2>I/UK0I,U\Y^*/VE]?\ "_Q/\2>'+C2+ M :7;ZYI6D:5>[9"TS3-9_:DD&['F".\#Q[<9$;Y!VFO12459'&VV[L^C:Y;Q MOX9NO$$V@W%F\0ETW4$NRDV0KJ 01QWP>*\K\??M0/X*\8&.+0Y+_P +1Z*; MZ2:2&XMK]KHWD=M'$D,D0+*6EC&[\)S:5>)>3Z>LC7"7 _#3_D\'XR_]@W1_P#T2:]_KP#X:?\ )X/QE_[!NC_^B37OV:]/,/XL M/\$/_2$>;@/X<_\ '/\ ]+8M%)FC->8>D+7D_C_]E[X>_$;Q+-XBU'3+RPUR MX18KF_T;4KBPDND' 67R74/QQE@3CC->KYHS5*3CJF)I/<\7U/\ 8_\ A??P M:7';Z1J&C2:;;&RM[C2-9O+6;R"[.8W=)07!9V)+9.6/-;.J?LS_ VU;P!I MG@R3PU%#H>ERFXL1;3RQ7%M,2294G5A(')));=D]\UZ?FC-/GEW%RKL>&>)? MV;M"\(? _P"(OA[P#HKR:]XBTNXA>XO+QI[J^G:)E027$[DXYP,L%&3TYJI\ M&?V1O!7@K3O!VLZEHEU)XHTJQ@86]]JL]W;6-V(U$CPQ-(T2MNSRHP/X<5[] MFC-/VDK6N'*CG/#GP[\/>$]5\1ZEI6G_ &6]\17(O-3E\Z1_M$H0(&PS$+\H M PH ]JXC6OV5?AGKG@K1O"TF@2VVEZ+<276FO:7]Q'TG0]476;^\CUF+ M4KJ^DC5A%!%Y>=D>YMQR5' XR*^U,T9JU5DKDN"9Y'XX_94^'/C[Q/=^(;[2 M[W3]8O0%OKG1M4N;#[:!T$RPR*'^I&?>F>)/V2_AAXFL?#UK-H,]B-!MS9V$ MVF:C/1?>O6LT9HYY:ZARHS_$7AW3/%NA7VC:S M8PZEI5]$T%S:7"[HY4/4$5YO\/?V6OAS\,O$D&O:-I%S+JEI&T-E-J6HW%[] MAC/!2!9G81C''RC..,XKUC-&:2DTK)CLGJC13>+-,M M7L[34B[AHHGSN7:&VG[S,KCQ/K.AS2:I=JB7PMK M^XMX+X(,*)XHW5),#CYAR.#D5ZUFC-"E);,+)GGGA[]GSX?^%(O"46E>'Q9Q M^%);B;1E6[G86CSY\TC,AW[MQX?:6EQKR:;)I N9 M)7*FT=MSQ&/=L()[E<]LXKILT9HYF^H61X1:_L/?!NVW(WA>>YMEE$UM:7&K M7CPV;!P_[A/-Q%\P_AQQQT)%>K:#\/M \,^)O$/B'3;#[-J_B!XI-3N?.D?[ M0T2;(SM9BJX7CY0,]\UT.:,TW.3W8));(\#\7OA>2>'4Y))KG3AJ5TED97^_*L"R!%[%RI=#@[SX$^! M-1TGQ?IEUX?BN;'Q;,L?+("KC9MP1D<\US7@K]DGX8> MO$.E>(--T*YFU[2W9[/4[_5+JYGB#(4V O(04"D@*00,YQGFO8[MO,>/S(SU&Y"&'U!!KB_B'^SCX#^)U MOH,>M:7<++H<7V?3[NPOI[6X@BVA3'YL;ABI &02?SKTS-&:2DULP:3W/*-. M_95^%FD>%M:\.67A2.UT76;BWNK^TBO+E1-+"08GSYF5(*@G:1N.2V237:^( MOA[X?\5ZWXN'NM,F\Z1/L\C(49L*P#94D88$5T6:,T954Y^Z3D MYKZH^&G@R/X=?#WPWX7BF^T)H^GP6/G8QYAC0*6QVR1FNDS1FJE-R20E%)W% MHI,T9K,H6BDS1F@!:*3-&: %HI,T9H 6BDS1F@!:*3-&: %HI,T9H 6BDS1F M@!:*3-&: .=^)/\ R3KQ3_V"KK_T2U<-^R5_R;?X _[!J_\ H35W'Q)/_%NO M%/\ V"KK_P!$M7#_ +)7_)M_@#_L&K_Z$U>G'_<)?XU_Z3(\V7^_1_P/\XGK ME%)FC->8>D+7EOQ-<)K<1&&/E?=S[UZCFO/?'FCWVHZHKP6SRH%VY4U$MAH\ MTUG4;>RTMWND#QD85&P>3QCFN=CL$LYB\0*1&+;M0# KLO$?@36=3TN6.&TD M68?,F<8)KFV^'?BPV\"&S<2,0TC[AV[=:V@XI7$[O0Y3QKXCM=)\.S/'C[4\ M>Q&0VWP[\1QP16QTJYBD,@WSYY(R:N$M-614LG='FFNZI9>(=- M.BWK;+VSVEEDX)(Z-]*X_P 0>,]?\ ^9=3O%?V-M K+;@?-GU_*O>O$_[/S> M)SNN["87XCP;B(@,1VS]*Y30OV6=5M_$1GO+B]U&!F&V&8 *!TKS6I<]T=U M.=.4?>-CPQJ-KKW@:'4]05;&TO;=952=\-\R@C;]*X6'PU<^%]/2[L1)K,2O M))'-"-S1Y'0XJSJ/P,\0^)KB]O\ 4?#MVO\ 9EP\=K:1G"O$#A3UYX K!-Y^T.?*W-S@9X]:]'73_B9((&A\+YD M\H2MYIXW8Y%1^*/A]XQ^(G@K[)/HT^D74K[6@R"J^IZU%DW[NZ'&;C%J6SZG M<^$M9TG5K&2;2+N"[LBVXF)@0#Z<5J3Q)+&=\8D4C.QP& (/;TKG?@Y\!KSX M5>$CI,*RW4DLAN)'DY^8CD#VKNE\)ZJ/^7=@?3%.TGJSEE:,N6+T(?"J;O$- MD 0N'&%Z =:]K7[H^E>5>'?#FI6NMV\LL!6-7R6QTXKU13\H^E:Q,F?&O_!3 M^!KOX2>&;9&BC>;5F02S,%6/]PYW$GTQVKY5N[>Y^,/[*EG ]W_:>OZ!<>8/ MWFYKF-&*;R3WODI;1\*?D0G:.V,_I7EU[2J\KW/8PZ<**FO,^:I/$[;Q&JCJQ/IE>*VM-5M#\8V-U;ZPJ()%55=C(H9DQDXP,DDG MZ5ZW^U?KND:!XA31-%TRSAN+W=/J$D86*1@W"IN7[I[U\Y:%9Z?=ZLD$]Z=/ MM4#L94R66102I/J<@#(]:\]R>J6B/3C&]FU=GN_@_P '^#=7L=;L%U&36-1> M!UCDG)C2)UQ_"26.YB1[ UVW[).OW?A#XLW7AN=Y!INH0^6("Q'E2+DC(Z9P M<9]J^>-&\=76DZ5IUY*\23V;D1)L&^X,C9D9N^"O%>X>(+[6]!N=,\>:58JM MHZ[R8DW.(S_%QU 7@GVK.3;CS16P&?%=MK6E:<=0T MFZ22">W&9""R'.X#^'(!KL?V:/"U];:;:>(/$1475Y\T2,@3RLD@<#H,8X-9 M/PK_ &D=$^(]KIS%O[,OY 85MKA20YSRV>G('>N^U$K::7Y-LSR0L08EA;A> M>%^-OVEE\ :_-9:I#/J#HJF2WC4 P M@CCYO7 '%>@^+OC+<^+/AWM\#:BEOJL]LC>=( 'M]W;;SSU%9*M3G>Y3HU:= MK&YI$VN_!G2%DU^]BUG3I7V&-I I@';&[J*Q/B@W_"U?!6H7W@V\<7"Q8D@X M.5SSM /)%?..N>*/$OQ9TV/P;XD$O]L22F.*]\_R]P']T=T D=9"R31LW+(?4>E)0DXZ,U[Y-W;W2Y@F7/S J>"1Z]B*^SO!GB:#XCQMXCTN26\M8TCS9P7!1[>1 M"""*W_BO\*[/XO_ EATWPY';W^ESRQW,9AD"E5!W$ CHQY'/K7S!X; M\,>*O@SXF^US176G1Q,$:*0E3.F?ND#^8K>-25&:<7=,4HQQ$-59K[_F?1FJ M7=U\1;G2]/TK1I6-U/)'.ER@,D6.-V?3/&00:U;OX+^.;/6;26TTI?(L(@\; MV]R$-Q)GYE<;N> ,$UJ?#/7+GQ1XYT75--UZ'^R(SY=SI[E1+O/09[__ %J] M"^-NN>+])\2^#8O#%I>W-G<7074&M(6=8T^T6RYF?]<6_]"KS M?S/I^=?1VN^$=*\22Q2:A:^>\2E4.]EP#]#6;_PJ[PU_T#__ ",_^->UA\;3 MI4U"2>A\]BLNJUZSJ1DK,\#\SZ?G1YGT_.O?/^%7>&O^@?\ ^1G_ ,:/^%7> M&O\ H'_^1G_QKH_M&EV9R_V37_F1X'YGT_.CS/I^=>^?\*N\-?\ 0/\ _(S_ M .-'_"KO#7_0/_\ (S_XT?VC2[,/[)K_ ,R/ _,^GYT>9]/SKWS_ (5=X:_Z M!_\ Y&?_ !H_X5=X:_Z!_P#Y&?\ QH_M&EV8?V37_F1X'YGT_.CS/I^=>^?\ M*N\-?] __P C/_C1_P *N\-?] __ ,C/_C1_:-+LP_LFO_,CP/S/I^='F?3\ MZ]\_X5=X:_Z!_P#Y&?\ QH_X5=X:_P"@?_Y&?_&C^T:79A_9-?\ F1X'YGT_ M.CS/I^=>^?\ "KO#7_0/_P#(S_XT?\*N\-?] [_R,_\ C1_:-+LP_LFO_,CP M/S/I^='F?3\Z]\_X5=X:_P"@?_Y&?_&C_A5WAK_H'?\ D9_\:/[1I=F']DU_ MYD>!^9]/SH\SZ?G7OG_"KO#7_0/_ /(S_P"-'_"KO#7_ $#_ /R,_P#C1_:- M+LP_LFO_ #(\#\SZ?G1YGT_.O?/^%7>&O^@?_P"1G_QH_P"%7>&O^@?_ .1G M_P :/[1I=F']DU_YD>!^9]/SH\SZ?G7OG_"KO#7_ $#_ /R,_P#C1_PJ[PU_ MT#O_ ",_^-']HTNS#^R:_P#,CP/S/I^='F?3\Z]\_P"%7>&O^@?_ .1G_P : M/^%7>&O^@=_Y&?\ QH_M&EV8?V37_F1X'YGT_.CS/I^=>^?\*N\-?] __P C M/_C1_P *N\-?] [_ ,C/_C1_:-+LP_LFO_,CP/S/I^='F?3\Z]\_X5=X:_Z! M_P#Y&?\ QH_X5=X:_P"@?_Y&?_&C^T:79A_9-?\ F1X'YGT_.CS/I^=>^?\ M"KO#7_0/_P#(S_XT?\*N\-?] _\ \C/_ (T?VC2[,/[)K_S(\#\SZ?G1YGT_ M.O?/^%7>&O\ H'_^1G_QH_X5=X:_Z!__ )&?_&C^T:79A_9-?^9'@?F?3\Z/ M,^GYU[Y_PJ[PU_T#_P#R,_\ C1_PJ[PU_P! _P#\C/\ XT?VC2[,/[)K_P R M/ _,^GYT>9]/SKWS_A5WAK_H'_\ D9_\:/\ A5WAK_H'_P#D9_\ &C^T:79A M_9-?^9'@8D/M^=>[_"AMW@JT/^W)_P"A&I/^%6^&O^@>?^_S_P"-;^DZ1::' M9+:647DVZDD)N)Y)R>M<>*Q<*\.6*ZGH8+!5<-4L?"CPEK\\LVH:';W4LFJVVN,[EL_;H%18 M9P<\,JQH.."!@@Y.>MHH Y3Q?\+?"_CV[CNM=TI;^9+:2SW>?)&'ADM)(,S2O"\C\-U9K>$^GR#WS# MC2.QB\FU:&XFBDMU\_S_W;JX93YHW;@0>V<<5Z!10!P?AS MX&^"?"5[IESI6B_9FTPL]E";R>2"!R'4R+$[E!)MD=?,V[L,1G!Q7=UC>*/& M>A^";.&ZU[5;72H)Y1!$]U($\R0@D(HZL< G [ TZ#QCH=U9Z/=Q:K:26VL. M(]/E64;;IRC.%C/\1VHYP.RGTH SOB?HC>(/ FKVL:YG$/FQ$=0Z'<,>_&/Q MK3\*:Q_PD'AK3-1&,W-NDAQZD<_KFM:F*J01X4!$4= , "N14+8AUT]XV:]' M=/\ %G0ZMZ*HM;.Z^:U_)#J*AL;Z#4[*"[M91-;3H)(Y%Z,I&014]=9SG@'P MT_Y/!^,O_8-T?_T2:]^KP'X:?\G@_&7_ +!NC_\ HDU[_7IYA_%A_@A_Z0CS M0_#/]HS2O%_@R]U?Q!:GPQJ.G6]W?7^FGS+@VUM! M<2PERZH QS$V5 )'H>"=#Q/^T!X;T>VUD6,L]Y<:9&6FNGTZ\_L^&0()/+EN MHX'5&VD';R1D#&3BGR2O:PN9;GIU%>\U2:Q.IW%NT)ND>[N=.N8; M0R6P8W"+%)J;0_CQX.UZZMK6&]O+2\N;B"W@M=0TRYM993,K MM"ZI)&I,;B-\/]WY2"0>*7++L.Z/0**X"7XZ^$5U&*PM[C4-2NVEFC>+3M*N MKEH?*F,$CR".,[$$@*[CP<$C(!-6?B+X^OO"^H>'M$T/3(-5\1:]/)%:17=P M;>WB2.,O++*ZH[;5& %))8#CJ#E871VU%>8>$/CC9WFO:OX8\50P>'O%>D^ M:]Q;0RO/;2PQQ1RF>*8HOR[)5.U@&&&X(7-7O^%\>$EN=.2635;:VU&-)+2_ MN-&NXK2;?%YRH)FB";B@)VYSD$?>XHY9=@NCT&BO,-)_:!\.>(;F";26N[_2 M9=,DU%&CTJ_^USJKQ*&@A-O^]0^:OS*QYX .&*D_[2/@BWMHW>?5SGT55TG5;37=*L]2L)UNK&\ MA2X@G3[LD; ,K#Z@@U;J!B44M% 'G/QN^!7A[X^>'+;1?$;W<=I;S&=#9R!' MW%2O4@]B:X[X<_L<>!OA?I-II^C3:GY-M-)<*T]PK,SNNT[B%&>*]WHK)TH2 M?,UJ:JK-1Y$]#Y;\3?\ !.SX:>+=T[CG&#'T';TQ6 M7I'_ 3(^$NC:E:WL5QKLTEO()%2>ZC=&([,/+Y%?7%%1]7I6MRFGUFK_,?( M#?\ !+[X2O.)FO?$)<'('VR/ _#RZ],T3]C_ ,$Z+ING6 FU*\L[&*2"*&ZF M5EV.26!PHSUQ]*ZO1OC'-XFU#S-&\':WJ?AO[8]B?$$3VJ0%DA7%EINW[9/'J$12#<<*6.[@,>!ZG@9JU MAH1VB1+$5)_%(\ITW]AGX?:-=K/87&L6@27S4BCN5VHB_L\:/H= MQOAUK6)(^H@EFC9 ?7[F?UJU;_M(_#:Y\22:,OC'1UE6RCODN7U"!8)4=W7" MMOY8&,Y&.,BM.'XT^#GM-3U"7Q%I%OH=D\*#5VU2V>VF:125"E9"0<@@!@"Q M'RY'-2\)3>\ ^L5-N8\L\9?L+> ?&^M7FJWVH:Y'=W8(E,%T@#?@4-:.C_L: M>"]"69;2_P!81981 0;A#@#;@CY.N5!_.O4/$GQ-T'PYX('BL77]K:5*(A:- MI96=KUY6"1)#@X8NS*!R!SR0,FLB/XR66B64MSXZT]_AU&'5('UZ^M/+N2P8 MXC>*5P64*=P.,=>1S26#I;J!3Q579S."O_V*O 6H:^FM//JT>HQR)+'-'6EX;Z:.YG:XR95#1,0!A#MX'RCBN_?XM^!TUBRT MD^,-"_M2^\O[-9C48C+-YBAH]J[LG<""N.N1C.:9-\8? EO>:I:2>,="CNM+ M!:^A;48@]L P4[QN^7#,J\]V ZD5HJ$5'DY=#/VT^;FYM3F/A;^SGH'PC\Y- M%U/5Y;:4#=;7=PKQY'\0&T8-;WCGX.>'?B%IQL]6@=UXQ)&P5Q^.*O0_%?P5 M.FF,GB[0R-4.VQSJ,0-TV\)MC!;YCO(7 YSQUKJZ2H0CIR@ZLY.[>IXIX5_9 M.\(>#M?L=6T^\U436DOG+%).IC=NVX;>1OCN%0>=')M8"1#&!@CE789'?G/B?\(M M<^(2^$]6O8X-4N=.U=-1D\/:BUK+:V0-M/"WV>7[,K.P:5'_ 'A.=G&.*]OH MH ^0_AY^R+J^D>)/!5YXAM[;4TTJ]5]8:ZNX)8-2"6EY&LXA2VCW.99T8M,S MN02"QV FAX3_ &-M=\,Z9I36]EH=MJUG:Z#_ *5!*0ZW-O>RR7T@;9G,D#JF M[JP&TX %?9=% 'Q-I?[&/BZU^'#Z?G1K;Q3,8[235$F9F%G_ ,(X=/>+?LW% M3<[7V=" &Z@"M_6/V>O'GB/Q!=:]=:)HZ:A)JL=U;6UUJ*7EG'&+.S@8S126 M_))MW(>)DD0<*WSG'UU10!X!\,LC]K_XQYQG^S-'SCI_J37O^:\!^&G_ "># M\9?^P;H__HDU[]7IYA_%A_@A_P"D(\W ?PY_XY_^EL,T9HHKS#T@S1FBB@ S M1FBB@ S1FBB@ S1FBB@ S1FBB@ S1FBB@ S1FBB@ S1FBB@ S1FBB@ S1FBB M@ S1FBB@ S1FBB@ S1FBB@ S1FBB@ S1FBB@ S1FBB@ S1FBB@ S1FBB@ S1 MFBB@ S1FBB@ S1FBB@ S1FBB@ S1FBB@ S1FBB@ S1FBB@ S1FBB@#G/B2?^ M+=>*?^P5=?\ HEJX?]DH_P#&-_@#_L&K_P"A-7'Y8Y;:>29)=^[D[I!QC^'J0<4G_ OOP)G']N\] M?^/2?_XBG_\ "]O Q&?[<'_@+-_\10II;,?*WT/.=4_9@U?[/KD&C>,;2R77 M;34+#4'N]'::\YM8]0U>]D:*UVLZWR3H4 M'SG:4\_.[G=MZ#/%2]_9_P#$VK:G:>(=0\8:;-XKTQK%=-N(M&=+-([8RG$T M/V@L[/YSY*R*!\N!P<]5<_M(_#JSG>&;Q#MD5=Q7[#(ZI/^U7\+(XY9 M&\5*J1MM8FQN1S[?N^?PI>V\RO9/LGQR>*-+^WPWMS?/K4&C2 MV]_ \UTUPXMI4NAY:\[=CB13@$@\@^H?$3P#>>*KWP_K&BZK%H_B+0IY)K.Y MNK8W,$B2(4EBEC#H2K#'*LI!4'V/%V_[9?P>N[Q+2'Q?YMPYPL:Z9>$GZ?N> MGO5X_M8_"E)$C?Q6L3N2H66PND.1U',0Q0ZVNK'[&2^RS%\0?LR2>,=+O9M: M\4'_ (2?4M52_OM4L++RHV@\G[/)9QQ&1BD;0%DR78Y;=SP*J^)_V6I?$GCZ M;73KFEI:_P!H1W]NT^BF;4+95@\D6L=R9P$@_B"*@Y)SGK7:M^TA\.EQGQ#G M*[ABRN#D?A'[5&/VE_ANS!1XC.2 <&QN>XS_ ,\ZI59;ID>S\CGO$O[-T^M> M'M$T^U\4?9)M*\.QZ"':R9H[D)-;R%I%653Y;BW*-&&Y60_-ZQ_#[]F?_A"= M3GOSK&F1F==2!LM'T86-I$;N.U3$GE_:4^&\"H9/$B MKO)"@V=QDXZ\>74'_#47PR)('B;.!GBPN>GK_JZ?/*UA^S\CMO ?A@>"?!.@ M^'_M7VW^R[&&R^T>7Y?F^6@7=MR<9QG&3CUK=S7F:_M*?#AUR/$8(QG/V*X_ M^-TO_#27PXV@_P#"1C!Z?Z':,UYJG[1_PZDD1%\1 N_W1 M]CN.?_(=>DJP=0PZ$9%*Z8FFMQE[K%U]CM7D$2R>6SY8@ MD#"@GH#7(77[1'P^LD5YO$&Q2< _8K@_RCI.<5HV-1D]D>C9H."*\_\ ^%^> M!/LOVC^W#Y.,[_L=QT_[]TU/V@/ 4BJRZZ2&&019W'(_[]U/M(=T5[.?9GFC M? _QY86.A>'-+NK"UT[0M4-UI_B"'6[NWF%H9_-,$UDD?E3-@[,LY!'/!)!Q M=/\ V=_'5U->:AXBAL=7U%]-M+3>_B_4#--=0W/G?:HY3;XM>?F6.-2H/!X) M->UK\=? [#(UO(_Z])__ (BE7XY>"6;:-9.?>TG'_LE;?6%W1'L9=F>.WWP% M^(VJV%Q;:K?:-KDNL:;;6-]=WUZXDMQ!?R7**=ML!<9C<1ER(R2I)'-=5XG^ M#?B6/XGW'C?1%TB_:WU*VO;32;RYD@25$L7M7#.L3^6ZE]R$*PX(.W/'97?Q M^\!V.WS]=\O"=:^('P[L[0'3](\3VEU:ZI BR//9I=02K*L9?8K-&2NTMM!YSCM7( M>./#WQ9\>1:=YUCHND6,$CK4>#_V M:O$>@> KS1KF\TA[^:70'66.:5E L3#YN6:/=SY;;>. ;J MZ>WBU[=,O5?L=P/U\O'>GS_'OP);3QPR:X5DV]I)KX2XN/]4AM)_F_P#' M*AU8R>Z*5*2Z,]$S1FN&/QN\%JFXZP0O3/V2?_XBG'XU^#!C_B<'GGBUF/\ M[)2YX=T')/LSM\T9K%\,^--'\81W#Z1=F[6 J)#Y3Q[2E;54FGJB M6FG9AFC-%%,09HS110 9HS110 9HS110 9HHHH **6B@!**6B@!**6B@!**6 MB@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6 MB@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6 MB@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@#P#X:?\ )X/QE_[! MNC_^B37IOBKXR>!O _B73?#_ (@\5Z3H^MZEC[+8WETL$>*/CUXM\1?$G6/ OPI\*Z?XAU#0@@UG6]< MOFM=/LI7&5@&Q&>23')"CY>]>\5\R?LAW<&B^/OCEX5OW6'Q+%XON-3DAD.) M);6=5,,H[E<#&>V1ZUK!*S;6Q$MTBUXH_:!^)G@;0M+_ .$H\":9H.K3^)], MT0SQWS7ME>V]RSAY8& 1E9=N-K@XR,@YKV?5_BMX*\/ZP-)U3QAH&FZJ6"BQ MN]4@BGR>@V,P;)^E>-_MFZA:W'A_P%:17,,EU;^.M$::!) 7B#2/M++U&<'& M>N#7F'CBVF^.$'QZ=J7B#Q5:O<:E>W$$6))(Q&%,>T M!2S]0#BM%!22>Q/,T['VBVL6*:C#I[7MLM_-&9HK4S*)9$'5E7.2HR.0,46^ MKV-W>W=G!>VTUW:;?M%O'*K20[AE=Z@Y7(Y&>M?%?[/VHS7WQ/\ V<+F]G:6 M>?X;W:"25LLY#Q<9/4A1^E87QK\0WVC:E^U?QUM?^KV#GTO_ %L?1OQ1_:3TOPYKG@C2_">L^'O$-WJ_B:VT M34K>&]6XEM8I ^YML;Y1P5 &X$>U=MX5^(%U=S>)&\2KHNB6>GZL=/LYX=6C MF\Y>-GF]/*E)./+//2OG?XX?"/P!\.KGX 2>%/#.BZ3./&&G01WME:1)<30^ M6Y.Z4#.?#?B;4;S3]'\0:5JM_9'%U:V-['-+ &5OH-5L;M=+MD@%Q$MNK*LFT#?AN[F\U&8EX6&8Q\O&3D@@\5R]]^T'X^\4ZEXZ MNOA]X1T/4_#O@N\EL+Z76=4DM[J_GA0/,ENB1,J #@-(>3Z4_P""'_)U/[0/ M_731_P#TE->+:1\*]3^.*_&_QMX4\8W7PVNY=7O=(N=$L2397B6Z;7DO$)R) M)'_%^FPRV]EK%HETD,_WX M\]5..I!!&>^*\S^)WQ+^-7A6]\0:EH/PXT&_\)Z*K3>9?:Z4O=0A1-SO$BQE M8_X@ YR<>]7_ -F;XGZ)X@^ GPZOKB#3/")U*U6RLM)$XCC=XV,>RW#G<]:Q?COXZU;XD:I>?!OX=R"37;Z'R_$6MJ-T&@V3C#[CT,[KD)'UYR< M#FH4;3:MH4W[M[GK/PO^(%C\5?A[X?\ %VF120V6L6B7<<4WWX]PY4X[@Y'X M5<\3^._#?@B."3Q%XATK0$G;;$VJ7T5L)#Z*789/TI/ G@S3OAWX,T7PQI"& M/3=)M([2 , MX0#):,9RXQSD9%,O_%NAZ5/=0WNLZ?9S6L2S3QW%TB-#&QPKN"?E4D@ G@FO MC+QU\(+WX-_LTP-KFJZ?:^._#OB1[WP7_P (ZTEQY$\T@:+3HQ(JLR-N92F, M!<'M7-ZHMEXD_8B^+OB[4YWN_B+K-X(_%0N(_+FLKF.ZC5;,+DE(XTQM&>0< M]^-%23U3ZV)YWV/NG3?'OAG6==N-$L/$6DWVLVXW3:=;7T4EQ$/5HPQ8?B*G MC\7:'++'&FLZ<\DEPUFB+=QDM.OWH@,\N.Z]1Z5\I?&[X6^#_A=;_ W4_!'A M[3?#WBH>*=.M;>73;=8KBZ@D4_:%D8?-("O+%B?UK)^!WPS\/S>&OC5\0$T& M#5/'&D>)]>?2;VX#2O:R1@M'Y*DE4;<(_B+X4\'7=O::_P")]&T.ZN!FM M0BMWE'^RKL"?PKX;^'7P)\:_%O\ 9FT4:+HWPRB.J6Z:BGBN>XNSK$=YOWM< M22B$D3!P0?FP.1TKM/''PR\5_#WQIXX\?7O@'PE\;?#NJVL$FHK>W,:W^G"" M +-'%YT;(T?!<*,,?0&G[*-[7%SNU['UCXA^(GA7PE#:3:YXFT;18;P9MI-0 MU"*!9Q_L%V&[J.E94/CB_OOB-IVDV$&D7GAJ[TIKX:G%JB-<,X?: D Y>,C_ M ): XSQ7RU)X&U#6]*./<(X#*K MQ@,K#(/)^G)R/#'C;3=<^(GAWQ+\/=#?P[:GX4ZO-IND*H!M9DO) 8U XP)5 M;&.,8P!TH5)6#F/M$?$3PJWB7_A'1XFT8^(,X_LH:A%]JS_URW;OTJ76_'7A MOPU]J_M?Q!I6E?9462X^VWL]\=>'[' M7K^W\"Z+=+<31Q7$BMYC>6V5+9)&2"1SC%+V<=7?8.9GU[I6K66NZ=!?Z M;>6^H6,Z[X;JUE66*1?564D$>XKRSQ%\;I/"_P"T):^"M2?2].\,MX9EURXU M.\D,3Q2+<"( NS! F#W&<]ZY#]BRSAT31_BAH=D@M])TKQOJ5M8VB<1V\7R, M$0=E!)X'K6-\1/ 7AWX@_MT^&K/Q+HUIKME;>"YKJ.UOXQ+#Y@N\!F0_*V-Q MP&!&>>H%)12DTQW;2:/HRS\:>']1\/'7[77=,N=""ECJD-Y&]J #@GS0=N ? M>J_A?XB^%/&\L\?ASQ-HVOR0H17)C_W@C''XU\;Q>(?#?P7C_:.TEO" M5IKGAH>)=,M;#PKA8;)[BZB3"$8*QQEPI/&/EZ4Z?P-XE\%?M,?"5]9TGP%X M(EU:TU:U,?@:VDMW6(6I;%P[;5D"'!4A0 0:KV2UU_JUQ<[/L./XF>$)O$+: M!'XKT-]=5MC:6NHPFZ#>ABW;L^V*Z"YN8K*WEN+B6."")2\DLK!510,DDG@ M#O7PSX0\,S_LUV_@W1/B/\)_"_B/0CKD%O8?$31)HVO/M4LQ:"::-T$I8DC+ M*^,#'/?ZT^./_)%_'G_8"OO_ $0]9R@DTEL4I7-6T^(OA34-8BTFU\3Z-O/"FL:+XCO=+AD9H;?4XC& MDJJ2$FD4D1 DU?$'B+X,>"+#]E_P#9_P!2M?#-A:ZGJ>MZ+'?:A!'L MNKE+A2)U>88&5XW949D0 %@.,XS6GLX]'_ $B>9GU)X;\?6\WA/1-0\2WFCZ)J=]9? M:Y+:/4XY81A=TACER!(BCDN.,"K_0O%+V<3&%AJT26; MR#&5>X!94P#R3TKY"\/^#=$\>ZQ^R'I'B'3+?6-+?PQ>2O9W:[XI&2VB9=R] M& (!P<@XY%0_%GP[IG@?5_VJ]"\/V%MHVB2>#]/OO[.L8EAMUF975G6-0%4D M#G YI^R5_P"N]@YG8^U?^$]T?2M'M;GQ#J^D:)=-8I>W,4^H1A(E( 9@[$9C M#' ?H>/6FW/Q0\&V6G:=J%QXMT*"PU)MME=2ZE"L5T>F(F+8<_[N:^7H? ?A MWQ_^U+\,;/Q+HUGKME;?#:.YCM;^(2P^8)4 8HWRM@,<;@>>>H%V63[!$D'FHEN#D0@.Q;Y,"8X9/$7B/2- CFR8GU2_BMA)CKM+L,]>U+?"LF MEZ]%>:M8V$.>=8W96C89(!.#G&?6O /"_B*X^(^E?"/P9I/@3PGXO M\9P^"+;59]<\<(9;:RMFVQ[40(SN[,HS@KCC)YX\R>PO= ^$?Q0T*\72H/[. M^*6E*+308VBT^!FE@9U@C8DHF>V>N:N-)7U$YNVA^E-<_/\ $3PK;>)$\/3> M)M&BU]R NE/J$0NFSTQ$6W'\JO>)[FZL_#6K7%BI>^BM)I(% SF0(2H_/%?$ MGA?X8^ -;_8"U'QCJFFZ=<>)[C2KO6+OQ)-&IOTU-7=@WGGYU99 % S[8YK& M$%+5EMVV/N*TUBQO[R[M+:]MKB[M"JW,$4RL\)(R Z@Y7(Y&:I77C+0+&QU" M]N=(R\=E MXX\#I!K)D&-VJVML)H&;_;D7<@]37%Q> /%&E^(/@=XK2[9 ) BL7>.-L*I!&0:T5'S_KJ3SGWIIGCOPUK6@RZYI_B'2;_ M $6+/F:E;7T4ELF.N9%8J,?6O/?C_P#'(_"_P7%J?A^;2M5U/^U-.LY;6:7S M/+AN9E3>51@1\I)4G@^]?.OQ8^#7C#P%\.?CEXFUBW\'Z!I6M^%1"^B>$I)Q M$US%(,7!22) "48J2.O&:T_C1\(?"'PV_9D\,WOAW0[?3]1U/5?#TE]?#<]Q M=M]HC;,DC$LW+$\GC-.-.-UK?4')V/JW7?BIX+\+ZH-,UGQ?H.D:DV +._U. M&"8YZ?(S \_2M?4/$FDZ3]G^W:I967VA6>'[1<)'YJJNYBN3R O)(Z#FODGQ MA!-\;_%_Q3/A7X;_ Z%CHEQ)I>L>)/&5JUS>7D\<(W>4D:@HJ+@!F<= 1WQ MYWX-\/Z=\1O"'['FE^)[2+7-/G.J)-;7>7CE6*-MBL"?F4;%&#D$#!R*2I*U M[_U:X<[N?>GAKQCH/C2SDN_#^MZ;KMK&_EO/IEW'<(K?W2R$@'VK7KY@\(>% M]&\ ?MQ7^D^#-.L]&TF]\&K=:QIVF0K#;I.MSMAG'_<)?XU_P"DR/-E_OT?\#_. M)ZW12T5YAZ0E?$?Q(7/Q#\3'/_,1G_\ 1C5]NU\2?$;_ )*%XF_[",__ *,: MLJFQ<-SG"HVE@,D5"MU(8QL0!R. YJTJE@14-I;B &/DX8GD=,\XK&U]S:]B MPJEXPCG!87@%@.<9-<[!X<@:VFU+>70Q&!(ID$F_![ ].1VKTN]\B5GBEPH7 M'S'C!.>AK$MO"HAE>5;J2>%UQ$NX$)ZX_P >M9-=SHC-J-CYPU7PYXC;Q'=: MAIDG]AZ=8Q$&XMY2"V!R,] ?8#%<%X@U?QCXN-L;>6YOAIZ;()EMBL0!/S,[ M'ACGO7UE=^&4F06D\>RT$GF20G_EKSGYO49_.LWQ!J$.DZ#-:6<22/*C*Z1C MY0"#DFLDK/4]*&(T24;LQ/AW=7]EX'T^.2X:YEC:)2)#N<(6VLI^AS^%;YWI MJ]JJI-/DG?)CY5(&#D_B*X?X4SV][K&IVL )@MHT=9 H 9LG(!'7&>M>IB=I M(8F2/Y2IW%A@[O\ ]=>C0E[B.#$1Y:K*EU'#*"\Z8VKPV.%SU_/BL]@+.9GC MBW!X?+.!V)[5JW$0EM5209\WY6(/0@"LJ2Z@NH]KR".-'.<=P/\ Z];^I@A^ MF0*89 H;R\=&I]Q;RQP)';\;""H8YR.]6-OF0,(FV[AQQQTJHWVBUC2,L\G. M#\O// _*DPN27-P+.ZLB< %\!R>%[U^F<'^HC_W1_*OS'-H)DBAN9%E'F G= MT!R,'-?IQ;C%O$/]D?RJ$DG=&-79'E/[2L(G\!6JL=O^GHYF2*,$?,[8&>P MKS\1\9TX?X#$\>:J=(TJPTJVC9[F^D$*A!RJ]S5J798Z<-GWH5V@DX#<5!K- MU$?$%J@P9 N #V[UP/Q#\:1Q:=.ES%(D43E,19S[$X['FN2I)123.RG!R9VO MA[Q8-6N9[=$_TB(@LJMD8]:Z0:G%%&\LC",H.=W%?,'@CXNZ=X9U.:>\>>=G M^5D5<^6@Z G/^[OM0 M,>CQQ+IZDSSN@3><]5'3=G*D #'UK5&+T,6RTE+75 MIF65=Y7H.H_SBKITT7TP?=M=3DY%23Z<(+N:X^Z3RW%6K$J3E/FW+GKUYJFD MK6%X/^>].CC,>NLOS-&V"# MG&/:J7B:5;35[6S2/S7N"P+ 9(X&<_IS1%-L&;,DJ3S1J4?E2^X].N*GCAED M9]K\,NWC^'WI;&*0P1JZ[B!C)%.BN%>0B-E=T)5E!Y![BJ6Y'H>S?LKZ+)HN MF^(DEE:>26:*0LQSV?I7NM>._LYF3['K@?/#P@9Z]'KV.O6H_P -'EUM9L2B MEHK8Q$HI:* $HI:* $HI:* $HI:* "BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6 MBDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6 MBDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6 MBDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH \!^&G_)X/QE_[!NC_ /HDU[_7 M@'PT_P"3P?C+_P!@W1__ $2:]^KT\P_BP_P0_P#2$>;@/X<_\<__ $MBT4E% M>8>D+7FGQ,_9U\"?%G6+76==TJ:+7K6/RH=8TN]FL;Q4_N&6%E++UX;(&>*] M*KQ6;X@^)?'?[14G@[PSJ TOPQX2MH[KQ'=K!'+)=W$PS#9H74[ %&]F7YN0 M 15QO>Z=B7;J:>A_LL?#+P_HT>F6OAQFA74[?67FGO[F2>:\ASY4TDK2;W*[ MC\K$KSTJEXC_ &0OA7XK\5ZGK^I>'9)KG5'\Z_M(]0N(K.[EQCS)($D",WOC MKSUYKV*69((GDE=8XT!9G<@!0.I)[5PNG?%32OB1I?BFV^'&N:3KVNZ0GDB5 MV>2QCNF5C&KR)PXROS!"2/8D4U*>]PM'L8OB;]EWX<>*?"GAGP]6:69+Q%4J-XD=N<,V6&"2&?V,_A+X5U32]2M?#US M<7^DW4=WIT][JUW.UDR'*+%NE(5!G[G0X&0<"NKOOV?O .HV6KVEQH/F6^KZ MRGB"]3[9<#S;]"K+-D297!5?E7"\=*\@M/VD?$WQ:T?X/V'@Z6R\+:QXXBO9 M[Z^O+4WBV'V1?WT<<9=0S&3@%CP.V:M:/^TKXB?X(7UY<6EC??$9/$-QX0L( M+>-DM[Z_27RTE";B53;^\89X"MS0XU.K!./8]VUOX?Z!XC\5>'_$FHV'VC6M M ,QTVY\Z1?(,J;)/E5@K97CY@<=L5M:A8PZG87-GE[#O!W M[)_PQ\ ^+(O$NAZ+J%IK:.)/M4FOZC/YC!2H\Q)+AEDP"0 P.*/%_P"RC\-O M&OB/4=;OM)O+:[U0@ZG%IFJ75G!J..GVB**14D]R1D]\UZ#J'CC0])\5Z5X: MN]1CM])H+36K6>7PT^S6$5 MCFR.S?A^/[H)XST/I3YI[W8K1V*&L?!?P7KK^#VN]!AV^$9UN=#CMY9(([*1 M0 I5(V56 'RL"/:N)\1?L9?"#Q5XDU77]2\,74FK:K<-=7D\&N:A )96ZL4 MCG51^ JAXG_ &C]/T.ZUWQ!;>+-!N_"EOX1_MRRT]K:<7E>;>)?VV+;Q5^S))XI\(^(+"R\=6D6G3ZG:00%TLO.N(XY%_>J5(P MS#.3CK6D8U.C);AU/J/P%X!T/X9^&+7P]X5F< M\D]2:Y+XE?LX>!/BKKL.N:SIMS;:]%%]G&K:3?SV-TT7_/-GA=2Z^S9QVQ1X M$_:5^&?Q)\52>&/#GC"PU;7HXV0AY#_?<%AV(KB/VD_V=;3Q5\,OB7)X*T 2> M-?%EO;172QWK0QWABE0AF1Y!"&"@_/@,>F3FNW\*_$35=9_9ST_QQ<+;C6I_ M#0U9U1"(?.^S^9PN<[=W;/3O7ATG[0?Q0\6Z!\ K;PW=^'],U[Q_87-S?7.H M6$DUO&\42R?(BR @'D=3VK2*GS7OM_PY+Y;6L>O?#?\ 9<\ _#S7=/\ $=GI M-W-KUI;^5;2ZEJ=Q>K8[EPZP++(RQYY&5[< XKO/!GP]\/\ P^M]4@T#3_L$ M6J7\VIW:^=)+YMS*09'^=CC.!\HP!V KRF[U#XS?#GP1XV\2>+O$7A/6H=,T M.ZN[M*F@9;E%WJTA>5MR85@5&#R.:\TE^/'QJ^'OPF\+_ !5\2S^$/$GA M'4ELIK[3+&QGL[ZWBN2H!B:7J$$VH M%3J%O8ZQ=VUM>[5"@311RA&^4 =.0.*/#?A?0%M51ELD^U5_V8OB[K/Q?^']]=^(K2TM?$&C:M=:+?MI M^[[-/+ P!DBW$D*P(X)X.:+SMSUAGBK]DSX:^+-474)=*OM*N/LT5E* M-%U6ZL(YK>-0D<3I#(JE0H '&<=ZZOP]\%O!7A36](U;1]!AT^^TC2SHMDT$ MD@2&S+[S&(]VPY;DL06SGGFG_$OXQ>#?@]I]M>^,->M]%ANI/*MTD5Y)9V'4 M)&@9WQWP#BJ6F_'WX?:Q\/;OQS9>*;*X\*V;;+G4$W8@;<%VR)C>C99>"H/( MJ;S:ZV*]U,Y9/V.OA.GB0:N/#(]1M(K&ZO/.D/F0QDE$V%M@P2>0H)[DU5\&?%?PA\ M1=1U:Q\,>(;'7;K261+Y;&7S! S9V@L.,_*> >,'->3_ !@^(WQ('[0'AGX= M>!-2T'2$U'0KC5IKK6M/DNOFCE";0$D3 ((H]^3LV+W4KH]B\'_#_0/ 3:RV MA6'V$ZQJ$FJ7Q\Z23SKF3&]_G8[ M=)\MLS[RFS=L^\,YVY]Z^7?&G[5?Q$\!>"OBIH^N6&@Q_$/P6MA/%?Z?'*^G M7EO=2HJOY3MO5@"#Q^(KVLV:RI#J.H:G M=7,X22,QLA9Y#N38Q 4C R2 #S7J?A_7;+Q1H6GZQILPN=/O[>.ZMYEZ/&ZA ME/Y$5YEX1^*>M:W^TIX^\"7"VHT30]*T^]M62,B8R3;M^YLX(X&!@5*<[.S& MU'L5O"W[(?PQ\'Z]IVJ6&CWTATR47&GV-]JUU=6=E*.CQ022,BL.QQQVQ7K& MN:+9>)-%O])U&'[1I]] ]M<0[F7?&ZE67*D$9!(R"#7&?'#QYXD^'/@#4M;\ M,>%6\57MM!+*\1O8K9+=$C9C*YD(W*,?=7+'M4_P+\::A\1?@[X.\3ZJL*ZE MJVF0W=P+="L8=U!.T$G _&D^9KF;&K)V1)=_!CP;?>$O#7AF?1]^B>')[:YT MNU^U3#[/);_ZEMP?<^WT8D'OFK'B#X3>%/%/B2?7]4TK[5JTVDS:')N==\2:K;:-I-OCS+JZ?:H). H[LQ/ M49)["N(T?]I_X8:]H.MZQ9^*X6L=$19-1\ZVGBEM48X5WB=!($)/WMN/>DN= MZJX:(W-,^"W@W1KSPA=6>C>3<>$;22QT5_M4S?9(70(ZX+D/E5 R^X\=:9XA M^!_@GQ5?>*;S5-%^U7'BBPCTS5W^USI]IMH\[$PK@)C)Y3:3W-:6J?$WPOHW M_".?:M:ME/B*58=)6,F0WK,NX>6%!)&WG/0#J17 ZM^V/\&-#NTM;WQ_IL4Y MG>V9%25_*=7*,)-J'RQN!&Y\ XX--<[VN#Y5N=W9?"WPQIWBS3O$UOIGEZWI M^EC1;:Z^T2GR[,,&\K:6VGD#YB"WO4>F_";PII&G^*[*TTKRK7Q5<3W6L1_: M)6^U2S)LD;)+=,TF1[#^U$-S-M5[8L%$ MBMT8%B "2<\ UF>*OVF/AGX+M=)GU;Q7;Q+JMHM_9QV\$UQ+);L,B8QQ(S* MA'\3 "BTWW"\2AXH_91^&GBRQ\.6USHES:?\(]:#3].GT_4KFVGBM1_RQ:5) M [I[,2>O/)JQIG[+7PNT7PU>^'['PK'::/>ZC!JT]I%>7"J]U#M\J3/F9&"B MG (!/4')K5U_]H#X=^&?!.F>+M0\66$?A[5"%L;R)FF^U,?X8T0,[L,'( )& M#G%9]K^T[\+KSP1>^+X_&-DOA^SN19SW,J21NDY&1%Y3*)"Y!R%"Y/I57J6Z MB]T]1KQ:_P#V._A1J7B2;6)_#DA$]U]NGTM-0N%TZ:XSGS7M0_E$YYQMP>XJ MIXC_ &EO#'BOX;ZYK/@#QQHMG=Z7<6T5S=ZY97(BM?-D"A9(=JR N,A3C&?I M76_$O]HGX=?!_4K;3_%WBBVTG4+B/SDM!')/,(^F]DB5BJ]?F8 <'FDE..UP M;B]S:^(GPH\)_%C0K71O%FC0ZOIEK=17D-N[O&$EC^XP*,IXR1C."#@@BH_B M7\(O"7Q>T*'2?%6D1ZE:V\HGMG61X9K:0='BEC*NC>ZD56U?XY> ="\*Z-XF MO_%>F6WA[6)%BL=3:8&WF8@L '' X5LYQC!SBJ_PR_:!^'OQDOM0LO!WB>UU MJ\L%#W%NB212*A. X615++G^)A?LH_#?0]&\0Z:=*O MM3BU^U^PZE/J>KW=S/<09R(_,:4LBYY^0BNT\4_"_P ,^-/"MCX;UG3/MFBV M4MO-;VWGRIL>!@T)W*P8[2HZDYQSFLKXV>+;_P &>#[?4-.UW2/#L[ZC:VQN M];@DF@99) IC"Q\[VR IZ GFL_QW^TS\,/AGJM_I?B7Q?9:7J=CY7GV3))). M/,4LFV-%+-E1GY0<=\4_?EJM1>ZM#.\5_LF?##QKXQOO$NK:!++?Z@5:_AAO M[B&UOF485IX$<)(0/4<]\UP?Q5_95T_7-?\ @OX=T'P_+%\/?#$]_P#;([?4 MY(9+..2+,920RB8GS.05)([\5] ^#?&FA_$+PW9>(/#FIP:QHUZF^"[MFRCC M.#[@@@@@X((P:VJ%.<7OL/E3.$^%OP1\(?!R+4/^$:TZ6*[U%Q)>ZA>W4MW= M7+ 87?-*S,0!T&<#TKO*2BLVVW=C2ML+1244AG._$G_DG7BG_L%77_HEJX;] MDK_DV_P!_P!@U?\ T)J[CXD_\DZ\4_\ 8*NO_1+5P_[)7_)M_@#_ +!J_P#H M35Z/^)C/_Z,:LJFQ<-SGHTV(%SN8<5(H )SWJH;C[-< M2O.52W !$C' 'KFJ;>)+(MMCE60@\D'(QZUCURC1!F4*HY0XRK _A^.: MAR2W-5"^C-2_U]KBTD0Q;)2%:-HVW#G..OT-:7@>SFM=%9YY%D>:5Y0$;*H" M?NCZ5YEX1U&:[22VNI0)K&4PSXQ@I&O'YYS72^&?%7D)-.9Q]C-PT<4 '!Z9 M/YYJ>?6QK*FTGY'7ZUIT<^96! W ':>M<-XX\-PR>';]T"E_*8!I)"D]>E74\$-I)+(V(W4 $^IZ8_.N+UH)=VK6=Q*MOG[SR)DA2",KV]:4E<5-M M-,\]^%O@^30].M]3_M W4E\I01A-JJ@ YYYZBN[MTE33X5E!G#_?+<8]ZY'P MGKD]YKUQI,"![+3XB Y7!8L=H'Y!C^-==:2SQ;(I&5U.0D;\%0"!^-=6'MRZ M%5VW.[(T;[0TB1 *H(;=_,50NK"6WM3-& 6(W$!1][!R<>]:MO \&]2AP9#M M]QBB[NTCBVMA58XW=A71N8&=]J,36L;G$Q3+#\._YU4OYKIKFW2WF5$/SRS' MM@\#'OFK*1.US-O52I4-_$ZGQG8VTI: .3"CE\*&/J/KQ7E8RI[-W M._!0]IIZC/$OCZ2/4Y3"\;LQ,8*CDGV/;CFO+M;\<:1H/C*3PSKT>IWELLD= MQ/?27(8 E05C"XQM'J3UK3\1>-;+3/#TND6\,-Q?75]Y-V9(R65<8!![<@ < MUPU]X?BU'Q)IZWTTERDJ>;)(X'!&, _H*\B51S]YGNPIQBCU*S\3_#CQLATV M;2H]%?:1%?1$.,@]7Q[5B>(])TGP#8V&I6&J1:MYTBI!)!D@*6R&;/.2>,"O M-M6O+1+[RM(L4M)1E)&3"A5)(Y]#BK-_J5QXE,5O:(LEY:LC1V\;_+LCQE@> MF*QD[KE:-X0:UOIYGTC\*=5TK6;&<75K'%?S-O?>AY ZGGWKM_#OB6&^U6ZT M1(W,4<+7)N<_*#OP4]J^>_A#XB^W^.;>&\>6PG$#.OVAQAPV,#\1FOJ+2(8& MM','ER.[890PZ5U4;6/.K^ZQLCE9E@'*,-P;WK4M/W$2JXY![5R-_JDQ\4V% M@@"Q-.,^A5>N/QKKU4K(T9Y(.[\*ZN5QMT5MO#C M*@=@*ML^YF+C!5N#4J*LH*N0=U&[)14L8$O;^"[$I "X\OMGUJQJ%E]HU."8 M*&$.2&QSR,4Q[R#1;!X\%4A7-Y]=&@[/#T'GW[2*""V-JD\MU&<5E^$/#?B.P\0&[OKX36C1 218Q^\"@?T M/-=7J%]%I=O'//E=YVY'05BW?CF2"VGDA@;R8P0I8?,356N@3>W<^F?V>)/, MM==/ .^'(_!Z]@KYX_9'UK^UH_%*;BYB^R,Q[!F60D9]L"OH:O3H/FIIGE5X MN-1IBT4E%=!@+1244 +1244 +1244 +1244 +1110 4444 %%%% !1110 44 M44 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !111 M0 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% M!1110 4444 %%%% !1110!X!\-/^3P?C+_V#='_]$FO?Z\ ^&G_)X/QE_P"P M;H__ *)->_UZ>8?Q8?X(?^D(\W ?PY_XY_\ I;"BBBO,/2"OG_\ 9E9(OB1\ M>;:? U1?%YEE#?>\A[:(P'Z;0/[3''S!<0E4;]ZF2N&P"O&16D6K-,E]&>8?'7X/\ C_6OB%/K^M07 M'Q9^&HPR>!;*_P#[+DM<=6,8PE[C!.V1U)S@ UZ?\/?C9\.1\/-9OM*A;PCI M'A2'.JZ/>:8^GRZ4-I;:\&T8R%.-F0<<$UZW5'5]"TWQ!IUWI^J:?:ZE870++%,G]UU8$,.3P>*;G=),.6SNCY7^&WC#0?CO\4],^)_C#Q/H>DZ7I M9>+P=X4GU2 7"&3Y3>W*;\B9Q@+'U4$=ZM? CQCH?PK\4?M!:3XFU6TT>[M/ M$MSK92]F6)I+2:%7210Q&X?*1QWXKVBU_9S^$]C=0W-M\,/!EO<0N)(IHO#] MHKHP.0RD1Y!!&016GXR^#?@3XAZI::EXG\'Z)X@U"T $-SJ-A'-(@!R%W,"2 M,\X/%6YQ>G0E1>Y\\?LR_ 6T\<_LU?#J]U6[U?PWKMG<7NK:7JFD3BWO+9+F M60X!=64J\;+D,I'2N"\2:#_PBO@GXC^+O \MVNB?#RVNM-T+4+B3SY[G59Y% M_M+4F4<,<,*Q)&J1*H14484 < >E9UAX6T72M#.BV6 MD6%GHQ5T.G6]LB6Y5R2X\L#;AB22,M'M7=MAR:6/GCX,O<>#/VACX/TC MQ/K/B7PU?>#H-;N1J^J2Z@8+LS;!(KR,Q02*2=H(4XR!6U\/F2X_;.^+$EG@ MV\.@:1#=E>GVC,K*#[^617IWAKX7>&_A=I&JKX \)Z%H5[=*9/*MX%M(IY0# ML$KQH6V@GL#@$X%8/P#^$E]\,-"U>\\0WT&K>-/$5^^J:WJ%L&\IYFX6.+< M?+C0!5R!W.!FDY)W?R!)Z(X+]LB^C^'\'P\^*;(QC\'Z^C7K(,M]CN4,,PX] MRE?-?B_3M<^#O@VWU7RYAJWQIT&:RO@ 25U6XN?-ASZ$074B?]LZ_1+7O#VE M>*M)GTO6M,L]8TR< 365_;I/#)@@CL(LQ6'P M:-E#&@ZA)60 #\*Y7QIK6E:U_P $V_#%G;WUG?21V6CQSV\'-)&NR:V-+LAK,EN+-]1^SI]H:#=N\HR8W%-W.W.,\XKD]-^ 7PU MTA]4:S\ ^'(!JC*]ZBZ7#LN"K[UWJ5P<, PXX(SUIJJM+]+"<6>5?'C3[73/ MC9^S?]CMXK00ZQ=VT8@0($B-FWR #HO XZ<5Z=^T5_R03XB?]@"^_P#1#UV6 MH^&](U>]TZ\O]+LKV\TV0RV-Q<6Z226KE=I:)B"4)'&5P<<59U'3;36+"YL; M^UAOK*YC:*>VN8Q)'*C##*RD$,"."#P:RYOA\B[;GQGX-_9$^$^H_LL:9XGN M/"\DFMR^$Q?O<_VK>@&?[+OW;!-M^]SC&/:O.4\/^$_%'A7]D#3?&[6Z>&9M M(O\ [4;J\:TCXMU*YE5T*_,%_B&>E?H9;Z#IEIHB:-!IUI#I"0?95T^.!5MU MAV[?+$8&T)CC;C&.*Y[5_@WX \0Z3IFEZIX'\-ZEIFEH8["RO-(MY8;13C*Q M(R$(#@<*!T%:JL[ZW(<.QX1K/P\^#/@;X._%9_AG<:6^I7/AB\%TECKLE^YB M6)L$J\TFT;B.0!U%>*)X%UCX??#/X+>/?&&NZW\0/A+;6EC&-(^WV[6=W]AT:WA^T0- MC=%)M0;T.!E3D' XKI$\.:3'H(T--+LET06_V4::MN@MA#MV^7Y>-NS'&W&, M<4*K;S#DN>"?'K]I*TM9=,\"^!M?TBV\5>(K-;I=>X<[I)960GYW M))Q].PJU>_L^?"S4EMEN_AKX0NEMHA! )M!M7$48)(1%O#6D>&K>X<230Z/816B2,!@,PC4 G'&36;E'ELBDG>[/"/$^H M:?H'[=6AWOBFXM[.QN/!\D&@W-\X2(70N,SJC-P)"A'N17@WQON;'7(?VK-1 M\-R0W/A:6TT:">>T(:VFU!9%\[:1\K,%(#$=^M?>'C7X?>&/B1I0TSQ5H&G> M(;!6\Q;?4K9)U1O[R[@=I]QS4-E\,/!^G>$&\*6WA;1HO#+#YM'6PB^R/R#\ MT6W:3D Y(ZC-7&HHV?\ 6XG%LF\">&])\,>%M+M-'TRSTJU6UB ALX%B0#:. MR@5\U_&[PUKWBO\ ;3\#6/AWQ9<^#-0/A"]?^T[2S@NGV"X7*;)E9>W0W,<3'+1K) MC<%)Y*@X-9QGRMLIJZL?(O[2_P #],^$7[+?Q+U)M6U'Q+XFUR>QGU;7]8D5 MKBY*7,010% 5$49PJC KT#]H'X_^";#X*ZOH&F:]IWB3Q1KNF/I6F:%I-REU M=7,\T?EJ!'&20 6R2< 8]:]Z\0^&](\7:1/I6NZ59:UI=Q@36.HVZ3P28((W M(X*G! /(ZBL3PK\(_ O@6\-WX;\%^'O#UV05,^E:5!;2$>FY$!JU432YMT3R M]CR7PO\ KXH:+\/_!&C:+\7+CP9%I.B6ME=:;#H-G?JTZ)\[>;,"W4XP./E M]ZY[PCXLT7P7^VI\4SXB\0:=IAD\.Z.BW&HW,=L)W"MN(W$#/? Z9KZHKC/$ M_P %OA[XVU9]4\1> _#.OZFZJC7NJ:/;W,S*!A07="2 .@S252]^;J-Q[&-\ M5O'/AO4_@GXQOK/Q!I5W93:3>V\5S!>QO')+Y#_(K!L%O8.&57:)M@X8 _*>.AKKI/@A\.IO#T.@2> ?"[Z%#.;J+2 MVT:V-JDQ&#(L6S:&(XW 9K3\'_#KPG\/(;F+PKX8T;PS%=,K3IH^GQ6BRE7E0[.]SYY_;7;4+7Q5\&+W^W+?PUH,'B"47.L7UFMW:V= MRT)%M)+&S*I&[> 6("DY[4ZU\(:1IOQ.N/&WQ ^,?AWQ:UOX9O+.[TNWTR"T M\[3R5=WE"3N613TRO\6 >:^E]@+DIXOL]4M-/U32YV^&7]LRJZVVG&9WD@ P-LY0HPR2? M+P*Z#X'>)? OA_\ 9:^+(\07NCVXEU?7EOH)I(A--F201JR_>9CP%!YZ8K[" MU;PAH6O-IK:GHNG:BVF3+<6)N[2.4VDH& \6X'8P'0K@UXC\%?V1?#'@[3+B MX\9^%_#'B'Q,-:O=1M]3%FL[I%+.9(E+R1@[E!]" >AJW4C*[?D3RM:(\7^ M'@O[3\9?@M8^+M+AOM0L/A?YRQ:C LC0/]I 0X8'#!&QGJ.:U_#<'B*U_:A^ M,EA;_$?2?A[JLT]G-:6^JZ+#=/=Z>( (S"\DL>$0A@57(!.37V*WAO27UZ/7 M&TNR;6H[=N<9YK#\=_"/P5\4%MQXM\*:1XC-O\ MZE]1LTF>('J%8C(!] :GVMWJ/DT/E"P^"NEZ#9^$W\)_'#PV_C?2=_'F";3O$GB;PEX"^)'@KQ9$= M,\0Z:!/I.L726Y8+ME8%F"-@J6)7C [5]2ZG\!_AQK/ANT\/WO@3P[<:)9DM M;6#:9#Y4!/WBBA?E)P,D8)[U+/\ !'X>W7A"'PK-X(T"7PW"YDBTMM.B,$;G MJZIMP&_VAS[T_:K=[_(.1GQK\9OBQXG\7?"OXL>$O&-IX:O=?\/7&B%_$/A4 MN;6[CDNT*1OO)99%P25SCYC@#O[#\'M8_%E]9:;KUS=V=Q:R:E M*D1ETP6X">67(RBL&SC@'K7M^D?!WP)H/A:3PU8>#="MO#\LBS2Z8FG1?9Y) M 05=T*X9@0""E+XY^$/@CXFRVLOBSPEHWB.6U_U$FI64Y\):%86>K^%?!7DVL5QX,U#XURR:-!)&&MY+,[\;%(P8 MRX?':OI+Q%!';?MW>#'B18WG\%7R2%!C>JW";0?7&3BO<)?!7AZXL])M)=!T MR2UTF1)M.@>SC*64B#"/"I&(V4$@%<$9XJS+X7^NG^0^76YX/^Q%$MM\/_ !K;1*$MX/&NL1Q1KPJ+ MYPX [#DU]$UG:)X*?^P5=?\ HEJX;]DK_DV_P!_V#5_] M":NY^)/_ "3KQ3_V"KK_ -$M7#?LE?\ )M_@#_L&K_Z$U>G'_<)?XU_Z3(\V M7^_1_P #_.)ZY1117F'I!7Q1\1@?^$_\2)X]Q)#CD#MG\J^=OBKKVHKXL$DLC;[< M+]GFBDY51R!D?_KKBD[/5['LX>FIKE1]*SWZ1V1MW)CECD559AP<@@@_C21Z M[;/;V2K-ABF;H!@"K+QD^V'?$6N_;Y888IOM%T%<&52R'D@DGL,\UBI)]3J^JR6KZ'K%[J5KI.O:TEK> M+$MVK!B0"<;%(Q]=V,U=\/Z]_9K0VDD2K;.H8RDYVEB<9].#5VV^&WAM? MX MUU>P:AXO*O&;J!R664XPH7/W1@#./6L*/P)K5P/(AA^TRR((WF'RH,# (SZ< M4^22V6@DZ3W9ZU>>*8[UEMGR+1%4B4'@9[_R_.LGQ9X^'AF"*YF1I0Y$, C3 M>TW(^Z.[=VUW0M&N=,U74;#:V[Y,[YE0#!X'6KOAN?0M):TCO+I[UO M.+--?@JX<#.X*>%^M:1BWJV8:Z>6W%VSE[8PSQ?,AE4Y=1-K M=3F4N%4;7&2"#^?Z5=G#IJ".DF\$8"CG /7/XBI8I%MV:%WSG)4-R?SK78@CMX-I7 MY>"!S5>ZB66[,+*'1AG.>4XXQ5V20N5V-AE(.#W!J*.%I$EWY^8\'H:GU IJ MS0K;KL\V6-QM7NW/K7Z9V^?L\6>NT?RK\RK9_,U,B1MKHR@#LYMYM0F2\N JO#(W7YLY&/I68E\FEZGJ\$UY)=7'R M"(RMS)SG&:T_$/A>\U'Q-=VFJ6C26MF?)AGCRI?DX^;MR36'X@\*66CFQN3* M;E)6\J6%G):)QD4 M3@XX/S8'X5YWX_\ $&FW]IX>&BVR2W\!9YH[),%(2N&0CW]*Z[5%CUGPEI4U MYJ\\,MI!Y?E2L")4;[N#G[RCCD>E86EKI^BQL5O7M;N!" \J!D="< D]OK4) MIRLC&*<5KJ<.FH7GB6_N-0L!'"4(B#*=I4+C&(^N17KWPK^+=QI&N[=4>2=Q M"%GVMT.0=P'<8'\Z\E;0K._U77=3BN'MH!=DVT^=B28 )/'7)Z8J+PMJ-W>^ M(CI<1AMYKZ58MTH)5<]]W8$=153BX[&J4:B:9^@.E#3]6CCU.*(><,MN(Y!( MK-N]0>W>63<2S2*@'MFO#_#OQ.UCP!XYTGPIK$J7<5_ Q655VNC#]"/0UZ=X MB\466FPV#O()/.?IQS7G&N?&+3=.+;WP!C,$[!9"3W([BN(^(%UJ% M[XPT\:7=22V[JB[8E! 8'YL_Y[5+K72:*C13;BSZ-N;>WU&"".Y7=&3G:>V. M]>9>//$Q@EN=-T=4A1%&V4C[SYY^N,UTG@3Q!KAO MX43R\2VZTFPHHHKI.4**** "BBB@ HHHH **** "BDHH 6BDHH 6BDHH 6BD MHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BD MHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BD MHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH \!^&G_)X/QE_P"P M;H__ *)->_UX!\-/^3P?C+_V#='_ /1)KWZO3S#^+#_!#_TA'FX#^'/_ !S_ M /2V+1245YAZ0M>-^+_VI?#/A?QAJ?ANRT'Q5XOO=)"_VM+X8T=[V'32PR%F M<$?-CG:H8X[5['7QQ\._BEIO[/.N_%?PAXRTK7DU_5_$=[JVE-8:/<78U>"X M4&/RGC0KE<;2&*@>O!QK"*E?2Y$G8]D;]J+P_=^ /#/BW1/#?BWQ19>(6E%E M9Z)I!N+H"-BK-(FX!!D=2U-TO]K'P+>>"_$OB+4%U?PZWAR:.WU31]8T]X=1 M@EDQY2>2,[C)D;=I(-?)G@#XE7_AGX,_ G0=7\8ZC\-?A[J]KJ4NI>(M.14G M:=+AS%;>>480[@2=P&3C&:3PK_PJW7=0^.Z>(/%7B>_\!W+Z$(O%-])<37T< MH#F.Y$CINV*X&'VE=N/X>:Z/8Q5_ZZV,^=GT9XZ_:T-K\.O&%Y8>"/'/AW7] M/T>:_LEUKP\R*^,*)!AF4JC,K."057)(X-)X*_;#T>U^#6E^+?&VC>)M$2.# M3XKS4]0T9K6VN9[@!?,@8D*\>[+$KP%(->0:3X]\5^+(/B/X!T#XB?\ "[?" M$G@J]N%U=;"-)["Z*E8K9IH@%F9QDX/S?3',/C7XI^$O'_['WP^T?0M;M-4U M+1[_ ,-P:E91G]Y:N)D0K(I'!W(PP?2CV:VMU#F?<]QO?V@M#\>>(/ 4NB:Y MXE\/6-YXB.FQ1R:(8H=:/DF0+F8!EA(!(D49SQ6IX@_:X\*Z1XBUC2]-\/\ MB[Q;#HLQM]4U3PWHKWEG92C[R/(",LHZA V*Q_VGU)^*'[/ZCY3_ ,)6(3!W&W"D9R<]./6O$]-_; M\)ZYJRQ:3X=\8ZOH+7@L!XIL=#DDTDR[]AQ,#DJ&X+[=OO7I?CJQN?&7PQU^ MSTEVCN]4TB>*T=OD(>2%@F<].6'TKYZ_9M_:6^'/@KX/>#/!.LZLF@^,]+BB MT2Y\-3V\@O5O VP@1ALZKIHU33K/0=.>\DO(BVT",)_$>3S@8&217QA\0/BE9>/OA-\2)OB!\4/% M-G\1%;4+2+X?:7)):VULJ%A&CP11YECV ,TCMMQG->Z_#$Y_:9^%G_9)X?\ MT;%6SI1BKM$*39ZUX>_:D\":U\._$/C&\GO_ Y8^'9VM=7L=;M&M[VRF&,1 M/",DLVX;0N/4?#?B[P9:QV,NHKJ'BC1GLK66WC +NL MF6'"D'#8..U?+/Q4T6_O?%/QSU.ST^?5+/0/'7A_6M2L+:,R/-:Q0 RX0?>P M"&(]%]J]>^.OQH\'?M&_!+QCX*^&?B.+Q/XHO]':\BL--1VD,4;H[HQVX1F MVA&P23C%3[..EEO^&PUG2&M]/ MOI&&8U20L64N!E=ZKN[5):?M9^!=1\>7?@VR36K_ ,0VFK'1[BUL],DF$#@@ M&:1URJ19.-[$9P>.#7SSH.J_!CX@:9X/L=7^-OCG5-1^W64D/A.]NT>>&]C= M=D3P+:[EV.,$Y !YQS7LG[)*@>)/CFP4;CX\O 3CD_NXZ)0C%-V8U)L^B:* M2BN4U%HI** %HI** %HI** %HI** %HI** %HI** %HI** %HI** %HI** % MHI** %HI** %HI** %HI** %HI** %HI** %HI** %HI** .=^)/_).O%/\ MV"KK_P!$M7#?LE?\FW^ /^P:O_H35W'Q)_Y)UXI_[!5U_P"B6KA_V2O^3;_ M'_8-7_T)J]./^X2_QK_TF1YLO]^C_@?YQ/7**2BO,/2%KX;^)&J;/B+XH1P! MC4[A1D]?G-?<=?F3\>/BMI=E\:O$>G1MY-U#JMU&S7*XB9A(0>>V3QN]JSGJ M;4H\S)=?TAKE93E0QZ+@'K7A?QE\-W.EVD4^ZW<,V #@RXQTP!TKW^UGAUK3 MHKF&>)E9?O1/O!^AK@/B/90&R3[=!/(@WLB=20,=3]:XJD8O5GI8>< MHM)'E'[/>AQZ;K-]%K3Z7:V5]#^Y-R1YRR\A67^[U.&=/U/3U\%65Y->-*J-(M,O]0@MKJ_N;;Q9/(K7-FJD0PN7**ICZ9"X8@UA'1V/3K1E+]X> MA6=WX;\ 6:27%W$SS!Y62- )I<] %'(JMI=WJ_CJ&V73G_L71'4A9$3;*[9Y M''2JD_P.:YKQA]O'A2_L[26.V58Q&)0,%G)'RC'MFLN M6^K)YY2:U.3\#7DFJ07LEW=16<4*/#:Q2/Q@,-G': M:1(UC50Q9FXV']>:X4VUKX:TL22()7MH@(RZ9+MR6/UXJYI-K<>)+/P]<)%_ MQ[*9-\P.)RP4D_4,"?QITZCC'T-JL(2GS/86TUG6+*.75GT>5;!)FA>))%:> M,+DEBF,=!ZUO1:U:^*! ]EB2U=-R3]#O],=>!75S7,*Z=*;J$;VP9'4=!C!S M7C$OB;P]X(\;W]Q!,+>P=0S*5)C1L$D* .IX%;*M*]I&*IJ:?*M4>E*LLH(D MP9%!0R*>OH34[32"YA0 M&$.YL]ZRH-:CU&WBU&S_?6LR9Q&?O#_ !%20PR/ M=17#LP#)P02%89X.*[%KJM?IE#_J4_W17YFSO] MJO8TY"@C.#CN.*_3&W_X]XN/X1_*BQA4U2/)/VG;?S_ 5B>\>HQO_P"0Y!_6 MOF-;!)99'QRV#GW%?47[2H)\!6N/^?\ 3_T7)7S7"04E49QL)7WKR\0E[0ZJ M'P'AGQG\#ZG?-$^CO;Q1R$";S@058'AACOSWKR#QQ\.-/\*^%4B^U)-JYECW MS;RQFM)PW/=P\G))7#PM\-Q<0B"ZN#LDMA]E,J;E,A )*CKUXS7DW MAWQ3K/A_7[S3K[2$\10*7LIHF(++@Y&T]B/>O7O#$IU2W%NFH7EK';+B5$F* MKT((/H.*YF?PC;V>L:U<:<7C:"W\Z92BG.T?>SG.?6L5.GRZ(Z4IN34F8&M> M(/!NI>'+?^RH[VPE9RTD!#2?9W!Y [<],5!X#T2PUW4(+>2.]\] \R1@B-W8 M D$-ZX'I6=!H5UHN@W%ZFFW5U8W3F9+O[(^!D#.#]:]/^$NJZ/X:\9Z#XCU@ MM) \9A(VX6W8C"N1Z=?I3LN9+H:MN,--6:.J?#Q;_P "V'B'2(+J77M/NVDA M&H2EIKN#C?&@].3CCM67J'Q+L-3T6![-+A(K(].GTVY!FLT=(_+&Z/# @C(/'8U\\>)] N-&US5OLD,@,TGVV*(C.4)^; M:/J2<5I6::M$Y\.W)WGN6- U6/59KV9E\F?<=H<]% [5RTU]XHN/$_\ 9EMJ MWG>8?-B!16"A>>>.@S6IK4\2P1O!/ABH.QCSZX_2JO@"'2M6U?494U-M.UF* M$M#N*MYGUL[TVVVT6*7<2N"S#ZUVJ%IV9PU M9RY+KL=SX?LXM.LOL*$!82"S=V-<-,YXR?8?TJWX9\7Z7XHU:$W5VT>L0LP18VX9> M@'([XKIR>[DMO.;/WV42X)'K@U]!5ZV&5J43R<6^:O)^GY"T4E%=1 MQBT4E% "T4E% "T4E% "T4E% "T444 %%%% !1110 4444 %%%% !1110 44 M44 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !111 M0 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% M!1110 4444 > ?#3_D\'XR_]@W1__1)KW^O /AI_R>#\9?\ L&Z/_P"B37O] M>GF'\6'^"'_I"/-P'\.?^.?_ *6PHHHKS#T@KQGQ_P#!_P")/BO7=8;2/C)= M^'/#>I@(VD1Z!;7$MNA0*XAN&(9=V"S452DXZH35SF/ _PYT/P!X# MT?PAIMJ)-&TNW2WACN@)"P7G5:6\5M%G=LA0(N?7 I+:PMK-Y7M[>*!Y6W2-&@4N?4XZFK%%( JO/ MI]K1^%6** "JYT^U-X+LVT)N@NT3^6-X'INZXJQ M10!"ME;I=-?4 MXZFK%% %9-.M([QKM;6%;IQM:<1@.1Z%NM6:** "BBB@ HHHH **** "BBB@ M HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** " MBBB@ HHHH **** .<^)/_).O%/\ V"KK_P!$M7#?LE?\FW^ /^P:O_H35W/Q M)_Y)UXI_[!5U_P"B6KAOV2O^3;_ '_8-7_T)J]./^X2_QK_TF1YLO]^C_@?Y MQ/7****\P](*_*O]I7]GR_\ 'GQF\236EW]ALSJ]U-(TK;Q)OF+LN!R!FOU4 MKXD^)5PD?Q%\1*2,G4)Q^.\U$I..QK3FX.Z/.[#P;:^&?"<-G;C)MANRHQGU MQ[5RGB-+:+1KN-[:.YA"[I&N6 B!ZY/KCWKT^Y)^R3 9V'&>G2O!?',SZMX M:FL[=UN+JY&=H4[.>N!WX[]!7#)]&=U%17L'P1\/6L7B_5KJ^#R7#M$$<$]_K75K$$!&,9JI)I0<%3(0. MX YK2R.>+L>>Z]H%O?P/$VV)G**I !(/M4/ASPO_ &"8([>X>2WB MX^M=U<: ASAMBWF*76X "AL[_$-VX^41!0R@')Z'C.*]BU6T2\M6$F/D!*UYUJ&J6FBZ MN8TMVS)%B24<)&1]W)_A!R>:F2+IRE9J.YAZ39#POX@O-$AMS;Z>Z^=;'<"" M?X@!VZ@XJUK$]T[6\(E:WC.8_/3GRG[;AZ&LOQ#K<$GBO2'@$L5Z^^,HYS&R M$=B.O(/Y5KQ:?_:MCOE;89"'/EGH1Q7;2=XF=31ILA675-*OHK>[C\T[D'GJ M05=21\PQ7ZD0C1G[. M5SQ+P#X32(WM_?>5;6TJ IEQP.X*XZU+XL^'S7ND2RQDD2VY%U':L%WCC;N/ MI@=J]"U+PQ/!?#L\$\ ,\EN^PQKP JX4'ZGBN M.-'ECJ=KJRE+W=V>D^%+33]+\(Z;:[(8K>&W2/YP", 8ZU\U?$KX;:%%\0O% M-PLUBNG6EG;WKV18[8@S,'*@' )P#CWK-N-/T>_^%]R+[Q1JQGLD\Q+628JI ME[!5(SC..E>9>*O#4L6C:?/.]U#K=TT;2S7,N3KCS)6&3@>N,9K"$KR:2W*J\OL^97,CXA?LV6?B)H[S2W;3[E4 M)E"@%?8[>,?A7E7A_P" 6H6/B",:AY$EI.XBEE\KH!G( /.3G.:^O;/6#>3! M+>!R&Y9FXXJ;4-$2[G\WRU5L;6D Y'?C\A6[HN.J.6.*E;E9X;=?!W1+PI8Z M)9@7D>-LK.RKN&?P(Z_E7I\/@K2M T>0W]I%/<)&7>0*<*P4CC/3BMR?PQ)+ MI$J6#A;E@HCD9\%<,3C/;J3^-:&I6K2VKQ.-Q"%6!Y#<'$B84;0. H)&0*Y9KD=GJSUJ:YE=:(_0W_@GUXTO/'.F>.;^>,) + MBU2,C@EMLN_CL,XKZYKXB_X)BV%]IF@_$*VNPR1+>VIBCD'S#*R[B6Z$$],5 M]NU[N$=Z$?ZZGR^.26(DEY?D%%%%=APA1110 4444 %%%% !1110 44E% "T M4E% "T4E% "T4E% "T4E% "T4E% "T4E% "T4E% "T4E% "T4E% "T4E% "T M4E% "T4E% "T4E% "T4E% "T4E% "T4E% "T4E% "T4E% "T4E% "T4E% "T M4E% "T4E% "T4E% "T4E% "T4E% "T4E% "T4E% "T4E% "T4E% "T4E% '@ M/PT_Y/!^,O\ V#='_P#1)KW^O /AI_R>#\9?^P;H_P#Z)->_5Z>8?Q8?X(?^ MD(\W ?PY_P".?_I;%HI**\P](6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH M 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH M 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH M YWXD_\ ).O%/_8*NO\ T2U<-^R5_P FW^ /^P:O_H35W'Q)_P"2=>*?^P5= M?^B6KA_V2O\ DV_P!_V#5_\ 0FKTX_[A+_&O_29'FR_WZ/\ @?YQ/7**2BO, M/2%K\M_VI?$O]E?%;7FGN]1MH#KDD1^Q.5ROF.&/'I\M?J/7Y8_MAZ;)>_$S MQ/<(RQ1VMY*2=I^8F;.,CG)('/YUC4=K-G7A4G.S/1?"VIVFK:);3VDPN(=@ M7=NW$X'?WJAXA\$VNH022VMNL5WZJ,97^)1Z9&>:\Q^"_B]QJM_:I$RV4FV5 M/-;+GH,X[=Z]FL+J7[=);SJ=S+YBMU&,US6NKF\DZ<['#7'ARY::RB&FW A@ MA55 3/S;EX./IFND7P_J%Y)$?)2$H5)D9@<A%8V$=C;K$!O[EB.M31QQVP+(@CR1Z@UQOB3Q[9V2$R F-F!"M5^352DTN3@+\X&>W/^%<+J6HW=GJ>E6+6PMY, MM*LT9WHP1'VFL9T&4M923)*HY*^F!R3T%)X1TZ[L;2*WO()$ MG)+S,PX ' Y^@%7KC6I83-,ZXC4D>6W1E_\ U5$K,(^Z[Q/'/$W@I[#4=&U7 M3U.FV\;A9'D?DY.,MSQG)'XUW5G:YKXU65[K7A M2.;2YI'M/.CD"(>0 >01WQUKI9-.$D%F8V(#QC>R\$G;][ZUM0LM#2K)RBFR M'3M/@ANF^2-=TI.X'[WS=?SK]0X!B",?[(_E7Y>6\*VURC%C(=Z)O)Y)S@_S M%?J' J= 22>>^*6;(0,".N#BJMU,T?G28W*GS*/H*Y6=2'7:!]1M^=L2J68= 35 M'6-,T2YU%KG4S$P$6W;* 5"YSWIMIYVH667<>*_ 6C_ !"BU(:,+."RMU -R4/S2GHJ =#G@FO M+_P7'J-F;*2VNVO9#S7&>&_@M&CV5QJUU-=W%I\P*'"LVV *](TKPZNJ>,K^X_M:2.P0JD-E;@@(!UP? MYD>M=;)H4>DV][>!?,D9!B-?ND].E3Z'HOV/38I6DQ<-&"YV 8)[ "NJ%-03 MMNSDJ5Y5'=FA/>MITMK!8V@DM6RLLH/S*.Q]ZL6?B"*:X>U#LD8^13(OWV'W M@,=,>]9>LVMV=$N4TV11>N/D+'&.>>O\O *^_/4=*RM&\?IXC@D,=L;1@0! MYP(!_'Z5U%W):2Z8S2Q@(4VMN/7CI6!I4&E)H\^FM&1;NC-Y+?? [@'VQ6\> M6US(X75/A'#XD\?!VN!'IIB:*]J\!WIO+J6Q D6VMP5MIF)W#VS7&?$7X.276KW=U' MY+8]O_P"";FM2>(8?B7?B(Q6,EY9K;*># MM"2Y)';.0<5]IU\H?L%^#V\(6/C>)A&IFGM3LA;;+_?H M_P"!_G$]+/$S^8ZQ)J,[.J'KAVQD=Q[5C5U2.BA+EG<^8_A;I4R>---TZPO3<0 M^2)WN4P=T75E;W#9P?>OJ,VR2303*[*R^G\0ZXKS_P"$_A6VT=+[4%MTAN;Y M@S;%P$7LH_F<=Z]'0 =S7/K]1*?&DL<&C23R$ M[4.T@$^-O%6H064@5K>4B)PWIW.>WMBN@OOA;KGA;55U[3[F.VG2,O);NV8[ MG'WE0C[IQT4_@:CGO([71IN/+>S/H'7T-S:6URK$M:7 D4^JG(8'ZJQKJ+2\ MM;'1EGBD6X55^5E.<^U>4?"SQW;_ !#T>>!7\JYC3$D4APP/8X/)'O7$:;XE MUWP?XTU72-0MYGTMY6E0J<@$@!B#^1Q5\RCJSD5&4KP>Z/?+O5)5+;IR&>(M MM[#VK&OK28R&5]T\9/W /NC_ #_*JN@^(;;5[-Y)7S@!,#JP SFEU3Q+9:3) M%*[;@2"JY^8KW'\Z=U):&23CHD>9:[<>(]2\3SZ;IL306 G266VD ^5!]YU) M/^RR6L4K?VA*V7C!(^1./YUT45:]R:\[):'QU;H;HK&VZ*1Y25;K@Y MK]0K8YMHN_R#^5>5?"[XI^&OB:]K;6NDK#J#V@O9(G@3;'&=FUL]<-YF!D0R?#B-1U^VH1Q_L/7S7(XDTZ"1?FR=G'TKZ<_: M/_Y$:T'K?H/_ !R2OER]S%8,J'8$#$$#O7EXCXSNP_P$22,MZL!<\C(SWK0N MK<%60_\ +1<'\JR=/G6\42; 9(RRALYXKKT-*,1R/AOF YV]JXWQW\0;/PE/I]N[*9;R<1A%&6 Z9P*Z330\:-N. M=[9W$\US3^!X]:\5'4)+C,ELWF0[AP&Z?RJN96N.*CS:F;\;V/@[X=7FKZ7Y MAU9BD,;1DEF+L!@"OG?1-0:34&6\-Y9S,#(R7P9) V,]/J,5VO[0/Q$EU/7+ M+PC;W<8N+.X,LTL?WE=0"HYZG/-9W@>QO?&VJO!X@O(9PD>]'*#S0Q/9NHZ5 MRSG&VAZ-.#C!7ZGI5UXVUGPKI^AG5HX+FWU! JQH2)47HK$'(.) M+:&[AN%-S:;LLN,[ _$B75K2]M;.XNDU'3;1-UK.G#L.?D;Z$]?2 MK7P5DU@Z[+# '2RN8V:6'9A59<<@^XXHI5I*5B:F'BX<_4]\\,W*7=RXC"P) MSN@*C)?/W@1V_E7I]O\ "3Q1>V\4L6DF2*9!(KM,F""/=LUY[I.A0Z9.T\&T M&6/)7'/6O>_BSKWBK0O"'@-O"\-W.]Q<117GV2-G*Q?9V.6P#@;@OZ5ZU*G& MHVCQ*TW32L=)\#_!^J>$;75DU*S6T\YXC&JLIS@-GH?<5Z?4-OT-35Z$(J$> M5'G2DYOF844459(4444 %%%% !1110 4444 )FC-+10 F:,TM% "9HS2T4 ) MFC-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% M"9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+1 M0 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9HS2 MT4 )FC-+10 F:,TM% "9HS2T4 )FC-+10!X!\-/^3P?C+_V#='_]$FO-_P!I M?_@H-_PS_P#&VS\#1>#SK%I$D$NH7CW)BDQ+R!"NT@D YR3R>.,9KTCX:?\ M)X/QE_[!NC_^B37I_BGX/>!_&_B33?$&O^%-)UC6M.Q]DOKRT226+!R,$CD M\@'H>17L8UQ5:#FKKDA_Z1$\K INE.W\\_\ TMG5VUPMU;13H&"R(' 88(!& M>14F:6BO'/5$S7PFGQ$\3_#;]J_Q[XRO-;U"[\ VOB&U\.ZMIT]P[V]C%)]&O(- \3:C;Q03W-NT<=S'] MD53)"S##[6[KG!%;4VE>_P#6I$DW:QEV/QGMOAA\7OVA=>\2:A?76@Z,NCFU ML8W:7YY+<@1P1DX#2.5'&,DY-==X=_:4UVW\8>'-$^(/PUU#X?P>)I#!H^HR MZE!>Q2S[=RPS", PR,.@.*+78].) ,4C +(7C13P3\Q&>37MGC/QG?_M/^+OAGHOA_P &>*=%MM#U M^WU_6]0\0:3)8Q62P*V(%:0#S)&9L83(QSTK>4(_UZ(S3?\ 7J?4/B/4[G1M M U&_L].FU>[MK=Y8;"W8+)<.JDB-2> 6/&3ZUXOI/[1OBO2_&GA?0_B#\++O MP/:^);DV.FZBFM6^HI]IVEEBE6, QD@'!^89KLOVCH_%\OP/\8)X#:=?%9L6 M^Q?9#B?.1O\ */\ ?V;MO?.,H^!?A9X]M]2T_Q':S>( M/$OB*PNRZ (V\2O,S$_-RS* @P.1D"LJ<(RBVRY-IZ'O=Q^U9XHU?6?&>G^# MOA!J_BL>%-2GL+^[&J6]K"PC ),1?YI)",GRU7CCGD"I+_\ ;(L+NR^'4OA3 MP=J_BZY\;VMU-8V5I+%#+!+!@/'+O(5<,2&8MA0I//%>9?";XZ6GPK\4?'&Q MD\*^*O$&H7/C.^DLDT31I;N&>38@$1D0%4;(&=V."#S7):'I5]^S?XI_9T'B M?2M2NM0AM-?O;_3]%M&O9[=KC$A41IDL$#C=MSC!/-:^SCV_X.A',^Y[U'^U MW+H^@?$,^+O M[X6\6^#-/75;G0'OXKD75JYPDD-P@VD9X/'!]>T[_MJ_'?P/XBO\ MX1?"_6]&T:ZUC5/!>HZ9K5QHD*8N;B**/;+&B'&9 &)"]201UJ>6%TFAWD;& MB?M)>(+?Q3%X7\:_#6]\&^(M1L;B]T. ZI#>P:FT*;G@$T8Q'+C'RD'Z],W9 M?VI-$'[.MK\5XM,N)HKE8XHM%$@%PUVTWD_9MV,;@^1G';.*X2?Q%>?M(_'? MX9:EH7A?Q%HWAOP;-=:EJ.J^(-,DL TTD/EI;1+( 7;));' ZURNB_!7Q7! M^TP?!4NCW2_":PUZ3QY;WYA;[,UP\8"V@;&W*SL\FW.<2V@WJ3.Z X/"C/&:KZG^U MOINH>'/!,W@CPSJ'C/Q-XOADGT_P_'-':R1)$<3-<2OE8@C J3SDCBO"E^&W MA/X5_$'Q_:?$[P!XRUN+5=Q9MO(XD MY^8_*-G/45%^SU>ZQXM_:+^+'C&Z\(^(?#&BZM8:4FGOK]@UJUP(T=68 Y&> MAVYW $9 )Q6O^V)I.J2^&? NOZ=I%_K<'AKQ98ZO?6NF0-/<_9DWAV2->6QN M!P.U3I[177;\@^RSS#Q%\3?&NG_M7^&-2;X::I-XGN_!=Q"GA:WU*V<1G[;Q M)+&=1CTB^\-)*EW/)= MRX\B.!UPLGF;A@\#KV&:Q/"NI77Q%_:Q\/>.=-T#7K3PS+X,N;07NIZ5/:*L MPO!A&\Q1M8@%@#R1STKRKXK_ /\6>-]6^-]S9^&M0O5A\6:-KEI9.LEL-8@ M@M]LT=O+\NXX9@"IX88SFJM&5E)6_P"'"[6J/H#P[^T#K\'CK0O#/CWX>W/@ M>;Q"DO\ 9%V-5AOXIY8TWM#)Y8'E2;>0/F!P0#6%\.?VL]5^*NG&_P##GPI\ M27MA$MXLU\TL4=OYT.\)#&[$&5G* 95=JEP">#CBOA=IOPBUCXA>''\/?"?X M@VGB*TE:9;S7+?4TM])D\M@6E:XF,>>J@*&R33OAUX8^(GAK]A+7-,\/:;JF MC>.E;47M+62![>\ :\=B8U< AVC)*'N2".U2XQ[=OU\QION>A:3^T;XKTOQI MX7T/X@_"R[\#VOB6Y-CINHIK5OJ*?:=I98I5C ,9(!P?F&:R[C]JSQ1J^L^, M]/\ !WP@U?Q6/"FI3V%_=C5+>UA81@$F(O\ -)(1D^6J\<<\@5X)H_@KPWK7 MCSX-ZCX%^%GCVWU+3_$=K-X@\2^(K"[+H C;Q*\S,3\W+,H"# Y&0*[+X3?' M2T^%?BCXXV,GA7Q5X@U"Y\9WTEDFB:-+=PSR;$ B,B JC9 SNQP0>:MTX]%_ M5_4E2?5GIFF?&[PK\2?B+\%]>L#K4:Z_I^JW%L!?&"V@\J']\EU ,B1E.X Y M^4C/-)>_M::L/#UYXVTSX9:GJ?POLY'\SQ*-1ACGD@1]KW,5F1N>($$@EE) MSBO+/AW\ _%GA?5?@7I.IZ7=PRC3/$KZMQ%DCDD4%5(+[1D\D' M&:Y'P!X ^'_@#P/!X+^)?PA^(&I>,=/$EE(NBIJ=U9ZLH8[9(&BF$.UE(R#M M .,[32[>TTK6/!MM=L+U%@7R86DBW([1G$;"3!^7 M[Q&*^H?@4/%P^#_A+_A/"Q\7?8$_M$N%W^9_M[>-VW;NQWS6,XI131<6V[,\ M*_9U^,OQ/\1_$CXBZ=JO@C4M1TF#Q1-;/=3:W:LNB1B-2(!'NW2 <'Y,CYOK M73ZI^T[XS\%'3]4\;_!W4/"_A"[O8K)M8&N6UU-;&5PD;RVR#A\1^*=9N-3\.:G#IX884;F"C"DL>@KRW]H#]I_Q5KVT>I0EK".5T:.:.48$TG?#"WTZR^#_ (]\4^$-?\7> M";GP+::3>+X<>Y-UILZXDCE:.W=9'C96(.,@'DCI75>+?A]X9\8? #XH?\*I M^&OBW2;VX6PE>;6X+M9M7$$XDVP)K?$;X1Q>-/!NO>#=9O\ 4;R"PMK?Q!#-;RJELKF2X2'*R*>0%)!!&:KW M'[8'B+4+7Q=>^&?A!K/B#2_"FH7=GJNH'4[>VB"0'YWAW_-*VT%B@' Q\V36 M=J_BJ;XS_%;X$^(=!\,^)H-+T;4]0CU"74]%N+46Q:R !?>N I8[0QX+ @$U MI?!+PCKFE?"/XVV=]HNH6=WJ'B'7IK.WN+61)+F.1?W;QJ1EU;^$C(/:HM%* M[7]7*UZ,Z37_ -J6WN8O!MGX"\+7OCOQ)XJTT:S::5'^Y\%OCE>_%+Q'XP\/ZOX0NO!^M^&)+:*\M+B]BN@S3(7&UX_E(P! MSWST'2OG7X6^&O&_P.F^%OCYO /B#Q+82^!X?#NK:3IENO\ :>G3I+YJ,8)6 M0D'.",C&.>V?0?V4]&[BYN]+SIMY*DDT(%J=HL@ ! [_I6CX?\ VH(/&NO:3H^@?#WQS-IPM;IJ,5 MFD""ZF/F/++D < 8 )YKL1^UM+HWA?XBS^*O U[X<\4^"+.*_O="-_%J6]C#!/LRT47F_ZYU!Y *X/&:\F\7?$/5OC'8_!72-%^'/C>W;0?$FEW&L M7>H:)+!!9&)"CJ2W+ $DEP-H &2,@5M>!/&&J?L]:[\3O!FK^!/%FN76M>(+ MS6-$O-"TIKJ"_BN0"%,H(6-D(PV\@ :[C_AL_7M1\-:]XET3X/ZUJOA MKP]=W5OJVIMJ=O D:02%7>!&^:<@*6( '3)-<2/)Y12,C,U:-\#_ %8:A:SV-];:'9Q3VUS M&8Y8G6%0RLK %2#P0>17BO[7_BF]NO$WP\TO3?!GC'7'T#Q18ZU>W6D>'KJ[ MMOLZ*^[9+&A5G&X?*#FL8+W[(N7PEW]M#Q+-X;N?AY)K][JNF_"F;4Y(O%-U MH\TL,@!3%NLCQ$2"(OG=L/.![5'^RQ?6UQ\4OB!!X#UF]USX/0P6@TZ:ZO9; MR&+4"I:>.VEE9G*!2I89(#'%)\;[_4[OQ]\'?B>WA7Q!K/@;2Q=R:AHZZ9(U M]8331A8;F2S(WY3Y@>"5SGO6?\&].F7XV_$?XE>#O!NJ^'_ D^A)&FFW&GOI M[ZUJ,99S-%;,H8?*-F\H"Q;H>:T_Y=V_K?\ ,G[5SWWXI?"ZQ^+.B6VD:GJV MMZ781W GF31-0>S:Y 4CRI'3YBG.2 1R!S7AGP TY_ '[3OQ \ ^&-9U75O M>FZ/:W4UKJ5])>+IVH.Y_=1R2$L-T?S%<_RK5^*?Q^^($7P"\/\ B'PW\-O$ MEAXJ\1RFUET]=+GO;G0DRX:>6!8PS$*H*JP4$LN3CJ_]EGQ#X>\/VZ>$-'\" M?$72KVZ\S4-1\1>+O#LUH-0N3S)+-._!=B>%]!@=*A*48.XVTY(^C. M6G[+WA>SA6*.\U *O3YT_P#B:G;]FKPXRD"^U$>X=/\ XFO7**7*NQ7-+N>2 MC]FWPX,?Z;J'_?2?_$TO_#.'AW&/MNH8_P!]?_B:]9HHY8]A[44G"+Z#4Y+ M9GS7X-_82\%>"[NXNK?6-;N[B=R[RW$D9)SCCA!QP*T==_8J\%>(]->PO]0U M::W;) \U 5/J#M[5]!T4*U?\ AAKP66C8ZMK+,@ZM)&23ZGY.M?1]%+V<+6L4Z]23NY'S MI9_L0^#K#SA#K&LHLO4!X^#C&1\E5YOV$O \Z,KZMK1RP8'S8\J?4'97TG7C MOQJ^/-U\*/$.G:;'I>DB"ZM&NAJ/B'5VTNTFD#[1:Q3F&2/SCU D:,29IB;@@MD@ C@#CBN9\5?M$^'?#%GJB207YU>ST^ZNX[6:SGCM[B6"V M-Q);I=^6T+.$')1F'!QG!%9V-Y#_D1VNZ!-I,49 M8QI]%+O@?[1K%+OP?K'B9[ZXLM+T>5X-0^W6,]O/;R*%.QH702;B M'3: I+;UQG-8?AS]H?PYXO\ '>C^&=&M]1NI;Z"\DEGELIH/LNX51!WGB3PMI?B^Q2SU:U^UVR2"54\QTPP! .5(/0FN8D^!?@> M565M$)#=1]KG_P#BZQ_B+^T5X<\ 0ZW"8;Z[U;3[:YEAMY;*XM[:[E@B\UX4 MNC$8BP3DX)Z'J00.U\9^,K7P3X)U3Q+>HSVUA:-=-$A^9R!D(/I__ (NH_P#A1W@@ES_8G+_>/VJ?G_Q^N\HH]G#L@YY]SA1\$O!0 M((T7IT_TJ?\ ^+J#_A0O@41N@T1E5^6Q>W )_'S*]!HH]G#^5#]I/NSP/6/V M$_@;KVIR:A?^!Q<7DC;FE.JWRDGUP)P*U-#_ &.?A!X;F\[3O";VTOEB+?\ MVI>L=HYQ\TQ]:]HHJ?8TG]E?<:?6*UK<[^]GDEY^RG\++\@S^%O,*G(_XF%T M,'VQ+6AI'[.'PZT%9!8^'C#YG#;KZY<_FTAQ^%>ET4>QI+[*^XEUJK5G)_>S MA4^"/@J/&W1B,# _TN?_ .+KL[6S@L[:&"%-D42!$7).% P!S4]%:*,8[(S< MG+=C555S@8S2YI:*HD3-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T4M% !1110 M 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% ! M1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %% M%% !1110 4444 %%%% !1110 4444 %%%% !1110!X5\.M)OK;]K'XNW\MG< M16-SIVDK!?"O2/AI>^*KK2Y[R:3Q'JTNLW8 MNW5@DT@4,L>U1A/E& \35O#<5U%9Q1.H@<3J%? MS%*DD@ 8PP]\UV5%5S.]Q604445(PHHHH **** "BBB@ HHHH **** "N-^' MGPKTCX:7OBJZTN>\FD\1ZM+K-V+MU8)-(%#+'M483Y1@')]Z[*BG=[ %%%%( M HHHH **** "O$/%/[)^B^,M6U6;5/&_CR;1=4N&N+SPTFO,NFR[CEH_+"[E MC)ZHK@5[?15*3CL)I/7LY !DEE;EC@ =@,<"NVHJN9VMT M%97N%%%%2,**** "BBB@ HHHH **** "BBB@ HHHH **** .?^(<,EQX \31 M1(TLLFF7*HB#+,3$P '4UQ?[+.GW6E?L]^!;2]MIK.ZBT]5D@GC*.AW-P5/ M(->J45TJLU0="V[3^Y-?J<[HIUE6OLFOO:?Z!1117,= 4444 %%%% !1110 M4444 %%%% !1110 5P7C[X21>.K^:Z3Q/KWAXW5B=-O8=*DMVAO+.XA ME53\S#?&$?#8W<#'>T4 >"-^QAX'_M:6^CO]8A+0W-ND:FU+1136C6K1B9H# M.R+&QVJ\C*I P,<5M^*?V7O"OB[5);^\U#6(YI(HH2L$T07$< A7K$>=HR?? MVXKV"B@#@-;^"?A[Q#X;\9Z'?M=SV/BN\^W7H9TS%*$B13'\N %\B-@&#\^59PQW2W B#I)'#;HB@>1$1Y2H%^*/V/O!_BWQ3JNO7NIZRMYJ,EW)(8A:!D^T0-#(HF-N9F0*Q*H\ MC*IQ@ <5Z#XX^'K^,/A[XB\-2:K<2MJ43K;SW*Q_Z*V 8U4(BY164'YLL>,=G10!X^_[/46O>(]:\1:[XFUN:Z\0:>+#4]'!LI;-(#%L>W@D:U\^.+<2^ M%D4EOF/I47_#,]GYO]H_\)GXD_X2?=M_X2+_ $/[5Y'D>1Y&W[/Y6S9SG9NW M_-FO9:* /']!_9JT+PCJNGW.DZGJJZ5IMU'J5KH$DD/V7[9':BV24R>5YW^K M497?MSSCM7:?"WP;-X$\$V6E74R7%^9)[R\EBSL:XGE>:7;GG;OD8#/8"NLH MH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@#(\2ZU=:'8I+9Z1= MZU<22"-;:T**1P3EF=@%7CKGN*S_ =XX7Q5<:E93Z;G:-H6F^';(6>E MV%OIUJ#GR;:(1KGUP!U]ZOT4 )FC-+10 F:*6B@ HINZC=0 ZBF[J-U #J*; MNHW4 .HINZC=0 ZBF[J-U #J*;NHW4 .HINZC=0 ZBF[J-U #J*;NHW4 .HI MNZC=0 ZBF[J-U #J*;NHW4 .HINZC=0 ZBF[J-U #J*;NHW4 .HINZC=0 ZB MF[J-U #J*;NHW4 .HINZC=0 ZBF[J-U #J*;NHW4 .HINZC=0 ZBF[J-U #J M*;NHW4 .HINZC=0 ZBF[J-U #J*;NHW4 .HINZC=0 ZBF[J-U #J*;NHW4 . MHINZC=0 ZBF[J-U #J*;NHW4 .HINZC=0 ZBF[J-U #J*;NHW4 .HINZC=0 MZBF[J-U #J*;NHW4 .HINZC=0 ZBF[J-U #J*;NHW4 .HINZC=0 ZBF[J-U M#J*;NHW4 .HINZC=0 ZBF[J-U #J*;NHW4 .HINZC=0 ZBF[J-U #J*;NHW4 M .HINZC=0 ZBF[J-U #J*;NHW4 .HINZC=0 ZBF[J-U #J*;NHW4 .HINZC= M0 ZBF[J-U #J*;NHW4 .HINZC=0 ZBF[J-U #J*;NHW4 .HINZC=0 ZBF[J- MU #J*;NHW4 .HINZC=0 ZBF[J-U #J*;NHW4 .HINZC=0 ZBF[J-U #J*;NH MW4 .HINZC=0 ZBF[J-U #J*;NHW4 .HINZC=0 ZBF[J-U #J*;NHW4 .HINZ MC=0 ZBF[J-U #J*;NHW4 .KG_$GC#3_"AA.I3RPK/YAC,=K+-GRT+MG8IP0J ML0#UQQD\5O;JPM;\+:;X@NX;B^@>26V618F29XRH==K?=(SD<<].V.: .;'Q MQ\(^1;3?VK*T=PRK$5L+@F0E'88 CR>(Y.G>-QU4@3/\:/"49N ^L[#;0O<3 M![68%(U&2QRG0CI_>[9J4_"KPG]A6U&B6X@CE22- GRAPHIC 9 elev-20230417xex99d2g004.jpg GRAPHIC begin 644 elev-20230417xex99d2g004.jpg M_]C_X 02D9)1@ ! 0 0 ! #_VP!# ," @," @,# P,$ P,$!0@%!00$ M!0H'!P8(# H,# L*"PL-#A(0#0X1#@L+$!80$1,4%145# \7&!84&!(4%13_ MVP!# 0,$! 4$!0D%!0D4#0L-%!04%!04%!04%!04%!04%!04%!04%!04%!04 M%!04%!04%!04%!04%!04%!04%!04%!3_P 1" +M!34# 2( A$! Q$!_\0 M'P 04! 0$! 0$ $" P0%!@<("0H+_\0 M1 @$# P($ P4% M! 0 %] 0(# 01!1(A,4$&$U%A!R)Q%#*!D:$((T*QP152T? D,V)R@@D* M%A<8&1HE)B7J#A(6&AXB)BI*3E)66EYB9FJ*CI*6FIZBIJK*SM+6VM[BYNL+#Q,7& MQ\C)RM+3U-76U]C9VN'BX^3EYN?HZ>KQ\O/T]?;W^/GZ_\0 'P$ P$! 0$! M 0$! 0 $" P0%!@<("0H+_\0 M1$ @$"! 0#! <%! 0 0)W $" M Q$$!2$Q!A)!40=A<1,B,H$(%$*1H;'!"2,S4O 58G+1"A8D-.$E\1<8&1HF M)R@I*C4V-S@Y.D-$149'2$E*4U155E=865IC9&5F9VAI:G-T=79W>'EZ@H.$ MA8:'B(F*DI.4E9:7F)F:HJ.DI::GJ*FJLK.TM;:WN+FZPL/$Q<;'R,G*TM/4 MU=;7V-G:XN/DY>;GZ.GJ\O/T]?;W^/GZ_]H # ,! (1 Q$ /P#]4Z*3CTHX M]* %HI./2CCTH 6BDX]*./2@!:*3CTHX]* %HI./2CCTH 6BDX]*./2@!:*3 MCTHX]* %HI./2CCTH 6BDX]*./2@!:*3CTHX]* %HI./2CCTH 6BDX]*./2@ M!:*3CTHX]* %HI./2CCTH 6BDX]*./2@!:*3CTHX]* %HI./2CCTH 6BDX]* M./2@!:*3CTHX]* %HI./2CCTH 6BDX]*./2@!:*3CTHX]* %HI./2CCTH 6B MDX]*./2@!:*3CTHX]* %HI./2CCTH 6BDX]*./2@!:*3CTHX]* %HI./2CCT MH 6BDX]*./2@!:*3CTHX]* %HI./2CCTH 6BDX]*./2@!:*3CTHX]* %HI./ M2CCTH 6BDX]*./2@!:*3CTHX]* %HI./2CCTH 6BDX]*./2@!:*3CTHX]* % MHI./2CCTH 6BDX]*./2@!:*3CTHX]* %HI./2CCTH 6BDX]*./2@!:*3CTHX M]* %HI./2CCTH 6BDX]*./2@!:*3CTHX]* %HI./2CCTH 6BDX]*./2@!:*3 MCTHX]* %HI./2CCTH 6BDX]*./2@!:*3CTHX]* %HI./2CCTH 6BDX]*./2@ M!:*3CTHX]* %HI./2CCTH 6BDX]*./2@!:*3CTHX]* %HI./2CCTH 6BDX]* M./2@!:*3CTHX]* %HI./2CCTH 6BDX]*.* %HIF?I36;GB@"6BH=QHW&E<1- M14.XT;C1<":BH=QHW&BX$U%0[C1N- $U%0[C1N-%P)J*AW&@.0:!DU%1@YYI MR]*8#J*3CTHX]* %HI./2CCTH 6BDX]*./2@!:*3CTHX]* %HI./2CCTH 6B MDX]*./2@!:*3CTHX]* %HI./2CCTH 6BDX]*./2@!:*3CTHH **6B@!**6B@ M!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@ M!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@ M!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@ M!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@ M!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@ M!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@ M!**6B@!**6B@!**6B@!*1\[#@_ARX_\"%_PKYO\2_\ (R:K_P!?Q_Z%RY_\"!_A1_PV-8_]"Y<_^! _PKQ3 M0?@QXN\3Z)#J^GZ4TUA,I:-_,4%@"0>"?4'%<5)&T+M&XPRDJP]"#@U<\TS& MFE*;LGY(N>;9G2BI3T3VNEJ?4'_#8]C_ -"Y<_\ @0/\*/\ AL:Q_P"AM=QJWP6\7Z'H4NKWNDM'8Q1B5Y!(I*K@;9E63=/6V^B/:O^&QK'_H7+G_P(7_"C_AL:Q_Z%RY_\"%_PKY= MJ]HNAW_B*_CLM-LYKZZ?I%"A8G_#ZFLXYQCI/EC*_HD9+.L?)VC*_P D?2G_ M V-8_\ 0N7/_@0O^%'_ V/8_\ 0N7/_@0/\*\Q3]F?QX]J)O[.A4[<^6;E M-_TQ7GVO^&]4\+7S66K6,]AH/0CZ9K>KF&:45S5$TO-(Z*N99M0 MCS5%9>:1]'_\-CV/_0N7/_@0/\*/^&QK'_H7+G_P('^%>%>#_A7XE\=V,MWH MUA]K@CD\IF\Q5PV >Y]ZV+K]GSQ[:0M*VA22*HR5BE1C^6[FJCC\TFN:-VO1 M%PS#-IQYHIM>B/7?^&QK'_H7+G_P(7_"E'[8EDQ 'AVY&3C/VA?\*^9+RQN= M-NI;:[@DMKF)MKQ2J593[@U''_K%^HKF_MC&J5G+\$221@D:*69B M< =37Z-!WBF^Q^FQ=TCP3]IG]MSX.2:WM])M5F=40 M@%GW.H ); ZYP?2O5_AM\1]%^+'@+1/&'AZ9[C1M8M4NK=W7#A6'W6 )PP.0 M1D\@U^,'Q$\/:_\ \%'?VQ?B"WA^>0Z/HNGW0TZ0+N40VR,MN@]YIB#_ ,#/ MI7TU_P $$O$WPDU69DU#0I6U'3X9>&%O(X69 #S\DI!Q_TUK0H^Q_ MVF?VK_!?[*/A_1]8\:0:M/::K=-:0#2K9)F#JFX[@SK@8]S76_!KXS^%OCU\ M/M.\9>$;QKS1[T$*)5V2Q.IPTHS^E?"?_ 6VR/A)\.,?]!R;_P!) MS7RM^Q+^T/XD_8G^*6E:1XTMYK?P#XQM;:[FW@LD<#O%UMKLVK:O:1WENVF6D?\ P5NU M"VU;]JGX5WUG.EU:7'AVREAGB8,DB&^N"K CJ""#FM3_ (+80&X^+_PRA3&^ M31YD&3@9-QB@#]8/!OC71_'_ (7TKQ%H-XFH:/JENEU:W,?1XV&0?8^H['BO M$_$?[=7PY\+_ +24'P0O+;76\937=K9K+%:1FSWSQ)+'F3S V-LBY^7@YZU\ M#?\ !._]I[6OV8_B?=_ OXH;]*TBYNREE)>-A;"Z;H-QX\J7((/3)![FJ_QC M._\ X+0Z0WKKVAG_ ,D+:@#] M7_ &Z?ASHG[1UM\$[BVUT^,9[N*S25+2,V MF^1 ZYD\S=C!Y^6OHKR$G'_3,>M 'UC^S/ M^VU\.?VK;S6[/P8=5@O-)CCEGM]6MDA=D:;\+O M /B'Q?K"7#Z5H=C-J%TMJ@>4Q1H6;8I(!. < D5^+OPWT?6_^"O413IG_MF#WK]7_VR'63]DGXNLC!D;PKJ!# Y M!'V=Z %_9F_:M\%_M7^'M8UGP7!JL-II5TMG.-5MTA)Q:I=&W?TNS\APV&>*Q:I=+Z^ESUW4_'>F_#GQ7X/\%Q( MB6EQ$8F8GF/ VQ?FP/Z5\X_M$^"O^$0^(5S-#'LL=3!NHL= Q)#C_OKG_@0K MJ-,\.0_'KQ[XCUV;7TTA;6>-;5BJL#&,[2,D?W0?QKT_]H#P6/%_PS^U6\J7 MVHZ2HF$\//F "0<9ZCG'L*^EQ$)X[#5?=TB_=].I]9BH5,PPU7W=(N\/1:- M'SW\!_!?_"9_$:PBE3?969^V7 (ZJN"%/U8@?3-?3]E\0]-\8>/O$G@>:..2 MW@M0@SSYC6'CN7Q.EGJ#W4DLEM(J_/EB&R2P/.3V[U&!C4PU.G3@M9OFE_AV M2(P$)X6E3IP6LWS27]WL>)>-_"\W@SQ7J>BW&XO:S%59NKIU5OQ!!_&OICPE M;Z=\ /@W'X@GM4GUB_1'8G 9Y'&4CW=@!U_&N>_:R\%+(--\56BAD;%K=.G( M(ZQM_P"A#/N*Z+XCZ9+\5?@'H]SHJ_:);9(;DV\9R24C*2(,=QN/Y5E0PSPE M?$J:G^U7XCTB2*/4/",5HTL8E1)VD3: MVN5GDDC$D95LB(8(!'K7%_#_ .)GQ2U7QEIMM*MW?6LEPBSQW%GM01EAN.[: M,8&3GVKV;X5?%FY^(7@[5]:FT^*SDL6=5BB8L&VH&Y)^M$:[BNEOM>I MP'[7FGVEOXJT6XB1$O+BU83A0 6"L-I/_CWY5X/%_K$^HKTG]H31-9T?XBWT MFKSO>1W7[RTN'&!Y70(!VVGC]>]>:Q\/?\ ("T[_KVC_P#017S7_P %'?CN?@7^S-XAFL[GR-=\0@Z)IVTX=6E1 MO,<=QMC#D'L2M?2GAX_\2+3O^O:/_P!!%?.W[6_[#6D_M>ZUX?N]?\8ZMHUA MHT3I#IUC!$T;.[ NY+#.2 H_"OU&G\*]$?K$=D?E_P#LH6G[5'P<\.W7B#X3 M_#V]N=,\3QQ3'4GTA+D7$2%MFQF/"Y9CP.:PO 'B_P")'[)O[7?ASQ[\1/#E MYX1N]7U!KK4K22V^S)<6D\FVX*(IQCYF8#ID"OWD\*>&+#P9X;TO0M,B\C3M M-M8K.VB'1(XT"J/R%>(_M=_L8^%_VOM%T*SUS5+W0KS1[AY8+^PC1Y"CKAXR M&&-I(4_5?>M2SY6_X+4ZA;ZG\%_AC=VLJS6\^L2RQ2(>'5K8D$>Q!%=1XR_9 M%L?VI?V!OADMC"D'C;1O#EO<:/=@ &5O+R;=V_NOV]&P?6O5?B[_ ,$_=(^, MWP+^'_PTUWQQK)MO!QQ;:HEO$9[A!&8T60$8^5,#(Z[:^@_A9\.[;X5_#CPY MX/L[N:^M-$L8K&*XG4!Y%1 M ?C_ /%B#X@/K&H^%]7)C>\CTV&-H[R1&R)&##AB 2.N!WZ[W[6?[!GAW]K M7Q?X:\0:SXGU30I]#MVMHH;&&-UE!DWY;<,]>.* /'O^"B/[%K?&SX4Z;\0O M"%B?^$ZT'3XVFAMU ?4;54!*\188TAC+'N=D:@GOBOZ![&Q2RTVWLPQ=(8EB#$K"PUJQP)H >2A!X=">=I_ BOC.Q_X(BV*:P6O/BK<2Z7D8BAT=4FQW M!$/ _[.NM_"3P9>7GABQUJW:"^UB$+->3EP%D=BPP2R@KT / %+^R/\ ML=>&/V0_#FM:;H.I7FM7.KW*W%S?WR*LC!5PB87C RQ_X$: /R9_:QL?VH_B MYHUIXI^+GP_O;+3O#<3XU1-(2V$$3LN0[+R5SCKTR:^WOAI\>A\=_P#@EKX^ MN+RY-QXAT/PKJ.D:GO;+EX[=O+.=(?2[V"YMXAY)* MLJS)@??578<\'//2@#Y[_P""//Q9\%?#OX4^/;7Q1XKT;P]<7&M120Q:G>QP M-(H@4%E#$9&>*_0[0?C_ /#3Q3K%KI.C^/?#NJ:G=/Y<%I::G#)+*V,X50V2 M< ]*^%3_ ,$2O 1_YJ/XCX];6W']*[WX$?\ !*3P=\"_BSX:\>Z=XYUS4[S1 M+@W$5KZ^5S\ MAHXFIAZE25-V;NGZ7,A9"GW6(^AKUSX*?&ZU^'.FZGINKVL^HV%RPDCCB(.U ML88$,>A&/RKS,ZM;YYT>R_[ZG_\ CE']KVV?^019?]]S?_'*BA7J8::G3?WZ MF6'KSPTU4I2U\T^IZK\6_CGIWC3PA8^'=!T^?3+&)U\Q)=H&Q1A$&#TS_(5X MT)64<.1]#6K/>QVS!9=%LD)4/C?,?E(R#_K/2HSJML#SI%E_WW-_\JG M'Y"N;^%'QIU/X83R0*HO](E;?):.Q&UN[(>QX'UXKCEU.!V"KHUDSDX #3') M_"2I;ZY&FW4MM=:%:V]Q$,K&I#J?4N;&$R _[^&/3X;&P MMF+19 :8GDRR>!\TW/\ MY$K2OF->O#V]HVN>G?"7XTZ=\/O!6L:-=6=Q/-> MN[*\6W:N4"\Y->2VM[-8WD-U;RM#/#()8Y$."K Y!_,5H3WD=M])FIS=WMM86(Q$\ M5-3F[O;:Q^COA[_D!:=_U[1_^@BORJ_X*Y?&SXB?#7X\>%K#PAX]\3>%;&;0 M$FDM=%UBXLXGD\^4;V2-U!. !DC. *_57P]_R M._P"O:/\ ]!%?D3_P6 A2 MX_:N^'44J!XY-'ME96'!!NY00:_5Z?PKT1^O1V1]J_L!_M>6G[07P&^V>(M3 M2+Q3X6B%MKTMQ)MWHJDK=$GLRJ2Q[,&]J_,;]J_]OSXC?%+XSZSJ7@GQWXG\ M)>$;9_LFFV6C:O<6221(<>]:EGV5_P5#^*OC7X?\ [.WP?U+POXPU_P - MZC?3HMW>:1J<]K-<#[(&Q(\; M\W/)//->+_ Y_94_;3^*'@30O%NC_ !VU M./2]9M([VV2[\<:JDH1QD;@%(!^A->@?\%%OB MSKWQ3^)]YXGLCX1OAIH3Q-?7SVMTL3.LJ"95",,<,IR.*^+/V8="_:J_:R@U M^3P9\;O$ULNBM"MS_:_C'4H[[]ECXR-^T DB> M(5TW41IWF16^@FNK<^-]4D\ MV%9 778R8;*@C!X.:Y+XV?LW?MF^"+/QSXWD^+>N6WA;2UO=7,-MXVO@\=I' MOEVI&"!D(,!1QQBO:?V7]8_;AN?CCX9C^+<-PG@!I)O[2+VND(/]2_EY,"^9 M]_9T_&OK/]K[_DU+XQ?]BCJO_I))0!^1'[-WA?\ :U_:IT/6-5\$?&+Q2;72 MKE+6X_M+QI?P-O9=PV@.I?MM^(/CC^S;^SI\ -!UOXC^);'QPTNO#6=2 MTOQ'=&2]'VF)X/,F#AI=D4J@;L[>0,"O5?\ @B*,_"[XE_\ 89MC_P"037/_ M /!ZG#Z=,[AY48,VY@&.3R0">:P?\ @ES^W5??$$M\*OB+KESJ7B1- MT^C:QJERTT]\F2SP22.26=>2I))*\?PU7_X*0?\ *-KX/?\ 7SH7_ILGKYH\ M4?LHZII?[(7PF_:%^'0GM-?TRU:;6_L8)D7R[J017B=<% H5N.@!['(![E_P M5G^,_C_X<_'WX?Z?X1\=>)/"^GW6BI+/:Z+J]Q:12O\ :I5W.D;J&. !DC. M!7LO_!2']N?5/V=K33O W@>11XXUB$SR7;)YGV" L50HIX:1R#C(. ,]Q7YQ M?M:?M.Q_M3:_\+?$5Q!]F\0:;HT>FZQ$HPC7*W#MYB?[+JRMCL21VKVO]L!X M+3_@JSH\WBIHQX>75M"<>><(+01P!\YXQO$M &WX7_X)W?M-?&O0;3QIXI^) M4VD:S>I]J@M-8U2ZEND#?,NXJ2(B<_='W>.!T'TU_P $^?AK^TI\.?%WBG1_ MBQX@N;OPAIFV"SAU*Y-\]U*W/F6T[-N6(+C(/G/-?$GP&_;,_:3?]L?PE\)/BEJ%G M8RS7ZPZKI:Z=:"15:W:9!YD0.,J4;@]#0!^KU%%% !1110 44F:,T +129HS M0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F: M,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%) MFC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +1 M29HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- " MT4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:, MT +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)F MC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +12 M9HS0 M-?[C?2ES39#\C?2D]A,_-[Q.N?$FJ@]/MB[KD+ M#;PR+,W^J-PK%GPFW/.]DSGLOI7*^)N?$NJ\9_TN7_T,UU&H^"=,6#3G@U#[ M)$UK;&>>5&1O=S[PUNJG]V%D="2W3JA/TK2U30]/&MMH M%I:7(OHI1$]ZSEPY&=[; O3TP>G)SFM?:5;--:FJJXBTHM*_^9>/B"PETN6. MUOX=/NO(A6:5[4L9P( K(#M.#OW=< YSGBM:Z\4^'[&RC-G=03744,T<$AMV M+A6A4*'R@&X/Z<#KGK6"GPTTS3+$/EQCC,@Z].OK6_:>+=#NM56]FN&@^T62VUTUU'YL MP9&P)$8(02RA1R.<')%'K&2>?4(V?SO*BA",'D^1')_V<"3D'D' K M5@\%6)-'>STX"]@@OX[62"*1;4^5;MM4*[#9D,<,#M+#)W8%0ZAX@TR>SO(K&_ MM;.9I,W#M9_\?J^4B_+\IQ\ZN<''WLU!/\++BWO3;27Z(^V4A3$P>1T90RHA MY;[P(/< ^E5&^&]X+"UG,OSS&-O*\EON/G!4_P 1&,D#IGV-5)5VM8%R>*:U MIFU)XC\/KINIM#56E#ZC"IW6R6V5.9S-OVXQ]W M'EMDGTINF^#]*O8+Q$U=9'2>W@CN! X =S("FWJ?NJ<^AIJ6(VY$BE/%/3D2 M_P" :DGC+38)HHXY(71YU%[,+48G40*K, 5S@L&X !Z' KSY.9EZGYN]7=92 MTBNA#:P20&%1%-ODW[Y 2&8<# /I5*+_ %B_45Q5*DJC49=#S:M:=22C+H?H M[X>_Y 6G?]>T?_H(K\U/^"F'[.?Q*^+G[27@?7?"'@S5/$.CV.FV\-Q>6489 M(W6Z=B#D]0I!K]*_#Q_XD6G?]>T?_H(K1$@''ZU^M4_A7HC]ACLC'U7PGH_B M2[TRYU;2[;4+C2KC[98RW,0=K>;:5WH3T;#,,^_M7Y[?\%:/V?/B'\:M>^'T MG@7P?J7B:'3[>Z6Y:P0,(BS(5!R>^#7Z1[A1N%:EGYZ_\%*O@5\0/BU\ /A- MHWA'PGJ'B'5-+G1KRTLT!> "U"'=R/XN*\+\#>/?V^_ASX/T?PQH?@._@TC2 M;9+2UCDT.WD98T&%!8G)X[FOU^W"C<* /S]^ WB[]JOXF>'/BKHGQA\+W5G8 M7'A.]BTI#I<5L9[QXV144IR20W0U\@?L^^ /VR/V88]8C\ _#C5[!=7:-KO[ M5ID-QN\O<%QN)Q]X]*_<'<*-PH _+/PA\:/V_;GQ;HD.L^"[J+2)+Z!+R4Z# M;+L@,BB0Y'(^7/-??O[3/A_5/%W[.GQ.T/2+.74-5U+PUJ-G:6D(R\TLENZH MB^Y) _&O3]PHW"@#X*_X)-_!3QU\$OA]X\L?&_AB_P##-W?:G!-;Q7T>TRH( MB"PP>@-8O_!6WX$?$#XX67PN3P-X4U'Q.^FR:F;L6"!O($@M=F[)[[&_[Y-? MH<9 ,]Z^?O$7[96C1>*M7T'P9X)\6_$RXT67R-4N?"]DDEM:2]3&99'17<=U M3)!R.HH \(_;H^"?COXD?L*?#'P?X:\+ZAK/B339](:[TRV0&6$16$L*&UGDM+^TOXC!WGA'X>^./'GA>QD>.?Q+H&F+)9'9]\Q%W5I@"""8U/(^E 'YO_M3_P#! M-/Q]X%^-DD_PQ\)W_B;P7J$PO;;["H/-(A,'D3N(TU"#.X)O_A=3G:3QR0<<&OJ'PQ\=_!'B[X8 MM\0=/UZV/A.*%YI[^9O+%N$_UBR@\HR\@J>&B+I2^)?\ A6_CX?#X M_/\ \)@VD 60BSCSMA?S?*[[]F,4 ?"OA3]I_P#;8^".B6?@JX^'6HZ\]F/L MUO>:GX?N;R957Y0/.B8*X'&&;)/J:Z_]DS]DWX[?$G]JO3/C[\5[)?#S078O M)EO8UBN;MEA\E$6!?]6JJ%&6QPHZDU^@_C_XXS>&?#/A_7?"W@G7_B78ZR@F MB;PP('\N(HKI(QED0;6##&,]#7EZ_MQS67Q!\(^#]<^#/CWP[JOB>Z^S6(OH M[,Y (WR%4G9@B Y9L8 H ^HJ*:KAB1C!%+F@!:*3-% "T444 %%%% !1110 M4444 97BOQ+9>#/#&K:_J3.FG:7:2WMRT:[F$<:%V('[?L\?\ M05U[_P $\G^-?2'[17_) ?B3_P!BYJ'_ *3O7QK_ ,$C?ASX3\5_LM7=YK?A M?1M8O!X@NHQ<7^GQ3R!1'#A=SJ3CD\>] '=?\/=OV>/^@KKW_@GD_P :^E?@ MA\;?"_[0GP^M/&?@^:YGT.ZEEAC>[@,,FZ-BK94^XJU_PI/X=_\ 0A>&/_!- M;_\ Q%;=O9Z!\/O#MP;:VT_P]H=E')_$/PSIWC M/3O"-QKMC'XGU"*2>VTCS@;F2-!EGV#D* /O' [=:XKXL?M-^!_@MX[\%^$/ M$US>0ZSXNG%MI:6]JTJ,YD2/YV'W1N=>M?E\?VHO$-O_ ,%';KXE#X-^,I=7 M_L@VG_"&+9R?VGM%L(_-V>7NV8&[.WH:^WOCE^T;X#\._$'X#6WC7X11:QXE M\8-!)IEQJ]I UWX?E>2$$9EC+HZLZD[=IRGK0!]=45X#^TQ^U_H'[,/BCX?Z M5X@TN6XM/%=X]LVI"Y2**P1&C#2R;ARH$F>/[IKP[Q+_ ,%;/!NDSRZEIGPS M\_@C]I[Q)J M7A6WTK5O"'C/3XVEET/6XU5W12 Y1@>2I(RK!2,]",D 'TU17AG[3'[8_P / M/V5[2P7Q7<7E_K>I FQT+2(1->7 SC=M+*JKGC+$9.<9(-?/=Q_P5IT7PU=6 MLWC+X,_$#PEH=RX1-3O+, '/0[7V ^N Q/IF@#[V9@H)) Y)/:N?\'?$+PU M\0HM2E\,ZY9:[#IUVUC=36$PECCG4 M'N'!(##."<9QUKR#XX_M'6=C^S3_P ML#P/X;U;XF:3KUOY-O%X>@>258I8Y 9W4*2JH5PP(&#P<5\5_P#!(OXYZQX? M\-Q?#N#X<>)-4TK5M=N+B7Q?:V[MIMB?(0[)7"%0WR#JP^^M 'ZJ45\Y?M,? MMV_#O]F;5[3P]J2:CXH\9WBJT'AS0(1-<@-]TR$D! W8H4CFO-_ G_!4K MP/J7C"P\-_$'P5XJ^$]WJ+!;2[\1VFRU?)P-[':R DCYMI4=R* /M6BLS7O$ MNE>%_#U[KNK:A;V&C65NUU<7T[A8HXE&2Y;TQ7Q+=_\ !6KP=?:M?/X4^&7C MOQAX7T^0I=^(=.L!Y**.KA2.];7PT^(6E?%?P#H/C#0_/_ +(UJT2\M?M,>R3RV&1N7)P? M;-?,O_!5[_DROQ7_ -?MC_Z4)75?LS>-(_AQ^P!X*\5RVK7T6B>#AJ#6R/L: M411,Y4,0<$[<9Q0!]+45\*Z=_P %7_"7B'P=H5QX;^'WB;Q=XUU.*6>3PIX? M3[9)8QK(R S2JO!8+N 5"0",XR,]Y^S9_P %$?!?Q_\ 'TO@'4/#^M?#_P = M*'*:/KL8'G%1N9%;@AP 3M95.!QF@#ZNHKS7X^?M#^"/V:_ [^*?'&IFRLB_ MDVUM GF7-W+C/EQ)D;CCG)( ZDBODU?^"M.GVMM#KNJ?!#Q_IO@69P$\2/; MQ%2/6O(?C#^TI\/+ MK]DS5/BQ#I%E\2_ S012G2[A$*7.9D39(DJ,%9'/*LN05KM?@?\ $WPUXD_9 MZ\,^.;/2[/P/X5GTD:@M@#'';Z= 21E550J@$\ "@#U&O(M7_:B\%:)^T-I M7P7N?[1_X3+4K3[;!LM@;;R]COS)NR#B-N,>E?-^H_\ !5[P]JVO:C#\/_A1 MXW^(F@::Y6\US2K,B) .KJH5CMQR-Y0GT%>)>$/CEX6_:(_X*H?#+QGX0N)Y M=+N= :%X;J+RI[>9+>Y#Q2+DX9..HC0D# R,LQ"C(YR0#\S0_\ !6"PTEK74O%WP2\? M^%?!]TZK%X@N+0M$5;HV&5%([_*['TS0!][45RGASXG>'_&WPYB\;^&=0AUW M0+BR>]MKFV;B554DKR,JV0001D$$$<5\>>'?^"M/@OQ)X)M+VP\#>(=7\:7M MW-;VW@[0P+ZZ,<87]](ZJ-BL20 %9OE/&.: /NZBOCWX%_\ !2GPA\5/B=;? M#KQ3X0\0_#'QC=N([2RU^+"32$96,L0K([=@R 'IG) /T%\;_CKX-_9X\"7/ MBWQOJ@TW2XF$4:(OF37,I!VQ1(.68X/L "20 30!Z!17P&/^"M6GK9CQ!+\# M_B!'X"+C_BI3;#RMA.-W3R_P\W\:^Q?A3\9O"'QI^'=EXW\*:O%?>'KF-G-Q M)^[,!7[Z2@_<9>X/UZ8- ';T5\0^+O\ @J;X7?Q;J&@_##X<^+OBZ^G,5NK[ M0+5OLPP<$H55V9>#\Q50>Q(YKT_]F7]NSP#^TOK%[X;M+;4O"7C>R5FN/#>O M1"*X(7[QC(.'V]QPPZE<\>Q9-9@CBE,BJK' CD<$8< MCV*Q0>"KZQ=K^\V>>5FBC,>2H9MP. MT_<)[5^M?P9\>7?Q.^'&D>)[[PKJ7@J\U%7DET/6(C%=6Q#E<2*54@D*#R!P M10!VU>+?M ?MA_"K]F>../QOXE2WU69/,AT>QC-Q>R+V;RU^X#V9RH..#77? M'7XG0?!CX.^,/&\\8F71--FNTB8X$D@7$:?BY4?C7PA_P36_9PTWXU66M?M" M_%:TB\8^*M>U.;^SAJT8FA@5&PTPC;*EMV57(P@08Q0!Z'X>_P""QWP$UK5X M[*[MO%VA0.VTW^H:7$T"^Y$,TCX_X!7V=X.\9Z%\0?#=CX@\-ZM::WHM]'YE MM?64HDCD7V([@\$'D$$'FLGX@_"+P;\5/"ESX;\5>&].UC1YHC%]GN+=3Y0( MQF,XRC#LRX(/2OF3]@[]E?XF?LJ>+/B#H>J:MI]_\+KVZ:;0X/M3O=HX?"RE M-FU T> WS9W*O% 'N?P]_::\#_$[XM>,/AQH=S>2>)_"A8:G%-:M'$N'"'8Y MX;DCI7J]?G1^Q7_RDB_:<_WIO_2I:]]_:)_;_P#AY^S[XOC\&?8M9\;>.9%5 MO[ \-VPGEBW#*B1B0%)'.U=S8P2 "#0!]-45\+:%_P %8_!UEXJL=%^(GPY\ M9?#);U@L5[K-IF)>2JMBOHO]I?]HS3/V;_@Q=?$:YTR7Q'IT,MO M&EO93JAE$S!597((QR#[T >O45S7PT\;0_$GX>>&O%=O:O90:WIT&H);2,&: M)94#A21P2,XS7DWA3]KG3/%7[5_B;X&Q^'KNWU+0[+[:^KO<*891LB;:$QD' M]Z._8T >_5S/Q+^(>C_";P'K?C#Q!)+%HNCVS75V\$9D<(.N%'4\]*\I_:@_ M;3^'W[*=O80>)'O=6\1:BNZQT#2(Q+=3+G&\Y(")GC).2*?AIXCU?0YO[*B\1VA2&^(P=J/@$,1TRN#T!R0" ?;> MB_M(^"M?^ LOQAM+B\;P7'937[3/;$3^5$S*Y\OKG*GBMSX-?&#PY\>/AYIG MC7PI+<3Z%J)D$#W4)AD.QV1LJ>GS*:^6OV3_ !5HW@;_ ()@:1X@\0Z'#XFT M/3M$O[F\T>X1'CO(EN)BT;*X*D$=B"*]2^!GQZ\(WW[()^*/A3P/#X2\+6%A M?W\7AK3TA@5! \F]5$:A 7*,<@=6YH ^B:*^&[7_ (*O^!=8\':#=Z#X*\3> M*?%^JQ23MX5T&$7<]E&LC(&FD48&[;N 56.",@9!/H'[-/\ P4(\!_M%^-+C MP2VDZSX(\<0J[#1=>A5&FVC+K&P/WE')5@IP#@'!H ^I***R?%FM2^&_"VLZ MO;V$VJ3V%G-=1V-OGS+AD0L(UP"=S$8'!Y/0T 8OQ:^+/AGX(^ M4\8^+]0& MFZ'IZAI9=NYW8G"HBCEF). !6GX%\9Z;\1/!NB>*-&>232=8M(KZU>9"CF*1 M0RDJ>AP>E?D?^VQX6_:!^-_P8U?XO?%F*/X?>$M(E@&A> XR6F+2RK'YLX[. M%8\O\W8(@//Z8_LB?\FN?"G_ +%JP_\ 1*T ;7QG^/\ X _9\\.QZWX^\2VO MA^RE8I L@:2:X8#)6.) 7M+T7QG_P5B\):)\5TBF\%II<7 M]B6FI'_0YY3$S(I#?*P:?<"#]XA5.>E>B_\ !5WX;?"_2/V9)]7N-(T?1?%E MK=V\>@SV=O'!XD=!@'@XH ^^**\G_9/U#7]5_9J^&EWXI\ MXZ]-H5JUTUQGS&.P;6;/.XKM)SW->L4 >/?';]K?X4_LW""+QYXK@TS4+A/, M@TR")[F[D7^]Y48)5>OS-@'!YKD?@[_P4*^!?QP\26_A[P_XP%KKERVRVL=7 MM9+1KANRQLXV,Q[*&W'L*\L_9X_8FUV;]H_XE_%?XXZ1I'B+4]0O-WAZ.65; MV""(LW.QAA61!$BY''..>:YK_@K3\'OA_I'[/T7CBVTC3M \9Z;J=M%IVH:? M"EO//N8[HF* %P%!<9Y4IQC)R ?H/5?4;Z+2]/N;R*_@)\/=8U_>=:OM"L[B[:089Y&A4EC[GK^-=KK]U#8Z%J5S<0"Z MMX;:222!@")%"DE2#QR!CF@#S_\ 9_\ VC?!G[3'A2^\1>"+B[N=,L[QK"5K MRV,#"555B #U&''->GU\P?L5?'?P#\5/@OXG\4> ?AQ9_#K1],U"=+C2=/@@ M@6XE2%',F(45BOD?X"?\ !2/P-\9/B1%\/M:\.>(/AUXS MN&V6VG^(8 BSOC(C#<%7(S@,HSV))Q7UQ0 5\D_&;_@J'\"O@QXBNM"GU74_ M%>JVCF*YA\-6BW"0N#@J99'CC)'<*QQT/->S?M0W&OVO[.GQ(F\+^;_;Z:#= MFT^SY\P/Y3S;PG ;.>30![%\'_P#@J5\"/C!X@M=$CU74_"6I7;B*W3Q-:+;Q MRN3@+YL\G>,+WPW\/O!WBKXL7MB M2+FY\.6FZV7!P2C-+96:3P M]K\*PSN%^_Y9!(?;W7AAR=N!F@#O/'_[37@?X:?%WPA\-=;N;R/Q1XJ"G38H M;5GB;+E!N<<+RIH^+'[3?@?X+>._!?A#Q-=_'?X_>"_V< M/ D_BSQOJ9L-.5Q%##"GF7%U*02(XD_B8X/H !DD#FOEKP]_P5?\':E=VD_B M/X;^-O!_@_47$-KXJU"Q#69+<*SE> O^X7^E 'TK\!?VE_!'[2-IX@N?!5Q> M7$6AW@L;PWEJT!67!.%SU'!YKU.1Q%&SM]U02:_.O_@C9/'=>%/C%-"ZR12> M)4='4Y#*48@BOT5(!!!&0>U 'QI>_P#!6O\ 9\L+R>UFU371+#(T;@:1(1D' M![^U0?\ #W;]GC_H*Z]_X)Y/\:^H'^"WP]D=G?P)X9=V.2S:/;DD^I^2OSH_ MX)U^!/#7B#]KC]I"QU3P[I6I65G?R"VMKRRBEC@'VV88164A> !QV% 'V'\ M/V\/A1^TMXSG\+>";W4[C5H;1[UTO+!H$\M652=Q/7+CBOH>O-_%UEX.^ _@ M?Q/XYTSP=I-I)HNEW%[*NEV4-M--'&A/M/TBXT.UO9YX%L[F5974QN4)+* .<9H ]8HKP'XI_M<:9\+OVD/A_\(;CP M]=W]_P"+XU>'4XIU6*WW.Z?,A&3]S/![U1_: _;9\*?LX_%[PCX*\56,L%EK MUE+?2Z\9U6"RCCWYW)@LQ.S "\DD K M7%E'J$EMX4M#,EI"ZAE,SX)1L$?*%)'\6TT ?75%?/7[*?[;7@?]K&/5K/0[ M74-!\2:0 U]H>KHJS(A.W>A4D,H;@]"#C(&1F?\ :;_;:^''[+'V.R\27%YJ MWB6^4/:>'M&B$UW(I. [ L%12> 6.3S@'!H ]^HKX:\/_P#!5[P9;^(K#3?B M%\//&?PRM=08"VU/6K+-N0?XGX5@O/55;'ZU]/?&?XW:5\(?@CKGQ,2#_A(M M(TVR2^CCL9U NHW90I1^1@AP<^E 'H]%?"C?\%9/"%_9Z9<>'?AOXQ\6H;2& MZUB31;=9XM*:09\EI.C.HZ_=&>,YSCU3]H+]O?P'^S[&_B#X M%\7?"JZU)Q':W?B&SVVS$G +L=K*,D?-M*C/) YK[75@ZAE(92,@@Y!% "T4 M44 %%%% !1110 4444 %%%% !1110 4444 %-?E#]*=37P$.>F*3V _-WQ-S MXDU;O_I+M5LG#)<*V(XXP)8U< 1C"$ @C*XX/6J_B4Y\2:M_P!? M];4@O;^XU Q-< MRM*T:[%9N3C<6Z_5B?QK6B\<:S ;=DNE$D.T++Y*;V"C: [8RPQQAL\52_M^ M]_Y[)_WZ3_"C^W[W_GLG_?M/\*/:6VF)5.5W4W^'^9/-XNU6>YAG:Y DADCD MB"1JJHR#"84# P.E/3QGJT:6JB=";<;4_\]D_[])_A1[3^\5[9WOSO\/\R/4-7NM4 $[($$C2".*-8T5B M%4X50 .%7\JDCUZ_C4HERX0P?9MO&/+SNQCZG/UH_M^]_P">R?\ ?M/\*/[? MO?\ GLG_ 'Z3_"DIJ]^;4GVBYN93=_Z\RZ/&VKK?)>++ MRH_P!8+:/+'.=Q M^7EL\[CSFF1>,M7@^S%;E?,MV#1S-$AD&,\%\9*\G@G'-5?[?O?^>R?]^D_P MH_M^]_Y[)_WZ3_"J]J_YRO;2_P"?C_KYDMYXJU2^8&2YVA3&56)%0+Y>[9@ M#&-[8QZTMSXJU&ZD#M+&AWQR8BB1 60L58A0._\]D_[])_A28'5N[\[_KYE*65YY7DD;<[L68^I/6B,_O%^HJX=>O3_ M ,M4_P"_:?X525BTP8G)+9./K6:<;JS,?=NN5W/T=\/?\@+3O^O:/_T$5E:Y MX0NM8U!KF+Q-K6EH0!]GL7A$8QW^:)CD_6M;P_\ \@/3QZ6\?_H(K3'2OV"G M\"]$?M4-D<3_ ,*[OO\ H>/$W_?RV_\ C%'_ KN^_Z'?Q-_W\MO_C-=O16I M9Q'_ KN^_Z'?Q-_W\MO_C-'_"N[[_H=_$W_ '\MO_C-=O10!Q'_ KN^_Z' M?Q-_W\MO_C-'_"N[[_H=_$W_ '\MO_C-=O10!Q'_ KN^_Z'?Q-_W\MO_C-' M_"N[[_H=_$W_ '\MO_C-=O10!S.@>%+G1+QYIO$.K:LC+M\G4'B*CW&R-3G\ M:QO$VJ>!OV?/ &J:U5V+-M10-TCL> 22:[R5BL3 MD+N(4G [U^?<;_'+QU\7)/&WQ*_9_P!=\1V.E3[_ QX9M=>TQ+'3?2XE#39 MFG/]YAA?X10!5\:V?BOPC^R!^T-\2KJPG\,WOQ%U0:G:Z4?EFL["7R;=#(!] MV5X]S,.V[GFONKP%X2TCP-X,T70=$ABM]*TZSBM[=(0 NQ5 !&/7K^->:6 U MG]I/X;^,O"?Q$^&NI_#RRO[;[$L5]J%K=M.LBM^\1H'8*8R%.&[D>]>?>$/$ MO[0OPB\+VW@FZ^&,7Q*NM-C%IIOBZRUVWM(+F)1B-[F*3YT8#:&VALX)H @^ M"GA'1%_:2_:0^'LVFVFH>"[Z;3=8GTFXB62V%U"=)TY-:\9^*[2;2=!\-VT:DS,R%"[KT2&,,&9CP ,"N6\+_ \^ M(_P%^$GCWQA8:3!\1OC9XJO1J-U9V\Z6]NDC!8XH$>0J/)@3)P2"V&]17F/P M.E^+OPSOM1\5^)OV>_%'C+XE:R -3\27&OZ4F$!.V"WC\\B&%0V # MZF^#'@:_^#GP(\*^%3C5=4T'1HK5@'P)YDCY52>@+< GV-?,GP3\?V9H^M7 BNM(L(,GR;""2-V,);JQ8#>W?BO;_&WB'XU M7WAWPEXL\'>&["TO4WG6_ 6O74:SRJ3A?+O(RR*ZXZ8*G=[5Y]XTT'XK_M47 M_A?P_P"(OAS_ ,*Q\&Z;K%MK&JW>IZM;WMW=FW??'#;I!G:&8#+LP(';U /K M>(Y)J6HXTV?3I4E !1110 F:,T9HS0 9HS1FC- !FC-&:,T &:,T9HS0!YY^ MT4?^+ _$G_L7-0_])WK\KOV!_P!DWXH_&OX(3^(/!W[0?B/X8:2NK3VQT72A M<^4TBK&3+^[NHAE@P'W<_*.:_5']HH_\6!^)/_8N:A_Z3O7Y7_L#?\%&/AQ^ MRO\ !"?P;XKT/Q3J.IR:M/?B;1[6VDAV.D8 S)<1G=\AS\N.G- 'TC_P[N^/ MG_1Y/C;\KW_Y/KZ<\0? [7->_92U+X5:CXNN-=\0W7AZ329/$M]O\RZG*$"6 M337S+_P /K/@G_P!"IX^_\ ++_P"3*]M\%_M&7/[8G[-_C'Q' M\$IM4\)>)(&FL=-N->M+;>MVB)(/DW31[6#!U^'/Q-^!M]=^&-*FE\GQ!I9:-&5W+EO-"/#,E?2G['_Q6_9I M^.WQ?\2>/?AUIMQH7Q5U2V+ZI::F\L%Q+"=F]EB$C0.-RJ24RV>3C->5_"G_ M (*A3_![PJG@[]HOP;XPL?'NFL\$U_#IL16_&XX8JS1@-@@?("K @\XK)_9 M7\%ZK^T-^W3/=-^*/[0/[ M'/B_1UF32];NX+^V6Y4+*J275LP#A20&&<$ D9'4T :7_!7G0H/%'CW]GS1K MKFVU'6)[24#^Y)+;*?T-?@ M#XR_X(R>#]*TW]G'7/$<-I$-7U/79K>XNMH\QHHHX]B9Z[078X]6-9GBBQM] M,_X+/>#)+6-8&O\ PW++;_TCO* .[_:@\0_LV_ +]H71?BY\2-8U"Z^)%O:! M-/T6U8W>V,*R+((,8CQEBK,R@MDC)''DG[1/_!0G2OC]\#/''AOPA\$O'?B# M2+W2IUGUG4[!8+2Q4*2+EF3S1A" PR5Y Y%"O M@3\.?%6M#4=.F35/$6JV2VME96@0M*%;<0TC*&4*2#SP&/% '>?\$Y9WF_X) MW6P=RP2#5T7)Z#?+Q^M87_!&8X_9AU\_]3-<_P#HF"M3_@EU=1>*OV$&T:RE M22^@N-3L98@>4D-O#6O:3XQU?Q'* M;:9[=%@C=HU79*'=77F+@JK [ATH \S_ &9/CUXQT;]I/XO_ !-TWX(:W\9_ M$5YJ4D"7NG2N#I"&23Y!B"7!9%51]W"H1T)KUK]JGXY_%G]J/X/:IX)U+]C_ M ,9:==3,DUAJSO-P!Q?[5/B_P >>%O^"6/P MXT'Q79ZEH?B&_OK?1=3M]1C>&X\B$S-&KJV#RL,1YZ@5^BG[/OP^T;X7_!3P M;X;T.TAM+"TTNWR(E \V1HPTDC8ZLS$DGOFO%_VCOV7?%_Q^_8T@\">(M>BU M_P")=E;PZ@NJR11P17&H1@EDPBJJJP9XP<#L3WKP7X1_\%.5^"7@/3OA_P#& M;X=>,=.^(.@VZ:!YQ0!!\.OAOHWPR_P"" MPNLV6A6L5AI^H:#/J?V6!0J1R2P*9 H' !<,V/\ :K]*\U^3?[*7C;QG\2O^ M"H4WBWQSX>N/"FIZSH-Q=VNCW0(EM;/R56!6! (.Q03D G.<#-?K)F@#Y _X M*O'_ (PK\5?]?MC_ .E"4GP]/_&K.U_[)U/_ .DKTO\ P5>/_&%?BK_K]L?_ M $H2D^'I_P"-6=K_ -DZG_\ 25Z .7_X(\^#=*T7]E5M>M[6)=5UG5[DW=UM M'F.L1"1H3UVC!('JQ]:XC]L[3;;2?^"EO[->J6<2V]]?2V\5S-&,-*JW+(-Q M[_*Q'TXKU/\ X)(G_C#'0_\ L*7_ /Z-KS;]M\_\;%?V7/\ KYA_]+* ,O\ M; LH/B__ ,%,?@C\/?$"+=^%[*S2]:PEYBF)EVE<=,8-?$?\ P4(^!GCNT^)?P^_:"^%^ MDR>(?$?@QE34-'MT+S7%LKEU94'+C#R(P7)PP('!K"U[_@KCH?B+PE<:-X+^ M&GC2[^*-U";>WT26Q1HX+EAC)9',CA2<@",$XP=M &]^UE^SQX0_9H_X)Z?$ MSPMX*2^CTF:6"\9+^[:X;S6N( Q!/"@A1P !7E?QY\7W_A7_ ((]?#V"PE>' M^V+73M-G=#@^2S/(P^A\L ^Q-6/&/P;\>?"'_@EQ\1O^%DZOJ6H>+-;F@U&> MSU"\>X.GQFXA"0#'[ M>YTZ:7A$NHF+1[CV#8*D]@QH ^@OV1_ &C_#7]FWX>:/HUM%;6[:-:W =/^%WQS^'OBW3?%OAN$:=9S:?9I(M_"@V MQ??=.< ,A96 !R.E>=?"+XD^,_C#_P5'\">-/&/AB[\'IJ^GSRZ/I-\"LT6 MGK;3I$S @'+%7;) SG(XP: '_M2?$77;K_@I]%-;_#J]^+?_ AUA#_9WA2U ME*9/D"7SN(I/NR2[_N'[J^E>Y^*OVTOC/XT\-ZGH.L_L4^*K_2M1MWMKFVGU M*5TD1A@@@V%4/VV?A#\1/@Y^TQX;_:;^&&@3^*ULX5MO$&C6B,\K1JAC9MJ@ ML4:([2R@["@8C%2>(?\ @KUX;U_PO/IG@'X<^,]4^(]S$8;;2+BQ0QP7!& 6 M,;L[A3R $!;&#MSP 2?\$T/!GQ$^''P"^*WAOQQX6UKPI8PSR7>DVNLP/$=D ML#^8$W 9 *)G ZM[UD?\$5_!NE6WPH\=^*1:Q'6;O6_L#714;U@CB1P@/4 M M(21WX]*^@_V7=(^,MC^S;KE_\;]=GU/Q5J5O,_\$8#_P 8Z>+?^QGF_P#1$- '._\ !5+3[;3_ (W?LW:[;Q+# MJIUSR#=(,.46XMF52>N 68C_ 'CZU'^W];1_%3]NS]GGX9ZU^^\+.T=Y<6;G M]W.SSL'!'?*PA?\ @1]:N_\ !5X_\7-_9N_[&)__ $=:UV__ 49_9_\;^(= M<^'_ ,:OACI[ZQXP\!W EETN%"\MS;K()%**.7*L&!4482NTIMZ;=O&/2OA7]K#X/^&_V+/V$?B7I7PU.HV- MOKUU!%<&YO&F*^=(DOO"\FF:1\,?&8RANWEACTP.M7/@C^QM\0/'G[&7Q!\,_%36]07QCX[E_M& MVL]4NI)ETAT/F0*5)(C)?)=5Z @'D8 !Y=^R1^TQ\3_@A\!?"_A[PC^R/XDU M_3FMQ=/K]E?R1KJKR?,;C LFZ@@#YFP !GBN?^).M?&KXU?M4_"OXH:=^S;X MJ^&^JZ'?00ZE?*);H7EOYJ@F5OL\6 L9D4DYRK8X KK/V>_VYM8_8K\%V_PD M^/OP_P#$^GS^'RUMI>L:;:K-'<0;B57+NBNHR0KHS C (&,GO/AG^T3\6&M_#;X'Z00VH7NJV,);5%#;F7YT=2[\(!&3L!+%LD4 ?H+FO@# M_@LEXJU#3_@3X/\ #=I.UO:>(/$"0WA4X#I&A95/MN*MC_9%??\ FOF;_@H- M^S/J/[3OP$GT?P_L_P"$JT>Z75-*21@@FD565HMQX4LK'!/&X+G YH ]J^$? MP]T3X5?#7P[X6\/64-AI>G6<44<<*A=QVC<[8ZLQRQ)Y))K\_P#Q[HMI\#?^ M"N/@*;PI"FFVOC6P#:K9VPV1R-*)DD8J..6B20_[0)K7^&__ 53LOA=X-L? M"7QG^'GC+1OB#I$"V4L5KIZ%;YD&T.!+(C*S8!(P1SD$YQ2?LP_#OXA_M2_M M>2?M)>/?"]UX+\+:5;&V\-Z3J"LL\HV,B,%8 E0'=R^ "S +D X '?&4_P#& MX/X3?]@(?^BKNOT7S7YT?&4_\;@_A-_V A_Z*NZ_1?- 'SC_ ,%%-*N=9_8P M^)\-H"TL>GI<,J]2D8+_#(+ MF0D'WP0?QKZ8\3>'K#Q=X=U30]4@%SINI6TEG.12K#\B:_++X<_$/QU M_P $I/'^O^#O&WAG4_%/P8U>^-WIFN::F3"3P&4L0F\J%#Q,RG*AE./O 'ZO MYK T[XA>%M8\2W_AVQ\2:3>>(+ XN])@OHGNK?@'YX@VY>"#R.]?$7CO_@L7 M\++?P^Z> ]"\1>*_%5ROEV6GS60MXO-/"B1MQ8C/9%8GIQUJU_P3F_9D\:Z# MXH\7?'7XLVTEIX[\7ES;V%RFV:VAD(OBCK[,-3L]/7^T)+0NV]D4ML2 M(M\H*;R0%48 K _8K_Y21?M.?[TW_I4M>.? [XE6G_!/O]I3XHM\;?!.LW5U MKUZ\VE^+K6Q%P70RR,3&[E^1U ]0!0!])?LL$?\,U?"W_L6M/_ /2=*^-_@^0?^"P_Q4Y_Y@1_]$VE M97[/W_!3;1_A5\(_#GPW\8?#?QL?B-X?LX])CTBQTY2;LQC9'P[*Z$@ ,-AP M>F>E=-M?C'_P %4OC)X@\1Q)?S^#X7@TF*X&Y;0>Q< MGK7TO_P4,^&^C?$;]DKQ^-4M(9KG1]/DU6PN'4%[>>(;@RGJ,@%3CJ&-?-_[ M07A;QQ^Q=^V#??M!^%/"U[XQ^'_B>W\CQ)9::A::U8A?,8@ [02BR*Y&W.Y2 M1D&N5_:H_P""AO\ PTQ\#?%/@_X/>!?%$\%Q8O+X@UO5;1(8-/LD&^5/_ /!5D_\ &%7B[_K[L?\ TI2O8/V1#_QBY\*?^Q:L/_1* MT ?$/[2+:U_P4)_:MU#X&:!#I&A>$_ Q:35?%%Q8)ZAX.C^WSZ'XULXKV&:"/YGV \ M?* 3L(Z#A@0,ZOCK5-;_ .">7[;OB[XGZQX>U'6_A+X_#&YU+38O,:SE=PY4 MY( =9 V%8C\1H+RR0Y6 M"XC8I(JG^[D9'L17KF:^<_V,O@W?_LK?LHZ5H>O+YFM6D%SJ^I01,"$E?,AB M#="54*N>F0:M?LF?MC:%^UAX*\2>)=-T*^\.6>AW7V:=+^5)"W[OS"P*]@* M/3/C#\9_"'P'\#7OBSQIJ\6DZ1;# +',L\F/EBB3J[G' 'U. ":_/GP;X*\< M_P#!4/XMZ;X^\;Z?<>%?@)X>N"VCZ+*2)-48'D_[6[ #R#@#Y$R\9:1 M!=6VF:Y91WUO#>HJS(CC(#A68 _1B/>KOC8_\49K_P#V#[C_ -%M0!^?W_!) MD_\ &'WQ,_["]]_Z1Q4G_!%GP3I-M\)?&_BP6D3:W=ZV=/:[909%@CBC<(#U M +2$D=\#T%+_ ,$F3_QA]\3/^PO??^D<5;W_ 1B/_&-OBC_ +&B?_T1!0!S M?_!3O3;;3/VE/V9]>M8D@U636EMWND&'9$NK9D!/4X+OC_>-?I#FOSG_ ."I M1_XOA^S'_P!C"W_I1:5^C&: ,;Q?XT\/> ="FUGQ1KFF^'='B(62_P!5NX[: M!2QPH+N0N2> ,\U\@?%O_@F)\"/VBO\ BL?#%S<>%;G5T%Y'J'AF>.2PNMXW M"7R6!7#9S^[* ]:^B?VE_@E:?M$_!'Q1X"NIQ:/JEO\ Z-=,N1!<(P>)R/0, MHS[$U\ ?!?\ ;%^)O[!OAVW^%WQO^%VNZAH6BEH-,\0Z2FX&#<2$5FQ%,HS\ MI#J5& 1QP 5/&W[*?[37[#WAZ]\9_#'XO7'C#PIHJ&ZN]%N3(NV!>78VDC21 M,H7.2C!L<@>GKWQA_:XNOC-_P3"\3?$?2H?['UJ_MUT;4(;=CBWF:=(9]AZ[ M61B1GD!P/>N)^*?_ 4@#H?^"#2M9TNU6:&Y@W$JN7=%=1D[71F MR, @$4R<>-O^"FG[1W@;Q!'X-U7P?\$O!EP+M+W6HO+DOVWJ[!1]UG?8BX0L M$4$ELD"@#J_VS#_QLL_9G_W8O_2F2F?\%'C_ ,9?_LL_]AA?_2RWI_[9A_XV M6?LS_P"[%_Z4R4S_ (*/'_C+_P#99_[#"_\ I9;T 5?VV;2'XM_\%%/@)\-M M>47/A:&!;^6QDYCG=I)7<,.AW"W13[9K]"/%W@K1?&_@[4O"^L:?;WFAW]JU MG-9R1@QF,KC '08XQCH0,=*^-O\ @HC\!_'%WXN^'_QW^%^FOK7B[P-*#=:5 M"A>6ZME?>"B#E\$NK*.2K\=*YR]_X*QV/C3PN_A_P'\+O&-]\6KR(VT.B2V: MM!:W+#&YG5B[*I.>47..=O6@"K_P1TT9/#GAOXS:3&^^.P\3+:JWJ$1U!_2O MT2S7YS?\$98KZW\&_%Z+5,_VFGB*-;K)!/FB-M_(X/S9K]&A?LX<_\N\7_H^>L3_@H?X1T_Q] M^WI^SEX>U6%;G3=0\F&Y@<962/[82RD>A P?K7G6N^/O&OQA_P""B'P'^('B MCPE>>"=%U>[2#P]I.I\7ALX6;,TJ8&TN\C$#T'&1@GV']M@_\;'_ -F'_?A_ M]*VH ^GOVX]$L+[]CSXI67=U>W 4;YF69XTW'J0JH !VY]:]=_;8/_ !B5\6/^ MQ>NO_0*\\_X)<'_C";P'_OWO_I7+0!XA\*;2'1O^"QGQ(@LHUMH;K0FFFCC& MT.[0VK,2/4MR?>L[]C'1K3XS?\%#OCUXZ\30IJ.I^&KN2UTI+D;Q:_OFA1D! MZ%8X=H/;<:U_AX?^-RGCW_L7?_;>UK'^*.@^._V!_P!KSQ-\9= \(W_C3X5> M- S:S#I2%Y;)V8.Y8 ':1("RLV%(V21QV,,@VR'Y)' .TD%G*JN31W&KQZ8;S4 MI83E#] 'JO_ 3*\*Z?X8_8Q\ R64*12ZG'/?W4BJ 9 M96G<98]R%51] *\%_:=^'7QE_9[_ &R+K]H7X=^"1\3-%U'3UM;O3XHVFGM, M1+&ZA$S(N1&&#HK 98,/7Z3_ ."=I_XPM^%G_8.?_P!'RUXS\??VBOC3^R;^ MTW=>(_%&FZQX[^ >IVP2VBT>PAW:6Y"[@75%)=65L>:^&5^&R#@ \ZUS_@H! M^SS^U);Z=X)_:"^'.M>$I+2]2=5O9)7M[:;!7YIH3%.@.[D;,8Z]*_2?P\-. M70--72)8YM*%M&+22*4RJT.T;"'))8;<?@6W^'/P ME^%/B+Q5XOO+N$QZQJ&EQ1_V8JN"Q61'#]0NA>W^B:3;V5Q.I)5I$0!L'T!R![ 4 =[FC-&:,T &:,T9HS0 9HS1FC M- !FC-&:,T &:,T9HS0 9HS1FC- !FC-&:,T &:#@@BC-&: /)[O]F'P)>W< M]S+9W1EF1_\,M> /^?&[_\ R3_ !H_X9:\ ?\ M/C=_^!DG^->N9HS1]1PW_/M?<'U#"_\ /I?CZ-J^NV&FZMK$C1: M=975PJ2WCKCW_P :ZKXA?&GP%\)C8#QIXPT;PM]O\S[)_:UZEOY^ MS;OV;B,[=ZYQTW"J>I?M _#31_!UEXLOO'GA^U\,7L_V6VU>748A:S3;6;RU MDSM+85CC.< T?4<,O^7:^X/J&%_Y]K[CN;6TCL[>.&/(CC4(H)[ 8%3# KB/ M"'QR^'GQ TW4=0\->-="UZRTZ,S7D^GW\\$>( M+W0;/3/%>DW]UKUJ][I4-O=H[7T"??EB /SJO==FC-(TBH/F.* MYCPM\4_!WCC5]3TKP]XGTG7-1TP(U[:Z?=I.]N&SM+A2=N=IQGT-,#J,T9K ML/B!X:U7Q7J/ABSUVPNO$6G1+/>:7#<*UQ;QMC:SH#E0$_AM MIBZCXK\1Z7XH@-9MJ-]'#]H!Q@IN(W#D.ZM9D$D4T3!D=2,A@1P M0?6@"?-&:3S%YYZ5D>(_&6A>#X;2;7-6M-)BN[J.RMWO)1&)9Y#B.)<]78\! M1R: -@X((/>F)&J=R?J:R]"\8Z'XH?45TC5;34FTV[DL+P6LH?[/<)C?$^/N MNN1D'D9JMX/^(/AGX@Z?<7WAG7;#7[*WN'M9;C3KA9DCF3[Z$J2 PR,CWH W M3&I8G)S]:7RUK!D^(7AF'QG'X1?7;!?%,MH;Y-'-POVIK<-M,HCSNVY!&<=J MJ^./BOX,^&=M!<>+?%.D^&X9\B)]4O$MQ)C&=NXC/4=/6@#IS"I[GIBE**RX M[5P7B+]H#X:>$= TO7-:\>>'],T;5&9;&_N=1B2"Y*XW"-R<,1D9Q5_P?\8_ M OQ!T:[U;PSXNT;7M,M 3<7FGWLN/ M\,?&?P'XUT_5+_P_XPT76K/2PS7T]C>QRI;!02QD*D[0 "(+?0O#'Q%\-Z_K-P&:&PT[4HIII HW,0JDDX )/TH ]*S1FC-&: #-%&:* M %HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** M"BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH * M*** "BBB@ HHHH **** "BBB@ HHHH *BNK6&]MY(+B&.X@D&UXI5#*P]"#P M14M% &!HOP^\+>&[QKO2?#6D:7=MG,]E810R'/7YE4&M^BB@ HHHH **** " MBBB@ HHHH **** "BBB@ HHHH **** (KJUAOK>2WN88[B"12KQ2J&5@>H(/ M!%9.@^"/#GA66671= TO1Y9>)'L+*.!G^I11FMNB@ HHHH **** "BBB@ HH MHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB M@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** M"BBB@ HHHH **** "BBB@ HHHH **** "ORH_:2N?'7[1'Q@\<>-_!'@;6/$ MEAX&DBTCPQKNG7D44%C>VY1+7<4 "R-@.0NT \#@U^H%IX.T"PDLI+;1-.MWL M3(UJT5I&IMS)_K#&0/EW=\8SWJUJ.B:=K'V;[?86U]]FF6Y@^TPK)Y4JYVR+ MD':PR<$\5ZQ::!HT'@'5$>^O7V1JS,0H M)[9)Q7Z@7'AC1[O4'OY])LIKYX3;M[\+Z-=06B>7;Q3:?$ZPIG.U 5PHSV% $/@/XA^&OBMX?36_"NM6FO:0TC1K M>V$@DB+J?F7/J._UKX.C37_@E^T7^U7!\&? \.I:['IGAZ/3M(T^)(XXI)K9 MB\Y3*AMK,SD9&XGGK7Z%:-H.F>'+(6>DZ=::7:!BP@LX%ACR>IVJ ,TZ'1=/ MMM2NM1AL+:+4+H*MQ=)"JRS!1A0[ 9; X&3Q0!^9?[%T'BCP=^UO\0M-C\*^ M(HO%NJ>$HKB]O/%LD>1J!W2?:+GRW8K#+)A5"9(! Q7I7[9'AKQ_XC_8X^)F MJ?&70_ LFLZ-!!-H-QX9:YG^S%YXEE8M<(I5B,#Y>Q-?=,>AZ=%J0#0 M!^;O[1?]B_#SXHZ/XONO$'P_U"[U'P):6DGA[XA65Q=?9HE4XELQ&C!G8@@Q MDJ6Y^8 YKZD_X)\Z%XA\-?L@_#JP\3K/'JJ6:1H5(/(Q$8QS7 MNNH>%M%U86POM(L;P6I!@%Q;))Y6.FS(^7\*TU4(, 8'H* /G#X5>'/CY8?M M+?$+4?&NM:;>?"BX,G]@64!4R1_.#$-H 92J9#[LY8@BO#?^"B4DNO\ QB^# MOAQ=%\;ZG!'<3ZM/'X6U(6WGQ6Z,Q,0,BA9XW,;^8<;5)VG.:_0#8O/ YJG= M:'IU[=Q75Q86MQ=0HT<,O$VC MZ?XK'C/X@Z[)8Z#!K=[]J:^N;J1UBGMP7))".QDD/+M%N.1@G<_8TU#5?V6O MC-+X(\5^$=2^'?A/Q?HR7-@FL7T4ZOJ5C"OVJ174X'FH=Y7J#[5^B7_"*Z*; M>Q@_LBP\BP8/:1?9DVV[#H8QC"'W&*DU3PYI.N- =1TRSU P$M";J!9/+)&" M5W XR..* /R5UGQC\0=1\>7G[4%K\.]=N+*U\2?VA9>(4NXOLX\-QJ;=K?R, M[R64LY8<9/XU[9?>*_AUIW[:'C3Q5\:VL+SPIKN@Z=-X!U76[?S],%MY(^U( MA9619"[9]<%O[P%?H N@Z:FD_P!EKI]JNF>7Y/V(0J(=G3;LQC;[8Q4%WX1T M/4-,ATVZT;3[G3H0!%:36J/%&!TVH1@8]A0!^=G[0=UX-\01_LU2_!3PGHVL M:%+XMU+^S]$OK=K&PO9O+S(&#H?D)R0VTKP,5%\$-1\)?\)=^T?XQ^+>@:!\ M.=(L-,M="U[P%IBL$V!LBZ=551(969%C=.N[MD$_H[+X;TF=[%Y-+LY&L&W6 MC/;H3;G&,Q\?(<<<8JM?^"O#VJSW4U[H.F7DUW&L5Q)<6D*_AOX]^+_C;XG:,/#WA;0T\)MI=IX"T@+)=-IL$H>2]O((U* MF5LH@4;C@X.2><3]G3Q+X3G_ &Z-.U?P;<>&_'VF>+[.\D273=(>QN?"%O"F MZ.)D&(U\PML8[=Y(R3CK^AVB> O#/AJ[:ZTCP[I.E7+(8FFLK**%RA()4LJ@ MXR <>PJYIOAO2-&NKFYT_2[*QN+D[IYK:W2-Y3ZL0 6_&@#2HHHH **** // MO^%^> O^ACM?R;_"C_A?G@+_ *&.U_)O\*J?\,X?#S_H75_\"Y__ (NC_AG# MX>?]"ZO_ (%S_P#Q=>1?,.T/O?\ D>1_PI=H?>_\BW_POSP%_P!#':_DW^%' M_"_/ 7_0QVOY-_A53_AG#X>?]"ZO_@7/_P#%T?\ #.'P\_Z%U?\ P+G_ /BZ M+YAVA][_ ,@_X4NT/O?^1;_X7YX"_P"ACM?R;_"C_A?G@+_H8[7\F_PJI_PS MA\//^A=7_P "Y_\ XNC_ (9P^'G_ $+J_P#@7/\ _%T7S#M#[W_D'_"EVA][ M_P BW_POSP%_T,=K^3?X4?\ "_/ 7_0QVOY-_A53_AG#X>?]"ZO_ (%S_P#Q M='_#.'P\_P"A=7_P+G_^+HOF':'WO_(7_"EVA][_ ,BW_P +\\!?]#':_DW^ M%'_"_/ 7_0QVOY-_A53_ (9P^'G_ $+J_P#@7/\ _%T?\,X?#S_H75_\"Y__ M (NB^8=H?>_\A_\ "EVA][_R+?\ POSP%_T,=K^3?X4?\+\\!?\ 0QVOY-_A M53_AG#X>?]"ZO_@7/_\ %T?\,X?#S_H75_\ N?_ .+HOF':'WO_ "%_PI=H M?>_\BW_POSP%_P!#':_DW^%'_"_/ 7_0QVOY-_A53_AG#X>?]"ZO_@7/_P#% MT?\ #.'P\_Z%U?\ P+G_ /BZ+YAVA][_ ,A_\*7:'WO_ "+?_"_/ 7_0QVOY M-_A1_P +\\!?]#':_DW^%5/^&_\A?\*7:'WO\ R+?_ OSP%_T,=K^3?X4?\+\\!?]#':_DW^% M5/\ AG#X>?\ 0NK_ .!<_P#\71_PSA\//^A=7_P+G_\ BZ+YAVA][_R'_P * M7:'WO_(M_P#"_/ 7_0QVOY-_A1_POSP%_P!#':_DW^%5/^&_\ (7_"EVA][_R+?_"_/ 7_ $,= MK^3?X4?\+\\!?]#':_DW^%5/^&_\ (M_\+\\!?]#':_DW^%'_ OSP%_T,=K^ M3?X54_X9P^'G_0NK_P"!<_\ \71_PSA\//\ H75_\"Y__BZ+YAVA][_R%_PI M=H?>_P#(M_\ "_/ 7_0QVOY-_A1_POSP%_T,=K^3?X54_P"&_\BW_ ,+\\!?] M#':_DW^%'_"_/ 7_ $,=K^3?X54_X9P^'G_0NK_X%S__ !='_#.'P\_Z%U?_ M +G_P#BZ+YAVA][_P A?\*7:'WO_(M_\+\\!?\ 0QVOY-_A1_POSP%_T,=K M^3?X54_X9P^'G_0NK_X%S_\ Q='_ SA\//^A=7_ ,"Y_P#XNB^8=H?>_P#( M?_"EVA][_P BW_POSP%_T,=K^3?X4?\ "_/ 7_0QVOY-_A53_AG#X>?]"ZO_ M (%S_P#Q='_#.'P\_P"A=7_P+G_^+HOF':'WO_(7_"EVA][_ ,BW_P +\\!? M]#':_DW^%'_"_/ 7_0QVOY-_A53_ (9P^'G_ $+J_P#@7/\ _%T?\,X?#S_H M75_\"Y__ (NB^8=H?>_\A_\ "EVA][_R+?\ POSP%_T,=K^3?X4?\+\\!?\ M0QVOY-_A53_AG#X>?]"ZO_@7/_\ %T?\,X?#S_H75_\ N?_ .+HOF':'WO_ M "%_PI=H?>_\BW_POSP%_P!#':_DW^%'_"_/ 7_0QVOY-_A53_AG#X>?]"ZO M_@7/_P#%T?\ #.'P\_Z%U?\ P+G_ /BZ+YAVA][_ ,A_\*7:'WO_ "+?_"_/ M 7_0QVOY-_A1_P +\\!?]#':_DW^%5/^&_\A?\*7:'WO\ R+?_ OSP%_T,=K^3?X4?\+\\!?] M#':_DW^%5/\ AG#X>?\ 0NK_ .!<_P#\71_PSA\//^A=7_P+G_\ BZ+YAVA] M[_R'_P *7:'WO_(M_P#"_/ 7_0QVOY-_A1_POSP%_P!#':_DW^%5/^&_\ (/\ A2[0^]_Y%O\ MX7YX"_Z&.U_)O\*/^%^> O\ H8[7\F_PJI_PSA\//^A=7_P+G_\ BZ/^&_\BW_POSP%_P!#':_DW^%'_"_/ M 7_0QVOY-_A53_AG#X>?]"ZO_@7/_P#%T?\ #.'P\_Z%U?\ P+G_ /BZ+YAV MA][_ ,@_X4NT/O?^1;_X7YX"_P"ACM?R;_"C_A?G@+_H8[7\F_PJI_PSA\// M^A=7_P "Y_\ XNC_ (9P^'G_ $+J_P#@7/\ _%T7S#M#[W_D'_"EVA][_P B MW_POSP%_T,=K^3?X4?\ "_/ 7_0QVOY-_A53_AG#X>?]"ZO_ (%S_P#Q='_# M.'P\_P"A=7_P+G_^+HOF':'WO_(/^%+M#[W_ )%O_A?G@+_H8[7\F_PH_P"% M^> O^ACM?R;_ JI_P ,X?#S_H75_P# N?\ ^+H_X9P^'G_0NK_X%S__ !=% M\P[0^]_Y"_X4NT/O?^1;_P"%^> O^ACM?R;_ H_X7YX"_Z&.U_)O\*J?\,X M?#S_ *%U?_ N?_XNC_AG#X>?]"ZO_@7/_P#%T7S#M#[W_D/_ (4NT/O?^1;_ M .%^> O^ACM?R;_"C_A?G@+_ *&.U_)O\*J?\,X?#S_H75_\"Y__ (NC_AG# MX>?]"ZO_ (%S_P#Q=%\P[0^]_P"0O^%+M#[W_D6_^%^> O\ H8[7\F_PH_X7 MYX"_Z&.U_)O\*J?\,X?#S_H75_\ N?_ .+H_P"& O^ACM?R;_"C_ (7YX"_Z&.U_)O\ "JG_ M SA\//^A=7_ ,"Y_P#XNC_AG#X>?]"ZO_@7/_\ %T7S#M#[W_D+_A2[0^]_ MY%O_ (7YX"_Z&.U_)O\ "C_A?G@+_H8[7\F_PJI_PSA\//\ H75_\"Y__BZ/ M^& O\ H8[7\F_PJI_PSA\//^A=7_P+G_\ BZ/^& O^ACM?R;_"JG_#.'P\_P"A=7_P+G_^+H_X9P^'G_0NK_X%S_\ MQ=%\P[0^]_Y#_P"%+M#[W_D6_P#A?G@+_H8[7\F_PH_X7YX"_P"ACM?R;_"J MG_#.'P\_Z%U?_ N?_P"+H_X9P^'G_0NK_P"!<_\ \71?,.T/O?\ D+_A2[0^ M]_Y%O_A?G@+_ *&.U_)O\*/^%^> O^ACM?R;_"JG_#.'P\_Z%U?_ +G_P#B MZ/\ AG#X>?\ 0NK_ .!<_P#\71?,.T/O?^0_^%+M#[W_ )%O_A?G@+_H8[7\ MF_PH_P"%^> O^ACM?R;_ JI_P ,X?#S_H75_P# N?\ ^+H_X9P^'G_0NK_X M%S__ !=%\P[0^]_Y"_X4NT/O?^1;_P"%^> O^ACM?R;_ H_X7YX"_Z&.U_) MO\*J?\,X?#S_ *%U?_ N?_XNC_AG#X>?]"ZO_@7/_P#%T7S#M#[W_D/_ (4N MT/O?^1;_ .%^> O^ACM?R;_"C_A?G@+_ *&.U_)O\*J?\,X?#S_H75_\"Y__ M (NC_AG#X>?]"ZO_ (%S_P#Q=%\P[0^]_P"0O^%+M#[W_D6_^%^> O\ H8[7 M\F_PH_X7YX"_Z&.U_)O\*J?\,X?#S_H75_\ N?_ .+H_P"& O^ACM?R;_"C_ (7YX"_Z&.U_ M)O\ "JG_ SA\//^A=7_ ,"Y_P#XNC_AG#X>?]"ZO_@7/_\ %T7S#M#[W_D+ M_A2[0^]_Y%O_ (7YX"_Z&.U_)O\ "C_A?G@+_H8[7\F_PJI_PSA\//\ H75_ M\"Y__BZ/^& O\ H8[7\F_PJI_PSA\//^A=7_P+G_\ BZ/^&_\BW_POSP%_P!#':_DW^%'_"_/ 7_0QVOY M-_A53_AG#X>?]"ZO_@7/_P#%T?\ #.'P\_Z%U?\ P+G_ /BZ+YAVA][_ ,@_ MX4NT/O?^1;_X7YX"_P"ACM?R;_"C_A?G@+_H8[7\F_PJI_PSA\//^A=7_P " MY_\ XNC_ (9P^'G_ $+J_P#@7/\ _%T7S#M#[W_D'_"EVA][_P BW_POSP%_ MT,=K^3?X4?\ "_/ 7_0QVOY-_A53_AG#X>?]"ZO_ (%S_P#Q='_#.'P\_P"A M=7_P+G_^+HOF':'WO_(7_"EVA][_ ,BW_P +\\!?]#':_DW^%'_"_/ 7_0QV MOY-_A53_ (9P^'G_ $+J_P#@7/\ _%T?\,X?#S_H75_\"Y__ (NB^8=H?>_\ MA_\ "EVA][_R+?\ POSP%_T,=K^3?X4?\+\\!?\ 0QVOY-_A53_AG#X>?]"Z MO_@7/_\ %T?\,X?#S_H75_\ N?_ .+HOF':'WO_ "%_PI=H?>_\BW_POSP% M_P!#':_DW^%'_"_/ 7_0QVOY-_A53_AG#X>?]"ZO_@7/_P#%T?\ #.'P\_Z% MU?\ P+G_ /BZ+YAVA][_ ,A_\*7:'WO_ "+?_"_/ 7_0QVOY-_A1_P +\\!? M]#':_DW^%5/^&_ M\A?\*7:'WO\ R+?_ OSP%_T,=K^3?X4?\+\\!?]#':_DW^%5/\ AG#X>?\ M0NK_ .!<_P#\71_PSA\//^A=7_P+G_\ BZ+YAVA][_R'_P *7:'WO_(M_P#" M_/ 7_0QVOY-_A1_POSP%_P!#':_DW^%5/^&_\ (7_"EVA][_R+?_"_/ 7_ $,=K^3?X4?\+\\! M?]#':_DW^%5/^&_\ (M_\+\\!?]#':_DW^%'_ OSP%_T,=K^3?X54_X9P^'G M_0NK_P"!<_\ \71_PSA\//\ H75_\"Y__BZ+YAVA][_R%_PI=H?>_P#(M_\ M"_/ 7_0QVOY-_A1_POSP%_T,=K^3?X54_P"&_\BW_ ,+\\!?]#':_DW^%'_"_ M/ 7_ $,=K^3?X54_X9P^'G_0NK_X%S__ !='_#.'P\_Z%U?_ +G_P#BZ+YA MVA][_P A?\*7:'WO_(M_\+\\!?\ 0QVOY-_A1_POSP%_T,=K^3?X54_X9P^' MG_0NK_X%S_\ Q='_ SA\//^A=7_ ,"Y_P#XNB^8=H?>_P#(?_"EVA][_P B MW_POSP%_T,=K^3?X4?\ "_/ 7_0QVOY-_A53_AG#X>?]"ZO_ (%S_P#Q='_# M.'P\_P"A=7_P+G_^+HOF':'WO_(7_"EVA][_ ,BW_P +[\!?]#':_DW^%+_P MOOP%_P!#):?^/?X53/[.'P\_Z%U?_ N?_P"+I/\ AG+X??\ 0NK_ .!<_P#\ M73OF':'WO_(I?VCU4/O?^1=_X7UX#_Z&.T_\>_PH'QZ\!G_F8[3_ ,>_PJG_ M ,,Y_#[_ *%Y?_ J?_XNC_AG3X?_ /0O+_X%3_\ Q=%\P[0^]_Y!_P *']S[ MW_D7?^%\>!/^ACM?_'O\*=_PO;P+_P!#%:_DW^%4?^&=?A__ -"\G_@5/_\ M%TO_ SOX _Z%Y?_ *G_P#BZ+YAVA][_P AWS#M#[W_ )%W_A>G@;_H8K7\ MF_PI1\ ATT!?_ J M;_XNB^8=H?>_\A_[?VC][_R+P^-_@@]/$%K^3?X4O_"[?!)_YC]M^3?X52'P M \!C_F K_P"!,W_Q='_"@_ PZ:$O_@3-_P#%T[X_M#[W_D-/'=5'[W_D7O\ MA=?@K_H/6Y_!O\*4?&GP8?\ F.V_Y-_A5(? 7P./^8$O_@3-_P#%TX? GP0/ M^8&O_@3+_P#%4?[?VC][_P BO]M_N_B7A\9/!I_YCMO^3?X4?\+C\'?]!VW_ M ";_ JD/@5X)'31%_\ B7_ .*IP^!W@L# T1?_ (E_P#BJK_;NT?O?^0[ MXO\ N_B7/^%Q>#^VN6_Y-_A1_P +A\(?]!NW_)O\*I_\*/\ !8_Y@H_\"9O_ M (JC_A2/@S_H"C_P(E_^*I_[;_=_$=\7_=_$N?\ "X/"'_0;@_)O\*7_ (7! MX0_Z#<'Y-_A5/_A27@P?\P4?^!$O_P 51_PI/P;_ - 8?^!$O_Q5'^V_W?Q# M_:_[OXES_A<'A#_H.6_Y-_A1_P +@\(?]!RW_)O\*I_\*3\&_P#0%'_@1+_\ M51_PI/P;_P! 4?\ @1+_ /%4?[;_ '?Q'_M?:/WLM_\ "X/"'_0;@_)O\*7_ M (7!X1_Z#<'Y-_A5/_A2?@W_ * P_P# B7_XJC_A2?@T_P#,%'_@1+_\51_M MO]W\1?[7_=_$N?\ "X/"/_0;@_)O\*3_ (7#X0_Z#<'Y-_A53_A27@S_ * H M_P# B7_XJD_X4CX,_P"@*/\ P(E_^*H_VW^[^(7Q?]W\2X/C#X0_Z#<'Y-_A M1_PN'P?_ -!RW_)O\*J?\*1\&'_F"K_X$2__ !5'_"C_ 7_ - 5?_ F;_XJ MC_;?[OX_Y"OB_P"[^);_ .%Q^#O^@[;_ )-_A2?\+D\&_P#0=M_R;_"JG_"C M_!8_Y@J_^!,O_P 51_PH[P5_T!%_\"9O_BJ7^V]H_>_\@OB_[OXEL_&3P:/^ M8[;_ )-_A2?\+E\&_P#0=M_R;_"JA^!G@H_\P1?_ )E_P#BJ3_A17@G_H"+ M_P"!,O\ \52OCNT?O?\ D%\7_=_$N_\ "Y/!O_0=M_\ OEO\*3_A"?^@(O_@3-_P#%4A^!7@G_ * :_P#@1+_\51?'=H_>_P#( M+XS^[^)=_P"%S>#/^@];_DW^%'_"Y?!O_0=M_P F_P *H_\ "B/!'_0#7_P( ME_\ BZ4? GP0/^8&O_@1+_\ %47QW:/WO_(+XSKR_B7O^%R^#?\ H.V__?+? MX4?\+E\&_P#0=M_R;_"J/_"BO!/_ $!%_P# F7_XJC_A17@G_H"+_P"!,W_Q M5%\=VC][_P @OB_[OXEW_A"1_S!%_\"9?_BJ7_A1G@K_H"+_X$2__ !5%\=VC][_R"^+_ +OXES_A#1_P QVW_)O\*/^%R^#?\ H.V_ MY-_A5(_ KP2?^8(O_@3-_P#%4G_"B?!/_0$7_P "9?\ XJE?'=H_>_\ (+XO M^[^)<;XS^#%ZZ];_ )-_A2?\+I\%_P#0>M_R;_"JA^!/@@_\P-?_ (E_P#B MJ3_A1'@@_P#,#7_P)E_^+H_V_M'[W_D*^,_N_B6_^%U^"O\ H/6_Y-_A1_PN MSP4/^8_;?DW^%4C\!? QZZ$O_@3-_P#%T?\ "@O O_0!7_P)F_\ BZ7^W]H_ M>_\ (5\;VC][+G_"[O!/_0P6WY-_A15+_A0'@/\ Z *?^!,W_P 711?']H?> M_P#(5\=VC][_ ,CT:BBBO5/3"BBB@ HHHH **** "BBB@ HHHH **** "BBB M@ HHHH **** "H[F0PV\LBX)5"PS["I*@OO^/*X_ZYM_*FMT)[,Q/^$BN?[D M7Y'_ !H_X2*Y_N1?D?\ &LNBO3]G#L>5[6?UGW-3_A(KG^Y%^1_QH_X2*Y_N1?D?\:RZ*/9P[![6?U MGW-3_A(KG^Y%^1_QH_X2*Y_N1?D?\:RZ*/9P[![6?UGW-3_A(KG^Y%^1_Q MH_X2*Y_N1?D?\:RZ*/9P[![6?UGW-3_A(KG^Y%^1_QH_X2*Y_N1?D?\:RZ M*/9P[![6?UGW-3_A(KG^Y%^1_QH_X2*Y_N1?D?\:RZ*/9P[![6?+YO#/BK6;JRU>&))GABL)IE M"N,J=RJ1TJX8?VCY81NQ.M*.KD?0'_"17/\ ._!C]H_P)\?CJH\%ZE/J!TSR_M/G6DD&W?NVXW@9^Z>E>G4IT%3?+.-F"K2 M:NI&I_PD5S_<^!/C#X.^)KZPGA?7(-9DTB3R;Y8 M$<&%_F^4[@,GY6Z>E<_\#?VBO#7[0":\WAVRU:S&C3I;W']J6Z1;F;=C9M=L MCY3UQVJOJUDVX[;_ ##V\OYCV;_A(KG^Y%^1_P :/^$BN?[D7Y'_ !K+HK/V M<.P_:S[FI_PD5S_+=<@T1- M1F-O:M.CMYL@Q\HVJ?4=:<:,9.T8W8.M-:MGH?\ PD5S_?ETV%[:5[7.\_X2*Y_N1? MD?\ &C_A(KG^Y%^1_P :\*\>_M:?#/X9?$2'P3XCUR73M>E,("-:2M$OFXV% MI NT#GDD\=ZZ'Q9\=O!W@KXC>'/ VJZA+#XC\0*&T^W2V=TD!8J,N!M7E3U- M7]5>GN;Z_(7MY?S'JG_"17/]R+\C_C1_PD5S_&/A-X9G\0>+-7@T;2HB%,TV278]$15!9V/HH)XKR#X? M_MZ_!_XC^+;'PWIFM7MOJ=_.EM9K>6$D:7$K$*JJP! )) &[%;1PDIQZYKVHV M^E:39IYD]WF_\%%O@AJ6N+IH\07MNKOY:7L^FS+ QS@SAV#VL^YJ?\ "17/]R+\C_C1_P )%<_W(OR/^-9=%'LX=@]K M/N:G_"17/]R+\C_C4D7B.09\R%&]-I*_XUCT4O90[#]K/N;?_"2?].W_ (__ M /6KF_#OQ)N=7\5>+-,FLXE@TFXMX8&1B&8/;I(=V>"GAZ;C4;6R_5$2KU$XZ]?T9ZK_ ,))_P!.W_C_ /\ 6H_X M23_IV_\ '_\ ZU8E%<_L8=C3VU3N;?\ PDG_ $[?^/\ _P!:C_A)/^G;_P ? M_P#K5B44>QAV#VU3N;?_ DG_3M_X_\ _6H_X23_ *=O_'__ *U8E%'L8=@] MM4[FW_PDG_3M_P"/_P#UJ/\ A)/^G;_Q_P#^M6)7/>//B#X=^&'AFZ\0>*-6 MM]&TBVQYES<$\D]%51DLQ[*H)/I35",G9(/;S74[S_A)/^G;_P ?_P#K4?\ M"2?].W_C_P#]:OE;PC_P4$^#'C+Q-:Z':Z[>VMU=S+;V\EYI\J12R,<*H8 X MR2/O 5WGP]_:-\+_ !+^*/BWP%I5OJ<>M>&2PO9+J%%@;;)L/EL')/)[J.*W ME@90OS0:MZD+$R>TCVW_ (23_IV_\?\ _K4?\))_T[?^/_\ UJQ**Y_8P[%^ MVJ=S;_X23_IV_P#'_P#ZU'_"2?\ 3M_X_P#_ %JQ*X7XU?&30_@/X$N/%OB* M&]GTR":.!DT^)9)=SMA:5VSU7_A)/^G;_P ?_P#K M4?\ "2?].W_C_P#]:OGBX_:V\&VWBWP#X>-AKCWOC2TM[W3I$M8S%&DQ(03- MYF5(QS@-^->V54\*H6YHVN)8B;V9M_\ "2?].W_C_P#]:C_A)/\ IV_\?_\ MK5B5@>-/'WAWX=Z+<:MXDUBST>QAC>4O=3*A8*,D("O;R&*:\L;"6: MWC8'!^<#Y@/501Z9K:."E*3C&#;7J0\3)*[E^1]5?\))_P!.W_C_ /\ 6H_X M23_IV_\ '_\ ZU[@.4D4]_;T(/(((->6 M?&C]KWX:_ ;78M$\4ZI=IK$D*W'V.SLI)6$;$A6+8"\X/&[/'2HCA>>7)&-W M\QO$22NV?0?_ DG_3M_X_\ _6H_X23_ *=O_'__ *U>4?!_XX^#?CMX?EUC MP;JPU*W@<17$3QM%- Y&0'1@",CH>AYP3BN\J98>,'RRC9C5>;5TS;_X23_I MV_\ '_\ ZU'_ DG_3M_X_\ _6K$HJ?8P[#]M4[FW_PDG_3M_P"/_P#UJ/\ MA)/^G;_Q_P#^M6)11[&'8/;5.YM_\))_T[?^/_\ UJ/^$D_Z=O\ Q_\ ^M6) M11[&'8/;5.YM_P#"2?\ 3M_X_P#_ %JT=.OOM\#2;/+PVW&<]A_C7)UT7AW_ M (\G_P"NA_D*RJTXQC=(VHU)RE9LU****XCN"BBB@ HHHH **** "BBB@ HH MHH **** "BBB@ HHHH **** "BBB@ I,4M% "8HI:* $S1FBB@ S1FBB@ S1 MFBB@ S1FBB@ S1FBB@ S1FBB@ S1FBB@ S1FBB@ S1FBB@ S1FBB@ S4-\?] M"N/^N;?RJ:H;[_CRN/\ KFW\JJ.Z)ELSD****]8\8**** "BBB@ HHHH *** M* "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH M **** "BBB@ HHHH *_-']I&#Q1<_P#!0RVC\&Z1I.N^(VTZ'[-8:X@:TE_T M9]V\%E'"Y(Y'(%?I=7YR?M)>%W\5?M'ZKXST6^^)_A;6=/QIT=SHG@:6[3,0 M,320W"W4>Y'&<$*,@UZF7NU25^S7]6,*WPKU/5MWDF:)Q_HS^:RAD8AE!"EMN..E7M'\4>,M/\%Z[I-YXS^.. MI:M=SVUQ8:O)X)N%>Q:(N64*;IMRR;@",C[O.:S/ 44G_"XM(^(_Q+MOBGXV MUG1\&RBM_ )LEW+G8TC*_P V"2<8SG&21Q7I1@E"::5WV7EYIZ?-&#=VB']@ MOX7>*?$?CGQO?:;\1=3T"VT+6H6U"SMX-RZQAY"1*=XVYVL.C??-:?PV^._Q M"U3]F7X^ZY=^+]5N-7T:^MX].O)+@F2U5I<$(>V1Q69X'35/A5\5]5U_P9+\ M5=(\+:QJ2WVHZ*_@)Y'FC$AGS,N\ '!Z&G^$_#VC^%_A%\2_ _]E?% M&Y_X3.YBN/M__"OI4^Q['W8\O[2?,STSN6M*EIS+OBE M\'_VU/!_A/Q'\2;WQII7B>S%U=0W,7D6T0=)3B.'.])T? MQK\#OAY\.O[(^*-G_P (C.TW]I?\*_ED^UYW<>7]I&S[W]YNE=3X[\0:'XY_ M:"\)?$V7PQ\4;:+0K);)]('@65OM( E!/G>>-F?-Z;#T]ZE\LDTXK:73_P ! MZ?UU&KKKVZ_>>;_&/XP:A9WOBO5?!?QR^(_B?4M/NY)@-*TZ1-%M5,G$;N9L M!5' ?80<=,&J/[4OB'Q-\6?@E\"O'6M>()6N=4WV4ME'$%B6XCD93=#!QO8; M<@ #C\*BTSX?76AZ%XM\)Z5J?Q=TOP/KDC3'2X_A\TCL_&WS6,P+ ':5W8 M'2NM\:Z!H'BO]GKP;\.4T+XJ6^J>%9WN+/6AX&E"2%V8L&A\XD?>'(BZDZM.YT_[1'Q!^(G[-NE^#_AU_PLO7=?O/$EVU[>^)$L@V MH6]IF.,06Z;VR<[VX()) &.:S_@[^T/XT\!_%W4+:#5/'7C3X>2:3-; M%TN8)XH'EXD.< E-O4 A^F1FL;Q/;W'Q+\$:5%XU;XN:CX]T6]-UI/BBT\"O M";2/:@$)C60;P&0/N!4@GZYWO GC_P :+XEMKSXC:Q\7?&>AP03VYT*'P(]K M#+AK9?"T _T&1%DBR"F=J@%QC"Y^7))S7V_^Q'_ ,FJ_#O_ *\' M_P#1TE?!=K\+YM.T'Q)X3T[6/C)IO@?4Y#-'H\?@65U+[@1YP\\!\!0#MV[B M >,8KZI^"/[0.C_!OX5>'?!G_""_%'5_[(@,'V[_ (0V6#S8VW[V/O M'I66,BYTN2GKK=)*UE8=-VE=]CP7]JGX2R?&W]N/6/"EM*8;^X\.B>S;. 9X M[9GC4^Q*[?QKB?AK\6]3^*'[2'P$L]?BFC\0^&)5T2^:]>[S>,]'F_:HA^,W_"+_ !1'EV/V+^Q/^$&EY__;/&7CSPMI>DSR6FAZ=X'LC(@96=5: MZ96!.2H)!SG)Q@#%+JW[1'QEL?@U\/\ QUJVL:UIDNB^(FTC5XY(VMQJ,&(Y M8GE0@!C@2(3CGCO5WQ$EWX=^)&N^,/A&?BW\/YM=D,NH:;)X&:Z@=R2Q9^*0U!=8_MC_A(?^$!ER9,;=OD_:.F MSY?O^_M7NWP!^-?AOX#?"O1_!EI\/_BCJ7V$.TM]_P (=+";B1W+,^SS&V]< M8R>@YKFQ$(.DXTHZZ+;HNOS+@WS7D]#@?^"B!'B+]H+X->%]:F:+PI&ZTYX[9(C:21,&C9&4 K M@@<9P>AR#7R7^TKXR\"?M+>%[73]6^'?Q7TK5+!VDT_5K;PE(SP,V-P*EQO0 MX&1D=!@BO*?!X\4Q:[X?;QKXC^-/B?PWH=W#=P:,O@VX1;@Q,&02,T[<# ZA MCZ$5'LI5*,(WY7&^G?TL5S*,F[7N4?C'\8-0L[WQ7JO@OXY?$?Q/J6GW>WU M"YL?W:7#)(D:LZ#@CN1TY->?:9\/KK0]"\6^$]*U/XNZ7X'UR1ICIC^(/AG\+O"/]E_%&#_A"+F6X^V?\*]E;[;O ME#XV?:1Y>,8SEJ[G&DG'2]GVZ6]%U,;RU_KJ=_X8\3_%#X)_ML^'/ WB/XDZ MCX[TGQ!:&XN%O(_*A7>'=#NQ:V&G:$"I^8OMW[67=@+DEB,O%^C>+?VF/"WQ;_X1CXHV MO]AVRV_]C_\ ""ROY^!(,^=YXV_ZSIL/3WKS[4+*^\&>.]>\0_"*;XM^ +77 MI#)>Z7)X%>ZB4DDDH3(!@%FVY7(S@-6"CS*]DI\JUMI>^O3MY%WMZ7-KXQ_& M_P ?^&?BEH/PBU_QWXD@L=#T\/K&N>#[+=J>I3,"Z, ,%0$:-3@XR&)W<4_X M;?'KXEP?#+XWZ5=:QXGO-/T?2'U'P]XCUZU>WOT D5-K.>K$,#C)Q@XX-8_B MG2(;VZ\+^)_#[?&71_B5HUK]FN/$TO@R68ZCRQW2(9<@X* M?$VO>$O&VF>/-4^+OBF[\1Z4=+B)\!21VU@"X8R+"LP5F.,<;>.]7RPY$N5= M+Z=;ZM:?KMI85W=ZGK?[%VG_ !9^(?ASP?\ $+Q/\3YM2\/>3ZK(UV5.%9DC&P'_OIS M^%;_ , /CEH_P,^%&B^"O^$(^*.M_P!FB4?;O^$,EM_,WR,_W/-?&-V/O'I2 M_'3XO>!?C_X!N?"WB+X8_%9(6<36]W;^%9!+;3 ';(F6QW((/!!(KCBIQQ:J M\ONI]$EH:.SI\M]3W;0/@9\.+KX4Z3X:/A?2+WPX+*(HK6Z?.-@/F[Q\P<_> MW@YR"=-DFAL'2-05E83(&RW+8^ M[NP>17E.E>&_%<.DP^%;[Q?\:I? D.$&E6_@JX1GB!_U7-P0%]N5_P!FNAUB MQFMOC+XI\8^#9/B[X0T_Q1O_ +4LX/ C33D.=SHDC28 +<@[QK%\$6-Y\,?A5)X8\)W_ ,7M&UD:T=8CUBU\ RQA M@81&8)(OM)#J<9R3C./EXJ;X=:3I<'Q%U'QS\3M$^*7CW7+NREL/+A\"-90[ M)(VB=GV/\QV,P& ,9SS6\H4^6:4=&^BU?WK]58E.5UJ5(XP<\FO0?VA_P!I#XG7$OPSN=*/A_JL]G\3[_P")UJM[B.YU>W:"]L@4'[F4,23SDALD'/'2OH2OE;]@;P=H M'@7PIXETS2]-\7PZI)/#=:CJ'BG1#I:W+,'"K!&6;Y5VMGDD;QZ@#ZIKYW%) M*M+EV.RG\*N%%%%\?7]&=U1117,:!1110 M4444 %? /_!3:YDU/QS\(?#VH7#V_AJ[NW>Z.[:F3+$C,?=48_3<:^_J\H_: M,_9R\.?M)>#(]$UR2:PN[60SV&IVP!DMI",'@\,I&,KQG Y! -=F$JQHUHSG ML9U(N46D;UW\%/A_>>'M,TJ;PII']F::T4MDJ6ZQFW:,AD9'7#*<@<@\\YSD MU\8_ ;4H-'_:I_:BV/BCXZZSK?A/2+F&XATB.W=!,(G#(CEI6&T;1P0V.V*Z:S_8ALCXO^+NK MZCXKEN[/X@VTUN]G#8>4]COE$@82&1O,VD#C:N:ZX3I4E*,JG-==GW70^&M1T"&]FT9)3]F,CV;2$[?\ >P?PJA-_P3I\ M6:S\-+7P-JWQGN'\/:==?:-.L(M$0P19+%BP\T,S$N._V/KCXK^+?B=K&LP:OJ2+_P (W)S9JHG*!@,X0AE) M 10,<5]??"G]AFT\!:I\1IM=\:7GC&U\:V+V-VMW9B*X7>Q9I&E\QM[Y.<[5 MYYKSJ/\ X)O>)I? U[X*G^-6HKX3%R+BRTM=,W0(V[):1#,,GKP"!GYO:B&( MPT)WC)+6.MMTEK;3N#A-JS7OWUCX?U3P]IIO=.AE M*PW&<@[U[\ #\*I:7JWQ;^,_[0GQK\(:/\6=6\*:7HC7,\$<2&8A4EPD49W* M8ATRRG.!BO?+O]C3[5\0OA)XH_X3#;_P@.G6MA]E_LS/V_R23OW^=^[SGIAL M>IK:^&7[*_\ PKGXQ_$?QY_PD_\ :'_"8)*G]G_V?Y7V3?)O_P!9YK;\=/NK M6+Q%!)N-KV[=;^G8KDF]'_6AR'_!.SXL^*/BG\(-7'BO5)]:O](U1K2.^NFW MS/&45@'8\L02>3SCZ5WG[6_P=\(?$WX3Z[J?B72/[2OO#^EWMWILOVF:+R)? M*)W8C=0W*+PP(XZ4O[*W[-?_ S-X5UO1O\ A(_^$D_M*_\ MWG_ &'[+Y?R M!=NWS'STSG(^E:/[0_P9\4_&C1+72O#_ ,1+GP)9F.:'4(X-/%VM]'(H78V9 M$V@#=ZYW5R3J0^M.=.7+&^^O_#FJ3]G:2NSQ7_@G7)91?LA:F^I3_9=.6_U MW,^<>7%Y:[VS[#)KX^\+-\0/#GP(^*=OX%T./Q3\(-2O7M[G7+RR1;R$)M/G M+&)-P 7;DD,%SGY3FON3X ?L9Z]\$TN-'O/BC<>)/!%U;W,-SX:_L@6L4K3) ML9]_GN00/:N)M_\ @GYXQ\,:1K?A+PG\9[S1_ &LR,UWI,VF++)M/!7>)!DD M E=F<<@UZ,,10C5J2YDU)IZIV_*]_P,7";BE;8]H_8JD\+O^S9X03PCRGS,+[+GH17V=7AGP&^ GCKX4 M>(KV_P#$_P 8=7^(=C-:_9XM.O[5XD@?KH?#W_'D_\ UT/\ MA6%?X#IH?&:F:,T45YQZ09HS110 9HS110 9HS110 9HS110 9HS110 9HS1 M10 9HS110 9HS110 9HS110 9HS110 9HS110 9HHHH 6BBB@ HHHH **** M"BBB@ HHHH **** "BBB@ HHHH **** "BBB@ J"^_X\KC_KFW\JGJ"^_P"/ M*X_ZYM_*JCNB9;,Y"BBBO6/&"BBB@ HHHH **** "BBB@ HHHH **** "BBB M@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** M"BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH * M*** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HH MHH **** "N%\$?\ )1?B-_U^V?\ Z10UW5<+X(_Y*+\1O^OVS_\ 2*&NFC\% M3T_]NB9SWCZ_HSNJ***YC0**** "BBB@ HK\M/$^O^(/V@?VA/B7:Z]X0\4_ M$"TT6XELM-T;0M5^Q1Z8JR,BRE"#N)V@Y[DG.>*ZNQ^%?CG5?V0O%"?$K4-4 M\&Z]X*NFO-!U+4[MEE^SE%/V=V5B65F&%'4,5QQQ7JO J*7-.S=OQ^=_P.?V MM[V1^D%%?FW^Q5K6L?M3_&L^)OB!XL:]N?">GVZV.A)(T8N2ORB=D!PP#?,W MJ[+D <5ROP@^$"_'J3X]_P!N^,/$.G6V@W4]U;6]K?;;5I UP5:9&!W!=F M1@$\TW@5"4HSG;EM?3N'MKI-+<_4ZBOR+\0?$WQ1XA_81\.F]U:^:?3/&#:? M;WGGL)&@%LSJA;.2%+$#/8 =J]7_ &FM"\1_LV?!NPOM'\>>*=:U;Q[/;0:G MJ%_=C=#$D3/Y4!4 QAM^.O1<=,TWE[4E%SU;:V[![;2]C]':*_-/X;^ /B+X M#^,O@77_ -\-_&/@_0C-#;Z_P#VOJPO(+Z)W4-*W0#Y6)QSR 1BO/\ XBZ+ MK?A3XD^*-9^/?AGQYJUE)=!U#R[:VC+':82R-$P(*[5WKC&,4+ *4K M*?3RO]U_U!UK+5'ZV5YI\=OBKX@^$WARPU+P[X U7XA75Q=>1)8:27$D*;2? M,.V-SC( Z#KUKX2_:'T;Q5XEUKP1X@73?&'Q(^",.@VOV9-'NGCFXA&^2YVH M^R7=ABS+R, ,*YWXI>,O"\W['>DR?#O6/$\-G'XO"36FN70:YLF-LQ\I73 : M/@,/J<\U=+ )N+;O=_U?6XI5MT?JCIEW)?Z;:7,UN]I+-"DCV\GWHF*@E3P. M1G'3M5FOST^(J7_[0G[7/A7X2^(]G:]J.J^$M*\.WUU8&[N#(]FZ(F-K?PG$A4 MXP"5!QFL5@;KXM;)VMT;MN5[778_3"BOR#U'X:7$G[%^B_%MO%_B27Q#9ZP; M6VM9+\FUMXS,RYC7&Y7W -NW?A7ZH?"/5[KQ!\*/!>J7TK3WU]HEE1 MX$9F/U))K+$854%=2OJUMV*A4YW:QUE%?FKX+^$Z_M!?M4?';PSK?BSQ%I&D M6DUQ.(=+OO+1V$^%$BL&!1>"_V2O%7A_3M*1WCC?.5!,0Q@\!SCK70LO M /B-X.\?_#_Q1\/OAQXT\,P1RP?VY>:EJZW<&J0NR;I&' *ECCDH?'?]K3XW>&;OQQXC\.:1;W4TLL>C7?EM,HN !&2P("C.< 3_\ 70_R%85_@.FA\9J4445Y MQZ04444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% M !1110 44E% "T4E% "T4E% "T4E% "T4E% "T4E% "T4E% "T4E% "T4E% M"T4E% "U!??\>5Q_US;^535#??\ 'E)KB2WMIWC M."(7E4./H1P?8UK2A[6I&'=V)D^5-E36/^"BOP0T?77TT^(;R\6-_+>^M-/E MDMP>Y#8RP]U!![9KZ$\+>*-+\:^'=/UW1+M;_2=0A6XMKE%*B2-NAP0"/Q%> M ?L7?"SP2?V7O"FS0]+U(:Q9F?4I+BVCE-Q*S,'5RP.=N-N#TQ7G/[4^J>&O MAQK'A3PCH?Q1\6>!X+73O(L_"'@2TDN+F0;V*R%_-7 _A"DY^7CBNZ5"E.HZ M5*Z:ZO7;R2,E*2CS2/MFBOSD_9W_ &A/B%J?@'X\:%JOB76]1D\-Z+/>Z5J& MM1^3J=LXWK\_S,RMPIVEFVD'!KAK_P 7?&L_LL:/\8C\9-;Q;:H;--(0%"1Y MK+ODE#_O?F'W74C'%7_9\N9Q3@5I?'?7?B=^QG\(= M9E3XDZAXWFUV\M['2;[68O,N=-.V1IVRQ;>2%4+DX!SQQSBL%*\8N2YI;+4K MVJU=M$?>'?%/Q)\9V-]/%!XAL?%FFR?9<.RAF@ MY;:OS,0>"-HY()%=9\*]4^,_QU^-7Q<\+Z-\6;WPQI6D:H^&F@-T\<0N)52. M'++Y8PO)!S@ >M:2P$HIRVT?3 MHQ)<2QQ-(RJ6"C"KR>6'2O _^'C_ ,#/^AAU#_P57'_Q-?2,FEP7NEK8ZC%% MJ,+1JDJW$8=)<8Y*G(/(S7P#XP\,:/%_P4[\-:6FDV*:8]BA:R6V00D_993R MF,=>>E9X6G2J\RJ)W2;T?;Y#J2E&UC[>^%WQ2\/?&/P=;>*/"]S)=Z/%OC!\0OB#X+_:*^)\'BO5K3P]IL4UIX=M8IRL4#!P? M,0=BJ!.?^FAJOJ;FE.+]UVM\W:WJ+VMM'N?H517Y;J5Q/-;K*0AR"J#)K-X;PIY@0H[-U)# X).-I MQP:^S*X:U%T)N#9M"7.KA1116!04444 %%%% !1110 4444 %%%% %#7] >*XWX:_'CP?\ %KP+J'B_PW?376AV M+RI/-+;/$RF- [X5@">".E7?C8"?@YXY Y/]AWO_ *(>OD[_ ()_,!^QIXYR M0,7&I9YZ?Z*E=M.C&5&51[II?>9N34E$^CO!W[4?PW\;_#S5_'%CKXMO#&DS M&"[OK^!X CX4[0K#+$[EP "23@F)KNH6QED$4=U<:9, M(78G Z L 3ZJ/>ODG]GWX(ZW\>OV*/%?A_P[<11ZQ#XI6]M[>XD\M+HI;H#' MN/ .&)!/&0,XZC5T[X[^*_@=I/AWP+\L4N$Q^\20%HI M'7AOD*D]<\YKTOJ5'FE&-VT]KI.WZG/[65DWHC],-2U*WTG2[K4+EBMK;0O/ M(P!)"*I8G'?@5\^>'_\ @H%\%_$^O:=H^GZ]?27U_<1VL"-IDZAI'8*H)*X' M)'-?0UI<0W]C#/"0]O-&KH2."I&1^AKX)^!5G;_\/*?BA%Y$?EQVUP438,*0 M8,8':O.P]*G4C-S3]U7_ *T-YR<6K=3[]HK\[M*U3XM_&C]H3XU^$-'^+.K^ M$]+T1[F>!(D,Q"I+A(HSO4Q#IEE.<#%LWN)IH8FA\TLQ;.]AA@"V?OGXD^V75?TC],;VZ2QLY[F M0,4AC:1@HR2 ,G'Y5YO\"/V@_#O[0NC:IJ?ARRU6R@TZY%K*NK6Z0NSE=V5" MNV1@^U>1_"WX#?%7PJOA[QAJ/QLUOQ )+8W6K:)J&Z2V=7A)VPDLVTJQ7G:, MX[=*^=? G[6/Q"\-?LC^//$MSXAO=7\2/XBCTBPO[]_.:S1XMS,N[C@*V,]R M#1#"*<9*#4G=*^JW?H#J6:NK'W%\TM+?P':&2Z MFG5@IDF8$':3N.,XP !R:U> 4HQ=.5][O7H[:(GVUF[H_1^BOS07]HKXL#] MD#QI<:KJ^N:?KVA:W96]AKMS"]K=W%M*S<,2!N(V[776R MN/VR['Z945\)7GB[XC_M2_M3>-/ 6B^/]2^'?A/PFKJ?[%)2XG9'$98L"I)9 MB3R< <9.:R?VCOB=\3/V=M&\&_#*Y^(.J:Q>ZS?37%QXJM+3?J0L-Z*D4:D MY,@.\Y#9/RC<,FLU@I.48U5F[:'W[?7B:?97%U(':."-I6$:E MF(49. .2>.@KR;X%_M):3\>=>\7Z?I6BZGI2>'IH86DU2/R9)O,#$'RB-R8V MGAN>17RQ^SK\:?'6E?M!P^'=-U'QWXX\":I9R;3XUM&CN8;E8F=0)6R%!90N M20OS\C(S7KG[.7ASXG^&OCK\1->\2_#2XT'1?&=W'=_:WUJRN/L/EQL K)'( MS/N) R!QWJIX54HS4VKV36MNO82JP6=J5NH7D8*JE)2@[YSG&,X)KY-_8MO++X>_LXZ_\0='^'LG MQ,\:RZZ;&YL[9=]U%!L5@0WER%5Y)/'.>3P*B\;?%_PQ\9?V2_C/J_A_X>V_ MP_N4U'34U"&VN1*MU)YHPY41HJL,$' R<\U[;P=/GY$G9-)NZ[]M_0Y/:RM> MY^A'P_\ &UA\2/!6B^*-+CGBT[5K9+N!+I0LH1AD!@"0#]":W+JX6TMIIW!* M1(78+UP!FOSGU;XM>-O^$+_9R^$/@S7Y?"3>)=(M'O-9M1^_57K3[M+R3-%5\CZ>^ O[0WAG]HG0M4U;PQ;:E;6VG7?V.9=3A M2-R^T-E0KMD8/J*]/K\D_P!GSP7\0=3_ &=_B3XI\(_$J_\ !MGX=O9;U]+T M^,QM>R)$K,7G5U91M& N",]>M>Q:A^T1-XZ_9G^&^M>*OBMKW@;7YKBZM9H_ M#%H9;_63&P16 5T"8XR3P6;CFMJV 2J-4WI>W5M:7[$QK:>\C] -6U*+1M*O M=0G#-!:0O/($&6*JI8X]\"N!^ _Q[\.?M#^$KGQ%X9M]1MK&WNVLW34HDCDW MJJL2 KL,88=Z^)/V3J$3+!N5 MB"[LH()'WB""#@5ZS_P2R_Y(%K7_ &'IO_1,595<'[&G*4G=JUO1W*C4YI)+ MS/;/C'^U;\.O@-KUGH_C#5+FQO[NW^U1)!92S Q[BN6GFC6[91) MM&[&R7C/I7*_M/\ Q \1_"W]CCX3:AX0UFZ\.7UPMA%+/I[^4TBFS)()'7D M_A1##0JTH..DI.V^FGR!U'&3OLC[KHK\];SQ#\6_@I^TU\'[;6OBEJ7C'3_& MK6WVNQGB\FUC6618V18=S*,;P0X"G(YJ_P" ]>^)O[97QD^(,5G\2]7^'7A7 MPQJ:C%I&F M7E_.&:&UA>=P@RQ55+''O@5\,?%OQ3\3O@]\7?@%X,U#X@ZAJ[WEV8M3NH6, M2ZC&;P!/-3N?+(4\GOR>M8'A[Q%\2?VL/B3\6KZ#XD:OX)\,^$EFAM-)TK[D MRCS559$W -D1L6+;N6P, 5?U-."G=)6U>O>RTL+VNK5M3[&^ _Q]\.?M$>$[ MKQ#X9M]1MK&VNVLW74H4CD+A58D!788PP[UZ37Y3_!KXZZY\"/V']:O_ TZ MV^N:IXL?3X+QD#_9@;=&9P#P6PN!GUSVK?\ !_QQ\>>#_B1X#O/#OBGXD^,[ M&^GB@\0V/BS39/LN'90S0!(D,Q"I+A(HSO4Q#IEE.<#%LWN)IH8FA\TLQ;.]AA@"V?OGXE>V75?TC]-Z*^1?!OPF^*/PIT#3OB5J_QFUOQ3#9:=)JNL^'M0W26L MZ?9VD\N(EFVD-MYVC..W2OE.']HKXA?$'PIK'B__ (3SXB6_C4W9;3=)\/Z> MQT-8PP_=OM."<$]5/09W9-*G@G5;Y)II===P=7EW1^@_QQ^.>O\ PA,UQIWP MVUCQ=I%G9&_U#5+2YB@AMHP6W#Y^78!=Q51P"*[SX<^.].^)W@70_%>DK*FG M:M:I=0I.NV10W\+ 9&0*)[74 M[73KNZ99'1[9%G8&%6V!BVTY#X' (/U=\(K>[LOAQH5G>>$QX'EM;<6ZZ"+R M.[^R(A*HOFQ_*V5 .1Z\\UE6I1ITEMS7Z._WJY49.4O(["BBBN$U"BBB@ KA M?!'_ "47XC?]?MG_ .D4-=U7"^"/^2B_$;_K]L__ $BAKIH_!4]/_;HF<]X^ MOZ,[JBBBN8T"BBB@ HKQ/]J+]I:+]FG0- U.7P\_B$:M??8A$EX+?ROE+;L[ M'STZ<5J3_&7Q+'\:]-\%Q?#?5Y_#MW;K._B]&?['"QB9]A_=;<@@+]\=7L7/C32M>\1>!?$UW_Q]7GAR\$ N">K M,-I(8X&2I /4@GFLVY_8&\':EX'/A:_\8^-;S3Y]1_M2^:3486DO[C8J*96: M$DA0. ".I.2<$?35%6L56224MB?9Q?0\*C_8V\!Z5\4-"\>>')M6\(:OI$$5 MLEOHDL,=M<1HNW$R/$Q;:^4O@3^QSK/Q.\5?%B'Q?/XV\!:=<: MJ6@^RA[.#4X6EF+!ED3;*H&T@C(&[OFOTBHK2&,JPBU>[=M>UA.E%M'@?BG] MBCX>>)_@]H/PV#ZMI'A_1[O[=%)I\\8N)IMK!GE=XW#%MQ)P!VQ@#%=]\3?@ MAX4^+OP\7P9XFM)+S2HTC$,JR;)X71=JR(X'# 9[8.2",<5WU%8.O4;3-]>L-$N8[K3](U#4U:UB>,Y3*;,8&.B[: MSK__ ()V^$M1EDLY_'GCE_"\D_VA_#K:HIM"V[=@+LP!GVS[YYKZNKA/C/\ M&;P_\"/!3^*?$PNSIBW$=L191"63>^<<$CC@]ZWCB<1.5HRU9#IP2U1Y1XT_ M89\,>(=9_M#0/%_BWP*C6D-A+9:!J BMWABC$:*5*Y)V@ DDY]*?J/[!/PTO M_A+8?#Z*;6[#2K;4?[4DO;6YB^UW5QL*;I'>)E(VGHJC&![Y]\\,>(;7Q;X; MTO6['S/L6HVL=W!YJ[7V.H9@_9P['A7QB_8]\'_%^_T3 M5Y-1UGPWXET>W2UM=3SCBH?A[^QAX%^'G@WQ=HE MO=:OJ-]XKM9+35==OKA)+Z2-P7QN\G9C)_N9QWKV7PGX;MO!WA M71M LGEEL]*LH;&!YR#(R1($4L0 "V%&< #/85JU2UO6K+PYHU]JNI7"6FGV M4+W%Q/(<+'&H)9C] *B52=323OK?YL:BH['Y]^$OV5=?^*'[3GQF;79/&?@? M0[R>>2TU?3!):0WZM/S&79-LJ%3G /;-?4FB?L>?#71O@M:#?^'?[7=]\0_ASXK\>VGPWU=O"^DS&' M3S9S_:+W52) I,=N(QM !!)W'!R.<$BI\$/VY=%^.WC(:!H_@?Q/:*@D-QJ- MQ C6UJ51F"RLK':6VD 'J:]*K+%3OI91ML]FD815-?,I^&/V O#OA[5=)DG^ M(/CG5M&TFYCNK+1+O4U-JC1L&0% F" 0.%"UZ;\.OV;?#/PR^*OB_P ?Z7?: MM<:SXG+&\@O)HFMX]TF\^6JQJPY'=FXJG^SK^TWH?[1\/B231M)U#2QH=PEO M,+\I^\+;L%=K'CY#UJM\$OVJ_#?QMU3QK:6>GWNBQ^%'VWMSJ31B-EW2 L"K M' 'EDG..*PJ/%/F4[Z;_ #+BJ>ECVRBOD#5/^"D7ABXUS4+7PCX%\4^--,T] ML7.J:=; 1!1_&!R=O'!;;FNJ\9_MI6^@?"7PQ\3](\%ZAK?@?5)S!>W+W2V] MUIK"0IEX0KAAE6 (<#.!QD&LW@ZZLG' MFW\"7-O.G1XV *G\C6A7(U;1F@4444@"NB\._P#'D_\ UT/\A7.UT/A[_CR? M_KH?Y"L*_P !TT/C-6BDHKSCTA:*2B@!:*2B@!:*2B@!:*2B@!:*2B@!:*2B M@!:*2B@!:*2B@!:*2B@!:*2B@!:*2B@!:*2B@!:*** "BBB@ HHHH **** " MBBB@ HHHH **** "BBB@ HHHH **** "H+[_ (\KC_KFW\JGJ"^_X\KC_KFW M\JJ.Z)ELSD****]8\8*P_''@K2/B+X2U7PUKUJ+S2=2@:"XBS@E3W![$'!![ M$"MRBFFT[H-SXIT?]@;Q]X&CN]$\%_'C6?#_ (/NI&=K!+5O,C#=<%95&XCJ MRA,^E;/B']@O4;+Q7X,\3>!/B3=^&=>T'38],EO[JP2Z>955E\T L &*L05( M(/'/K]>T5V_7:[=[_@M?734R]E ^5? /[#4_@QOBG)=?$*XUVY\=Z=+8RW5U MI866W:0L3*Q$N)#EN@"?A5B;]B/SOV6(?@U_PFF/+O\ [=_;7]E=?WIDV^3Y MWOC._P#"OJ*BH>+K-WRW6P_9QVL?+_Q)_8C3Q5#X"U?PWXSNO"?COPCI M=KI<&NV]J&2Z2",(K-%O!4_>_B(PQ!#47'[&^M?$/P)XDT3XK?$J_P#&NH:H M]O+9WD5HMLNER0[]K11ABIW>80PPN1[X(^H**/K=:R5]O)7[[A[./8^5/"G[ M*_Q?TJYT73M5^/VHWWA32IX72PM],$4UQ%&P(B>42;MI"@')88[5V_P)_9A_ MX4I\3?B%XN_X27^V?^$MN3E>Z44I8FK-.+>C MWT2_0%3BM0KP36OV5_[7_:HTOXS?\)/Y7V*W6#^Q/[/W;\0O'GS_ #1C[^<; M#TQ7O=%8PJ2IWY7NK?(MQ4MSXZ_X*A/HS_ ?3+>\B:76Y=7B_LP1C+!@K>:? M]W:>'R]0;0'O+X +- \8?#[Q7<_#GQ;HMG'80W5M )XI88T MV(K+N7D+\I/((X(-?2U%5/&U93YD[+733K\M?F"I12L>,?!#X.>/O OB/4M= M\>?%&\\>W=U:BUBLS9BUMK8!PQ=45MI8XQG:./6O9Z**Y)S=27-+_+\C1))6 M04445F,**** "BBB@ HHHH **** "BBB@"#4+"WU6PN;*[B6>UN8FAEB;HZ, M"&!^H)KXKE_X)Y^*?#"ZYHO@+XR:EX:\%ZT[&ZT>2T,A",,%2RR*'^7Y+M3\,ZCIFI?VPGB M*W3,\EWL9"Y"LI48; "L, #D\YY ?L'>+/'NMZ/)\6/C#J?CC0M*F\Z'2EMC M$)#_ +3M(<9 P3M+$9^85]DT5HL96C>TOP5_O$Z<7T*5]I[RZ+<6-C/_ &=( MUNT,$\:;O(.W"L%XSMX./:OD;P-^P=XQ\%_%I?B"/C==7>MSS*^HR_V J/?1 M;E+Q,WV@@!@@&0*^QJ*RIUZE)-0>^^B?YE2@I6N>"_#']EC_ (5Q\9/B-X\_ MX2?^T?\ A,$E7^S_ .S_ "OLF^3?_K/-;?CI]U:X;PG_ ,$^-"TKX)^)?AYK MOB>;6H]5U-=5MM3M[$6LEE,J!%(4R.'&,YR1D,1QUKZSHJ_K5;?F[?AL3[./ M8^8?AM^R]\4/"FKZ'#K_ ,;K[7_"FB@K;:.FG"'SE\MD197$A+*H((#%N@Z5 ME>%O^"?VF:-\"O%OPWU3Q9)JJZUJ*ZI;ZG%IP@:SF10%.PROO'!SR,AB..M? M6=%4\76Z.VVR2V^0>SB?$,W_ 3M\4^(=*\+6GB3XTW^JQ^'9U:QM)M,,MO# M"I7"(#."#A0-Q)XP,<5W_P 2/V.=7NOBQJ'Q(^&'Q"NOA[XCU-=NH1?8UN;> MY)QEMI8 9P"00PSR,5]/T4WC*[=V_P %;7RL+V4.Q\M:_P#L=^+/'OPB\1^$ M_&7Q;O?$&KZW?6MX=5N=-W16BPY_=10"8 !L\D%?I6A\5OV-/^%G>#OA7H/_ M E_]F_\(,L:_:/[,\W[;L6)?N^ MQ\O_ !*_8VU6\^+=]\2OAC\0+GX>^)=14K?Q_8UN8+@G&YL%@!G:"00P)&1B MJWBO]A^\\?\ @+2+?Q'\2=4O_B%I6H2ZE:>+Q;[7B9]A\H1;_N*8U*[67!Y& M.E?5-%"Q=96L]O)7^\/9Q['SU\+_ ("?%70O'.E:[XY^--[XMT_3 _E:-!IZ MVL,Y9"@:4J_S$9R,J>>]?0M%%8U*DJCO+\$E^1:BHZ(****R&%%%% !1110 M4444 %1W%O%=V\L$T:RPRJ4>-QD,I&""/0BI** /C2[_ ."?^M^"?%NI:O\ M"+XJZEX!L=18F?2S TT:C).T$2*&49. RDC^]6EX<_X)_0>'_@5XS^'X\![6.VT_Q);VG$@0AANAW\?,,C#G&3US5KX2_L>7_A MGXDW_P 1?'_CFX\>>-)K5[2VNFLUMX;560H6"ACN.TD#&T#)X).:^F**CZU6 MY7&_Y=1^SC>]CX=T[_@G?XS\->"]6\):'\:YK3P[K=QYNJ6*Z"L:S+@#[WG% MN@P1N /?WZWX@_L"6.H>'?AW;^!O%<_A36O!:D6NH3VPN//8R>89&7*X?S,M MW'.,=*^M:*MXVNVGS?@O37347LH;6/EGP1^Q3JWA[XN:I\0==^)MSXIU?4M) MGTVY-UI*1,7DA$9D#)+@*N.$"].,]Z]!_98_9U_X9H\ WOAG_A(/^$C^TW[W MWVK[%]EV[D1=NWS'S]S.<]^E>RT5E/$U:D>63TTZ+IL4H1B[H^=OVJ/V5-<_ M:7DL;5/B--X8\/6Z*9-'&E"ZCEG4MB;=YR$'#8Q[5S'BW]B#7/'7P*T;X=:Y M\4IM1DTG4UO;;59M%'R0+#Y26XB$XP!DG=N]L5]8454<56A&,8O1;:+_ "$Z M<6VWU/!/B7^RO_PL3XG_ L\8?\ "3_V?_P@Y@/V+^S_ #?MOER(_P!_S5\O M.S'1L9KC/$?[%?B'0/B9KOC/X2_$RY^'T^NL7U#3WL%NH69B68KE@ -Q) *D M@DX(Z5]744HXJK%))Z;;+U!TXL^7-3_8LU/Q!X@^%NN:S\2+K5M4\&3M:<9)-2=KGSSEC-^[ ^Z/O8&/I6)K'[!FJVOQ0\3^(/!?Q1U/P5H7B8R/J>F M6-MF1MY)9%?>!MW,Q!*Y4$CFOKZBJ6,K+K^"[W[![*'8^4O"G[ .A:7^S_J_ MPOUWQ+-K27>IG5K;5K>R%K):3;%12$,CAN%.SCV/E_X=?LK?$?0-3T:R\5_&>\\4^"=)1HDT#^SA"+N M(QM&(YG$A)4!NC%N@Z5SVB_L3?$#X7SZCI_PN^-=]X4\*7\[3'3+G3$N7@)X M.QRW)P -P"'@9SUK[!HJOK=6[U6ODK?=8/9Q.9^&?A"[\!>!=(T"_P!/K^C.ZHH MHKF- KP#]NGXBZW\,?V'KB2RU*XEAL5O(3AX%D?#,I['&0#VSFO?ZY MGXE?#K1/BSX(U7PIXBMVN=)U&/RY5C;:ZD$%74]F4@$'U'>MJ,HPJ1E-729, MDW%I'Y9_';X#Z)\.OV>OA-XPLM6U34]9\37,5SJ#W5V9(&=XO,RJ8X(SMR23 MUS7T!XQU754_X*+^&;*RU"2!6\. QQ/*1 )/L:H82H!/)(&21U'2O6O$/[*OA'Q-\88/ MB/>7VLC6HM.;2Q:QSQ"U:(PO$25\O?NVR'D..<<5[,\92:LY-Z2Z=[6.54I+ MI;8_.2\TBX\">)=1NOV@O#?Q&@UFZOCY'C#3-0Q''Z>7O0I( 03\LG3@ 8KO M_B/XVU3XY?M+ZOX=N]!\2?$?PEHNGQC3/#^C:F;$NGEQ$73_ -XMOW'O\R]A MBOI"+_@G/X-FFL[35?&_C?7/#%I*)8?#U_JBM:@CH,!!@8X^7:<=Z[#XL?L4 M^"/B9XDLO$MA?:QX(\26D"6T>I>&KD6[-&B[$# J>0H"@J0< DXK1XV@Y)W MUL^]EMLKW7R$J4['RYX.O]<^%'[/?Q(\/?&JT\8:#X+DO+7^PK:.Z0ZEAI'; M[/'(V0%Q&NXD 8WX&3BO-M!?5OA)\=?A3J_A?PSXI^'>E>(+V!1%K6M+=_VG M \J*Q,:HA52K\A\YR",8K[7A_8+\$7'@3Q%X=UK7_$_B.XUR6"XN-8U2^66Z MBEAW"-HR4P,!V!#;L@FJ6B_\$]_!.GZKX6U6^\6^,]9U/P[/'/:2WNI1R)A& M5DBV-$0L8VCY4*]3STPHXR@N9M[^3MMVO^8W3GIY'RK^T-X?\2Z/\%O&7BKP0UP_P#9.J>'[\Q6MC!O^0JVQXP0N!L8H=V27MXR."1U!KZJ\6?L!^&O%.M MZQ<#QYXWTW1]9NI+R_T.TU)!:2N[EV 0IC!)[AOK72^//V(_AIXX\&>&O#\= MK?>'V\-Q^5I>IZ3<>7=P@MN.78,'RV6.1G))!&:2QE!*'-K;RT6F]N_H'LIZ MV/%/V.O"?Q%^'GQWUBS/@[Q'X/\ AAJEF[P:7KEZ+I;6= I!5L]2=XZ=",YP M#6]_P5%\)VNI_ S3]>DGNDN]+U*.*&*.3$+B7ABZXY(V#'(QDUZM\&_V3M+^ M$GC,^*Y_&?BOQCKBVKV<4OB"_$Z11,5)"KMR#\H[X]J[[XR?"'0?CEX!O_"/ MB,7 TZZ*.);1PDT,BG*NA((R#Z@CDUQRQ,5BHUD]%:_],T4'[-Q/A+XH_LNQ M> _V1])^(/@[7/$+ZY!;Z?K%TMS?ETCB,?[P1*JKM4&16P2>$K6\!_$2\_; M_:J\"WMK=7">'?"OA^#4=1ABD98VN]H9U8 X/[YD7GLAKWW1/V>;3]GGX,^/ M[6SU/Q5\1XKS2'M8-$OW-T0H1U2&")%RH8R<[>PS@8KDO^"<_P "=3^%7PMU MK6O$6D76C^(==NB#:7T#0SQ6\0*H&1@&&6+MSVQ74\1%TIS;NT[)^N_W$,/$-F?#4\MW9VL-]BT:58Y7#2HP.[[NT8(Q MDU3U?]H/Q[J_[,OPN\+2:CJLEOJ6L7=A=7%KF^/;;QO<^./ 5K)JB[;*'?9P:E"=Y):.5,28.,-SC-?7 MWBG]CWX:^*_A%I'P[N-+GM=&T@E["ZM9MMW!*?OR"0@@LQ)+9!!].!CHK8JC M3J6G[VJ>VVGXF<:U>H? M'/X8P_&3X3>)?!\SK"VIVI2&5AQ',I#1L?8.JY]LUYM2O"6(IU+W2M??OYW- MXP:@T9_[.N@67AG]G[P+8:>BK;+HEO)\O\3/&'=OJ68G\:^4/^"8_P![XR?] M?T7_ +7KTC]F_0O$WQ#_ &?]1^#_ ,1=(\5^#-2T518+K%M"]K]IMDD!C:WN M60HQ&W:<9RN".O'2?!O]A;P7\#O&,?B/0/$WBZ>X59%DM+Z_A:VGW(RYD1(% M+$;B0<\&FY0IQK4YRUD]/D[_ (@DY.+2T1\;_L8>!OC!XO\ ^$]D^&'CZQ\& M6T&H1K?1WEHDQG8^9L(W1/C #>G6J'P%M]:A^#/[4T,<[76L1VD2W$\(QYF) MI?.8 8!7>>G2OT+^ 7[-'AC]G.+Q!'X;O\ 5[Y=;G2XN/[5FBD*,N[ 39&F M!\YZY[5!\&_V6O"'P2U/Q?>:/=:IJ?\ PE+[[^#5Y(98L;G)5%2)/E/F,"&+ M<8KIGCX-S:6CY;:;VM>Y"HM)?,\Y_P"";4VAO^S+IR:6T']H)>W/]IJF/,$Q M<[2_?_5[,9[5ZK\5]'\+^,/@!X[L-/\ [/FT6;3;\NUAL,(F4.SM\O&X2J23 MUW YYKQK7/\ @FK\.[O7KR^T/Q#XH\*6=ZQ^T:;I5Z@A*D\HNY"P7V8L!4WQ M_P#"VI?!K]G.T^$/PF\*^(==N=81M/2YAMI;A+2&1R9I)YPNQ2VX@ X #$\ M5RS]G6K*=.;NW?72WS\BUS1A:2V1M_\ !.O6;O6/V6/#@NV9_LES=6L1;_GF MLI*CZ#)'X5]+5Y[^S_\ "N/X*_"#PUX/5UFGT^V_TF5.DD[$O(P]MS''L!7H M5<6(DIUIRCLVS6":BDPHHHKG+"NB\._\>3_]=#_(5SM=%X=_X\G_ .NA_D*P MK_ =-#XS4HHHKSCT@HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** " MBBB@ HHHH **** "BBB@!,T9HHH ,T9HHH ,T9HHH ,T9HHH ,T9HHH ,T9H MHH ,T9HHH ,T9HHH ,T9HHH ,T9HHH ,TR>/SH)(\XWJ5SCID4^BC8-S%_X1 MO_IX_P#(?_UZ/^$;_P"GC_R'_P#7K:HK;VT^YA[&GV,7_A&_^GC_ ,A__7H_ MX1O_ *>/_(?_ ->MJBCVT^X>QI]C%_X1O_IX_P#(?_UZ/^$;_P"GC_R'_P#7 MK:HH]M/N'L:?8Q?^$;_Z>/\ R'_]>C_A&_\ IX_\A_\ UZVJ*/;3[A[&GV,7 M_A&_^GC_ ,A__7H_X1O_ *>/_(?_ ->MJBCVT^X>QI]C%_X1O_IX_P#(?_UZ M/^$;_P"GC_R'_P#7K:HH]M/N'L:?8Q?^$;_Z>/\ R'_]>C_A&_\ IX_\A_\ MUZVJ*/;3[A[&GV,7_A&_^GC_ ,A__7H_X1O_ *>/_(?_ ->MJBCVT^X>QI]C M%_X1O_IX_P#(?_UZ/^$;_P"GC_R'_P#7K:HH]M/N'L:?8Q?^$;_Z>/\ R'_] M>C_A&_\ IX_\A_\ UZVJ*/;3[A[&GV,7_A&_^GC_ ,A__7H_X1O_ *>/_(?_ M ->MJBCVT^X>QI]C%_X1O_IX_P#(?_UZ/^$;_P"GC_R'_P#7K:HH]M/N'L:? M8Q?^$;_Z>/\ R'_]>C_A&_\ IX_\A_\ UZVJ*/;3[A[&GV,7_A&_^GC_ ,A_ M_7H_X1O_ *>/_(?_ ->MJBCVT^X>QI]C%_X1O_IX_P#(?_UZ/^$;_P"GC_R' M_P#7K:HH]M/N'L:?8Q?^$;_Z>/\ R'_]>C_A&_\ IX_\A_\ UZVJ*/;3[A[& MGV,7_A&_^GC_ ,A__7H_X1O_ *>/_(?_ ->MJBCVT^X>QI]C%_X1O_IX_P#( M?_UZ/^$;_P"GC_R'_P#7K:HH]M/N'L:?8Q?^$;_Z>/\ R'_]>C_A&_\ IX_\ MA_\ UZVJ*/;3[A[&GV,7_A&_^GC_ ,A__7H_X1O_ *>/_(?_ ->MJBCVT^X> MQI]C%_X1O_IX_P#(?_UZ/^$;_P"GC_R'_P#7K:HH]M/N'L:?8Q?^$;_Z>/\ MR'_]>C_A&_\ IX_\A_\ UZVJ*/;3[A[&GV,7_A&_^GC_ ,A__7H_X1O_ *>/ M_(?_ ->MJBCVT^X>QI]C%_X1O_IX_P#(?_UZ/^$;_P"GC_R'_P#7K:HH]M/N M'L:?8Q?^$;_Z>/\ R'_]>C_A&_\ IX_\A_\ UZVJ*/;3[A[&GV,7_A&_^GC_ M ,A__7H_X1O_ *>/_(?_ ->MJBCVT^X>QI]C%_X1O_IX_P#(?_UZ/^$;_P"G MC_R'_P#7K:HH]M/N'L:?8Q?^$;_Z>/\ R'_]>C_A&_\ IX_\A_\ UZVJ*/;3 M[A[&GV,7_A&_^GC_ ,A__7H_X1O_ *>/_(?_ ->MJBCVT^X>QI]C%_X1O_IX M_P#(?_UZ/^$;_P"GC_R'_P#7K:HH]M/N'L:?8Q?^$;_Z>/\ R'_]>C_A&_\ MIX_\A_\ UZVJ*/;3[A[&GV,7_A&_^GC_ ,A__7H_X1O_ *>/_(?_ ->MJBCV MT^X>QI]C%_X1O_IX_P#(?_UZ/^$;_P"GC_R'_P#7K:HH]M/N'L:?8Q?^$;_Z M>/\ R'_]>C_A&_\ IX_\A_\ UZVJ*/;3[A[&GV,7_A&_^GC_ ,A__7H_X1O_ M *>/_(?_ ->MJBCVT^X>QI]C%_X1O_IX_P#(?_UZ/^$;_P"GC_R'_P#7K:HH M]M/N'L:?8Q?^$;_Z>/\ R'_]>C_A&_\ IX_\A_\ UZVJ*/;3[A[&GV,7_A&_ M^GC_ ,A__7H_X1O_ *>/_(?_ ->MJBCVT^X>QI]C%_X1O_IX_P#(?_UZ/^$; M_P"GC_R'_P#7K:HH]M/N'L:?8Q?^$;_Z>/\ R'_]>C_A&_\ IX_\A_\ UZVJ M*/;3[A[&GV,7_A&_^GC_ ,A__7H_X1O_ *>/_(?_ ->MJBCVT^X>QI]C%_X1 MO_IX_P#(?_UZ/^$;_P"GC_R'_P#7K:HH]M/N'L:?8Q?^$;_Z>/\ R'_]>C_A M&_\ IX_\A_\ UZVJ*/;3[A[&GV,7_A&_^GC_ ,A__7KS_P ":%YGQ*^)B>?C MR[ZR&=G7-C"?6O6J\[^'_P#R5#XH_P#7_8_^D$-==&K/V=77[/\ [=$QJ48< MT-.OZ,ZK_A&_^GC_ ,A__7H_X1O_ *>/_(?_ ->MJBN3VT^YM[&GV,7_ (1O M_IX_\A__ %Z/^$;_ .GC_P A_P#UZVJ*/;3[A[&GV,7_ (1O_IX_\A__ %Z/ M^$;_ .GC_P A_P#UZVJ*/;3[A[&GV,7_ (1O_IX_\A__ %Z/^$;_ .GC_P A M_P#UZVJ*/;3[A[&GV,7_ (1O_IX_\A__ %Z/^$;_ .GC_P A_P#UZVJ*/;3[ MA[&GV,7_ (1O_IX_\A__ %Z/^$;_ .GC_P A_P#UZVJ*/;3[A[&GV,7_ (1O M_IX_\A__ %Z/^$;_ .GC_P A_P#UZVJ*/;3[A[&GV,7_ (1O_IX_\A__ %Z/ M^$;_ .GC_P A_P#UZVJ*/;3[A[&GV,7_ (1O_IX_\A__ %Z/^$;_ .GC_P A M_P#UZVJ*/;3[A[&GV,7_ (1O_IX_\A__ %Z/^$;_ .GC_P A_P#UZVJ*/;3[ MA[&GV,7_ (1O_IX_\A__ %Z/^$;_ .GC_P A_P#UZVJ*/;3[A[&GV,7_ (1O M_IX_\A__ %Z/^$;_ .GC_P A_P#UZVJ*/;3[A[&GV,7_ (1O_IX_\A__ %Z/ M^$;_ .GC_P A_P#UZVJ*/;3[A[&GV,7_ (1O_IX_\A__ %Z/^$;_ .GC_P A M_P#UZVJ*/;3[A[&GV,7_ (1O_IX_\A__ %Z/^$;_ .GC_P A_P#UZVJ*/;3[ MA[&GV,7_ (1O_IX_\A__ %ZT-.LOL$#1[_,RV[.W'8?X5:HJ95)25FRHTX1= MT@S1FBBLS4,T9HHH ,T9HHH ,T9HHH ,T9HHH ,T9HHH ,T9HHH ,T9HHH , MT9HHH ,T9HHH ,T9HHH ,T9HHH ,T444 +1110 4444 %%%% !1110 4444 M%%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4 M444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !11 M10 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% M !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 M%%%% !1110 4444 %%%% !7G?P__ .2H?%+_ *_['_T@AKT2O._A_P#\E0^* M7_7_ &/_ *00UUT/X=7_ _^W1,*GQ0]?T9Z)1117(;A1110 4444 %%%% ! M1110 4444 %%%% !1110 45%H(H ?1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% M!1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 ) MFC-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% M"9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+1 M0 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9HS2 MT4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 F:, MTM% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 )F MC-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% " M9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FO._A_ M_P E0^*/_7_8_P#I!#7HM>=_#_\ Y*A\4O\ K_L?_2"&NNA_#J_X?_;HF%3X MH>OZ,]#S1FEHKD-Q,T9I:* $S1FEHH 3-&:6B@!,T9I:* $S7C7[1?P*L/B[ M8V.HZE\0/%?@2ST2&>6:7PYJ0LTD0@,S394YVA./3)KV:O$OVN_AAX_^,WPD MN?!G@+4M(T>7595BU.\U6XFBQ:CEDC\N)\EC@'.!C([UTX=M58VER^?8RJJ\ M'I?R/E#]AOX>>(_C+)\5]5;Q]XW_ .%>7DWVK227Q.]6-PC'Y5=551 MD+_RT([&N:\9_"35]%_:T\%?"CX??%?X@Z]>QLFH>(KC5M=>6&S@4A]NU O. MP<@D@^8@[U^@?PQ^&$'P6^#^E^#O"L-L\VE6!B@-TQCCGN=I)DD95) :0DD@ M$@'@&O)_V1?V7M>^#&K^-?&7C_4].U_XA>*;UI;F^TYY)(8H,[@BM(B-RQ)( MVXPJ#M7L?7ESU:J>FT5WZ7?HM7YG#]7?+"%M>K_0^0?C]X_URU^+'Q9GO_&/ MB?2OBCI?B*PM_!&A65W.D,UFSX.R%1L=67!.>I/?)KW;Q'^TE83_ !V_X2CQ M/KFHZ=X%\#!-#@T_21+(VN>()D!EC6*/_6B$9&#P&QZU]9?$O1=;U3P?J_\ MPB4>EQ>,&M)(=,O=4W+%;R,,!RZH[ #). #D@"OFSQ9^QCKNA_"OX46G@6_T MN?QCX%U8:Y,VL-(MMJMT^&N&=U!8$N!@D=!CBB&)H5HQ516Z?@K]-%IY[MCE M2J0;<7?K^/X_\!&U\4OCC\%/C?\ !#^U]5U/1_L":BUG:+XPT^Y^S6>II&Q" M74"%6X4L<,0#G@YJ3_@G0(XOV>##!;S):1ZW?""YRWV6Z3S,B6U5E#) \*H10J@*H& !T%<%>K3A"6'I7:O>]_\ @'13A*4E4GH[!FC-+17FG4)F MC-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% " M9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 M F:,TM% "9HS2T4 )FBEHH **** "BBB@ HHHH **** "BBB@ HHHH **** M"BBB@ HHHH **** "BBB@ HHHH *P?'?CK0_AGX/U;Q1XEU"/2M#TN!KBZNY MBZE92^(K+X,_$N\^'D4C(_BV#20]LJ@X+G#;0H[Y M?(],\5]C1^,-&;3]/O)M1MK.*_A2:W6[F6)G5P"N 3UYK\H?B!^V]KW@[]F[ MX=ZM\&OBGX7T6QTO1;'1=2\!W-A!+J:W:JRS3!)4),7 Y&0:]>61N&%JCK'86\$B)Y@\P;5P=Q'/ M'% 'Z_75Y;V-L]S!7EWQW_ &F/!7[//P_M?&7B2>YO M=%NKR.QB?1T2X9I'#$$?.!M^4Y.?2ORFATG5_BW^QM\"[6Y\>^&_-TG4-3F' MA+QMK3:=::O!%<*$43%T4^6,J%,B$*_RD8KF/B-_P@/C_P#8OU?7-$^&T/@C M5?#GCB"SN&TW5[B^TYS/ 1*\#/(PPWDQ@CTDGY%'WA]\5^N2SN23ESW/>@#]*I]8L+:^BLIKVVBO)AF.W>51(X]E)R?PJY7Y!_LG> M$O@!\4O!WCWQ3^T1XD@B^+"^()OM$VLZU)::A:A2OEFWBW@N=^X8"/\ ="XQ MQ7Z[VP06T7EDM'L&TGJ1CB@"6BBB@ HHHH **** "BBB@ HHHH **** "BBB M@ HHHH **** "BBB@ HHHH **** "L'QWXPM?A_X-UGQ)>VUU>6FEVKW15&=J*2 6/0#(K>K(\7>+-)\">&=3\0Z[>IIVCZ; UQ=74F2L:+U.!R? MH.3515Y)6N)['S?X&_;ZT77_ (FZ'X*\4?#[Q?\ #R^U]@NDS^(K+R4N23A< M@X(W'@$!ADC)%;'Q8_;;T'P#\1;GP%X9\(>)?B7XNLD$E]8>&;3SA:# .'89 M.[D9 4@9P2#Q7S+H'QP\%_M7_M4>'O'7BKQ3I/A'P9X.N!#X;T6^N56_U.Y+ M@K*Z#.Q2P0X/]U0,_,:\JDM?^$7\>?M-W>L?%37/AEXTTV_EU#3;73M1%D=7 M/F2M&C<"24'. HN?O1::2NM;7;MOOHM['DO$SY='=7WTVM_ M5C]9?!WB"3Q7X4TC69M,N]%EO[6.Y?3M039<6Q903'(IZ,N<$>HKYEUS_@H3 MI-AX]\4>%-(^%WCSQ7>^'KU[*\FT+3TNHU96*Y^5R0"5.,@9Q6C^SA^U! GP M9^$,'Q,U.Y'CGQBDD&GQBSEEEO@DI1)6V*0N5*$LV P0L_S,A4X/8UQX;!Q=6=.K M'R6]KWMNEMYF]6NU",H/UVOL?8WQ2_;3T'X7Z!X)>?PEXDU/Q;XN@6?3_"%K M:?\ $Q0'&1*A/RD'Y< $D@\<$U+X _;?^'_C7X3^+/'-Y'J/AQ/"C^5K.D:E M"!=VTA.$0*#\Q9OE'3D$$#%?)FL?$34;+]IW]F;XH?%!XM$MM3\,+]KO[I?) M@CG*S@NV>$SYL3'H!O["O*?$FFW?Q&\$?M9^+O#"R7OAB?7;.>.XMU/ES1K> M.[.OJ K!C[$&NN.74912DK;:WTUE:WW&#Q,TVUYZ?*]S[J^#_P"W[X8^*'C[ M1/"NH^$/$G@JX\0Q&?0KO6[=4@U%.<%&!_BP<$94GC.<9^I*_+SQ%X[\/?&' MXK?L?Z3X(U"#5M3T:VM6U&*S.YK()Y)=),?=($,A(/;GN*_4.O+QU"%%P<(\ MMT]/1M?B=F'J2FFI.]NOR"BBBO+.L**** "BBB@ HHHH **** "BBB@ HHHH M **** "BBB@ KQO]HK]J[P'^S-I44WBJ[GEU6ZB,MEI%G"SSW2A@K%2<(H&< MDLPZ5[)7R9_P4FU_PC9?LY>)=-U2_P!'A\57=O$VF6MU)$+R51<1[S"K?.0! MG.VNO"4XU:\*5_M"?M;Z#\!?$6A^%X_#^M>-/&.LH9;30M!@\V8Q@D;V[ M\[6P "3M/0#-<[\ _P!H3X=^!_V1?"FOZGXKT]].\/:/86FJFQD^U26IHUO$FZ*8 M#=O *'++D-@C>,XKMHX1.M-3B^5KM\K]3WOP[^WA\-M:^ M"&M?$JZ_M'2;31;D6-_H]S"OVZ.Z/W(50-ABW.#D#@YQ@X9\'_VW= ^)GC^R M\&:UX2\0^ -=U.S_ +1TJ/7X%2._M]I8,C \$J"1D8.#SGBOBOX9?"31_P!H M#X;?M&:K=>);7PAX5N?%<-_IFOZA\ED)4EG(WDXPI6= 3VWJ?:K'AK_A,_C; M^UC\/=*_X2_0/']WX1T29)]9\)V[K9P1+%($5IC@2,2R E0%R^!GFO1E@,,O M:)=+]]-$UY/71W.58BK[K[_CK8^FM4_X*9^!M/U^\\GPEXIO_!5EJ TRY\8V M]H#8I,3VYY'<9(8CD*:^NK+4;74=.@O[:=)K*>)9XYU/RM&PW!@?0@YK\<=% M^(?AK0O^"?7C?X=:A?06_CIO%2A=&D.+IR'B)<)UP/+<$]B,=Q7Z(^ OB3HG MA_P1X+^#5]?7"_$BZ\&PR)IJVLKE +4J6>0+L3!4CYB.WJ*Y<;@H4DO91:LV MN]TDO>_K0VP]>4W[[Z+[WT."U3_@IGX&T_7[SR?"7BF_\%66H#3+GQC;V@-B MDQ/;GD=QDAB.0IKO/C?^VEX:^$?B+0O#>DZ!K7Q \3ZQ9C4;?2_#D(E<6Q!8 M2$]>5!( !X!)P,9_._1?B'X:T+_@GUXW^'6H7T%OXZ;Q4H71I#BZQ>']/G^'MG;QWVI-Y<4]M>U[GU+;?M\?#2?X"3_%-S MJ,-E!=_V;)HS0K]N%YC(@"[MO(^;=NQC/<8JW\!?VSM!^-?CFZ\%7WA?7O G MBV*U%]#IGB" 1MWU@V^)?W4 MHVEAQD&6-2.QXZBIK9?0IQGRI[2=[[6M9?B.&)J2<;OM\[WU/T'HHHKY8]<* M*** "BBB@ HHHH **** "O._A_\ \E0^*7_7_8_^D$->B5YW\/\ _DJ'Q2_Z M_P"Q_P#2"&NNA_#J_P"'_P!NB85/BAZ_HST2BBBN0W"BBB@ KQ7X3?M)Q_&C MXI>,?#OAOPY+-X7\,3&SN?%4EV!%/=#K%%%LRV"#EMPX&>XSZEXQDN8O".N/ M99^V+8SM#MZ[Q&VW]<5\9?L5^(-%\%_\$^_$'B&\L9-42 :MPYKOHT8SHSFU=W27SOK^!SSFU.,>FK^X^V+36].O[F2VM;^UN; MB+[\4,RNZ?4 Y%#/!+7^OQ11Z9X9UR\O-7AB\Y$/VY99&50PR!@ M L"<\<5VWB@^ O&?BW]J#5OB]J$/_"P-.DGM_#-KJ5[)"R;3*L:P(& MS&@6FJ0O,;>YN X@"R,G,F%!^[GH.M=Y%J%K-:)=1W,,ELXRLRR HP]FZ5^. MFIZMJ]UX*_9G\/ZF=%_X0B;2KJ=+?Q7=36NC3WGVJ<$W,D7(VCR\9X&[G )K M7\8>%KWP/^S+\;=)3Q;X-UG19M3TN_M]$\&:M-J%KI3R7#957=<*& QN8_( M,]LD\JBY:3M=Z*U].:V]]T$<8[:QO9?I<_7.+4;2>Z>UCNH9+E%#M"L@+JIZ M$CJ ?6FR:K917R63WENEZXW);M*HD8>H7.37YD:?\-=,^"/[5'[.]UX'CN[/ M4/$WAL76H>=>2SF[G:W?.XNQP"=ORC"C:, 5Y!;V?@#7/V:?B1XV\8ZZ5^/T M'B+-L]SJ3QZBCB2/ 2'<"5YERVT[=O48%91RN,K-3=G;IKJVMK[:;E/%M7O' M77KV2?;S/V9OM1M=,@,]Y)+R#1[*-IY6DBC M>*13)AT8!BS'H 3UJ%EJO&+DVVKNRTMZMHKZUHW9=M]?NL?J)]L@\A9_/C\E M@"LF\;3GI@T]IHU5F:10J#K=6.G>/;:*T M6&5I((D,9)$18D[">1GUSU)KV[]J[X2:+\%O /POTZQO-9L/ WC/6;:?QIJ4 M]_-.]P0D>WS'8G V-,0.F5!Q\HJGE:C-4W/5MK;LD^_9[=Q+%MQYE'HGOW^1 M]W?%_P"+-_X!\"#Q!X4\+3_$:Y^U);?V=I%TJL%(.7WX887 R,=Z[BRUF*73 M8+F[*:?*UNL\T$T@!@RH)#'CIG&?:OS-_; \#? CP5\ ?$:?!S4M-GN9[_2F MU*TTC56OK=4#3>6Y)=PKGY@1NS@ X[G6UCX3>&_C1^WA=^'/%=K/>Z.W@.UG M:W@NI;?>ZV\6W<8V4D G."<9 R#26!IRI\UVDN9ZK73EZ7MU!XB2E:U]NNFM M_+R/TFBO+>>U6YBGCDMF7>)D<%"OKGICWJ.RU2SU.W,]G=P7< )!E@D5U!'7 MD'%?C/IGB'6[?]CC1=!GU.^M_ I^(DFGZO)%(P$=IY<3",D=$),C8Z;@*]CT MJR\(^!/VI_%GA_X(7\5U\/[SP%?3:U!I=^UY9+(+67:Q;W]K]--+;N^C=]$$<9>WN]NO<_37^U++SH8?M<'FSY\J/S5W28Z[1GG' MM3[>_MKN6:."XBFD@;9*D;AC&?1@.A^M?BF_POT31OV2_A1\1M/-]9>,+OQ9 M)ISZC!?3*R0AY"JQJ&VQD%<[E .23FO?]&TCPY^S+^V!\7M+T>POY?!\'@2; M4+S2%O999+HF&)W!D=F;)9F.XDD;CCTHGE<8W49MM7Z=FD^OGH*.+;M>-EIU M[KT/TGM-;TZ_N9+:UO[6YN(OOQ0S*[I]0#D5Y%X1_:3CU3X_:Y\)?$?AR7PQ MK]K;_;=+N&NQ/!JUMDY>,[%*D#G:<]&&?EK\NM-O]+LO&GP7\9>#M,\&>"6O M]?BBCTSPSKEY>:O#%YR(?MRRR,JAAD# !8$YXXK[F_:L6.V_;-_9JN=.P-:D MO+J*;9]XVOR[L^V&D_6B>7PHSY)._,I6Z6 M>B%%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 M 4444 %%%% !1110 4444 %%%% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 )F MC-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% " M9H8!@01D'@@CK2T4 >6-^RO\&G\0MKC?"OP>VK,_F&Z;0[=V M,UK^(_@/\-O&/B6W\0Z[X"\.:SK=O$((K^_TJ&:58P,!=S*> ,@>G:N\HH \ MUU?]FGX2:]X=LM OOAEX2GT6Q=Y+2P_L6W6&V9SES&H0!"QY.W&>^:V4^#G@ M.+P*_@I/!F@IX0<8;0ETV$6;=:%^SI\*_#-KI= MOIGPY\+6D6E737U@%T> FTN&VYFB)0E'.Q/F!!^5>>!72WGP_P#"VH^+;+Q5 M=^&](NO$]E$8+76YK")[VWC.JGQ%7J*:=M4!YQ:_LV_".QN8;FV^%G@NWN(7$DUJ7 MOS._J1R1M:QY+=_ .UU/]H72/B7>WT4MMH6BG2M'T9+;:EI(S$R3;MV"2IV@ M!1@=ZT[O]G#X4WWB,Z]=QYS7H]%5[>II M[VRM\A>SCV.<\:_#KPM\2-(32_%7AW3/$.G(P=+;4K1)T1NFY0P.TX[C!J7P MYX#\->$/#G_"/Z'H&FZ3H>UE.G6=HD4#!N&R@&#GOD<]ZWJ*SYY6Y;Z%\JO> MVIQ/@KX)?#[X<:I<:EX6\%:%X>U"X!62ZTW3XH9&4\E=RJ"%]AQ7:YI:*4I2 MF[R=P24=$)FC-+14C$S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T9I M:* $S1FEHH 3-&:6B@!,URWC'X4^"/B)<6T_BOP=H'B>>V4I!+K.EP7;1*3D MA3(C%03V%=5151DXN\7832>C/"/BA^R/X0\<>']%\.:%I>B^"_#D6N6VKZQ8 M:-I$4 U1(0VV%O+V G^-OAAX0^).EP:=XJ\,Z5XAL;<[H8-1LTF M6(XQE-P.TXXXQ7445HZU1VO+;8A4XJ^FYRI^%?@W_A"'\&CPMI">%'78VBI9 M1K:$9#H!Z=>:?X&^&7A'X96,MGX2\,Z5X;MI2&E32[-(/,(Z%RH!8^Y MS73T5'/-IJ^C*Y5>]CA+SX$?#C4/& \5W7@7P]<>)!()O[4DTR)IS(.CEBN2 MP_O=?>L/P=\"HO#_ ,=_&WQ0U'4EU35==M[>PL8?L^P:?:QJ-T8;<=Q=@&)P M.G2O5Z*M5JB35]U;Y"Y(WO8X2\^!'PXU#Q@/%=UX%\/7'B02";^U)-,B:?"SP=\4;6WMO%_A?2?$D-NQ:%=3LTG\HGJ5+ E<]\=:ZJ MBI]I.Z?,]!\L=58Y^+P!X8@\)?\ "*Q^'=*3PSY1A_L9;*,6A3J5\K;MQGG& M*I> _A+X*^%T=RGA#PII'AH7)!G.F620-+CIN*@$@=@>E=;12YY6:OHPY5O8 M3-&:6BH*$S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3->=_#_\ Y*A\4?\ K_L? M_2"&O1:\[^'_ /R5#XI?]?\ 8_\ I!#770_AU?\ #_[=$PJ?%#U_1GH>:,TM M%)YWO1X;NK9C)97 M#CY]C9*M&V2"I'0+Z<^_T5K"K*$916SW(E!2:;Z'G6E_LZ?"K1#$;'X;>%+= MHKD7D;+HMN6CF'2124RK#L1T[5>UWX(?#OQ1XCFU_6? WA[5M:FB,$M]?:7# M-+(A&TJS,IW?+QSVXZ5V]%'M:E[\S^\.2.UCD=2^$/@75_"-OX6O?!N@W'AJ MVY@TA]-A-K"@6?P^\,PZ+>.DEU8?V3 MT-PRG*-(I4ARIZ%LX[5W]%+VLTK^&9K72,_V? ^DP%+;)W'8NW !/)'<\ M]:]!HH56<592?W@X1>K1Q7_"DOAU_8=UHW_" ^&/['N[D7EQI_\ 8UO]GFG' M E>/9M9Q_>(S[UOZYX4T3Q-H,FB:OH]CJFC2((WT^\MDEMV4= 8V!7 P,<<5 MK44G.3U;#E2Z'G6F_LZ?"O2-%NM(M?AQX6CTNZD2:>T;1X'CF=<[&=60ABN3 MC/3)QUKI;?X?>%K3Q&?$,'AK2(=?-N+0ZK'81+=& 1>:%W; !MSC@<5T% M%-U)RWDP48K9')VGPF\#Z?X:O_#MIX-T"UT"_EP:7"EK<.<9:2(*%9N! MR1G@>E1>#_@YX$^'^G7]AX;\':)HEG?J4O(;+3XHUN5((*R87YQ@D8;(Y-=C M11[2=FN9ZARQ[''/\&OA_)X>L] ;P-X;;0K*^%9?$5SX@?PSH[Z]=6YM)]4:PB-U-!@#RGEV[F3 VDXP.E=#12 MYY]PY5V/.M+_ &=/A5HAB-C\-O"ENT5R+R-ET6W+1S#I(I*95AV(Z=JXGPS^ MSGJMS^TKJ?Q>\::Y:ZQ0!R[>V/>Z*U6 M(JJ_O;JWR)=.#MIL)FC-+17.:"9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC- M+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9H MS2T4 )FC-+10 F:,TM% "9HI:* "BBB@ HHHH **** "BBB@ HHHH **** " MBBB@ HHHH **** "BBB@ HHJ"^GDM;2:6&W>[E125@C90SGT!8@?F::5] )Z M*Y;_ (2O6O\ H3]1_P# FV_^.4?\)7K7_0GZC_X$VW_QRMO8R\OO7^9G[1>? MW,ZFBN6_X2O6O^A/U'_P)MO_ (Y1_P )7K7_ $)^H_\ @3;?_'*/8R\OO7^8 M>T7G]S.IHKEO^$KUK_H3]1_\";;_ ..4?\)7K7_0GZC_ .!-M_\ '*/8R\OO M7^8>T7G]S.IHKEO^$KUK_H3]1_\ FV_^.4?\)7K7_0GZC_X$VW_ ,?W,ZFBN6_P"$KUK_ *$_4?\ P)MO_CE'_"5ZU_T)^H_^!-M_\?W,ZFBN6_X2O6O^A/U'_P)MO_ (Y1_P )7K7_ $)^H_\ @3;? M_'*/8R\OO7^8>T7G]S.IHKEO^$KUK_H3]1_\";;_ ..4?\)7K7_0GZC_ .!- MM_\ '*/8R\OO7^8>T7G]S.IHKEO^$KUK_H3]1_\ FV_^.4?\)7K7_0GZC_X M$VW_ ,?W,ZFBN6_P"$KUK_ *$_4?\ P)MO_CE'_"5ZU_T) M^H_^!-M_\?W,ZFBN6_X2O6O^A/U'_P)MO_ (Y1_P )7K7_ M $)^H_\ @3;?_'*/8R\OO7^8>T7G]S.IHKEO^$KUK_H3]1_\";;_ ..4?\)7 MK7_0GZC_ .!-M_\ '*/8R\OO7^8>T7G]S.IHKEO^$KUK_H3]1_\ FV_^.4? M\)7K7_0GZC_X$VW_ ,?W,ZFBN6_P"$KUK_ *$_4?\ P)MO M_CE'_"5ZU_T)^H_^!-M_\?W,ZFBN6_X2O6O^A/U'_P)MO_ M (Y1_P )7K7_ $)^H_\ @3;?_'*/8R\OO7^8>T7G]S.IHKEO^$KUK_H3]1_\ M";;_ ..4?\)7K7_0GZC_ .!-M_\ '*/8R\OO7^8>T7G]S.IHKEO^$KUK_H3] M1_\ FV_^.4?\)7K7_0GZC_X$VW_ ,?W,ZFBN6_P"$KUK_ M *$_4?\ P)MO_CE'_"5ZU_T)^H_^!-M_\?W,ZFBN6_X2O6 MO^A/U'_P)MO_ (Y1_P )7K7_ $)^H_\ @3;?_'*/8R\OO7^8>T7G]S.IHKEO M^$KUK_H3]1_\";;_ ..4?\)7K7_0GZC_ .!-M_\ '*/8R\OO7^8>T7G]S.IH MKEO^$KUK_H3]1_\ FV_^.4?\)7K7_0GZC_X$VW_ ,?W,Z MFBN6_P"$KUK_ *$_4?\ P)MO_CE'_"5ZU_T)^H_^!-M_\? MW,ZFBN6_X2O6O^A/U'_P)MO_ (Y1_P )7K7_ $)^H_\ @3;?_'*/8R\OO7^8 M>T7G]S.IHKEO^$KUK_H3]1_\";;_ ..4?\)7K7_0GZC_ .!-M_\ '*/8R\OO M7^8>T7G]S.IHKEO^$KUK_H3]1_\ FV_^.4?\)7K7_0GZC_X$VW_ ,?W,ZFBN6_P"$KUK_ *$_4?\ P)MO_CE'_"5ZU_T)^H_^!-M_\?W,ZFBN6_X2O6O^A/U'_P)MO_ (Y1_P )7K7_ $)^H_\ @3;? M_'*/8R\OO7^8>T7G]S.IHKEO^$KUK_H3]1_\";;_ ..4?\)7K7_0GZC_ .!- MM_\ '*/8R\OO7^8>T7G]S.IHKEO^$KUK_H3]1_\ FV_^.4?\)7K7_0GZC_X M$VW_ ,?W,ZFBN6_P"$KUK_ *$_4?\ P)MO_CE'_"5ZU_T) M^H_^!-M_\?W,ZFBN6_X2O6O^A/U'_P)MO_ (Y1_P )7K7_ M $)^H_\ @3;?_'*/8R\OO7^8>T7G]S.IHKEO^$KUK_H3]1_\";;_ ..4?\)7 MK7_0GZC_ .!-M_\ '*/8R\OO7^8>T7G]S.IHKEO^$KUK_H3]1_\ FV_^.4? M\)7K7_0GZC_X$VW_ ,?W,ZFBN6_P"$KUK_ *$_4?\ P)MO M_CE'_"5ZU_T)^H_^!-M_\?W,ZFBN6_X2O6O^A/U'_P)MO_ M (Y1_P )7K7_ $)^H_\ @3;?_'*/8R\OO7^8>T7G]S.IHKEO^$KUK_H3]1_\ M";;_ ..4?\)7K7_0GZC_ .!-M_\ '*/8R\OO7^8>T7G]S.IHKEO^$KUK_H3] M1_\ FV_^.4?\)7K7_0GZC_X$VW_ ,?W,ZFBN6_P"$KUK_ M *$_4?\ P)MO_CE'_"5ZU_T)^H_^!-M_\?W,ZFBN6_X2O6 MO^A/U'_P)MO_ (Y1_P )7K7_ $)^H_\ @3;?_'*/8R\OO7^8>T7G]S.IHKEO M^$KUK_H3]1_\";;_ ..4?\)7K7_0GZC_ .!-M_\ '*/8R\OO7^8>T7G]S.IH MKEO^$KUK_H3]1_\ FV_^.4?\)7K7_0GZC_X$VW_ ,?W,Z MFBN6_P"$KUK_ *$_4?\ P)MO_CE'_"5ZU_T)^H_^!-M_\? MW,ZFBN6_X2O6O^A/U'_P)MO_ (Y1_P )7K7_ $)^H_\ @3;?_'*/8R\OO7^8 M>T7G]S.IHKEO^$KUK_H3]1_\";;_ ..4?\)7K7_0GZC_ .!-M_\ '*/8R\OO M7^8>T7G]S.IKSOX?_P#)4/BE_P!?]C_Z00UM_P#"5ZU_T)^H_P#@3;?_ !RN M"\#>(]6B^(_Q)D3PO?2R27UD7B6> &(BRA !)?!R.>,]:ZZ-&7LZNWP]U_-' MS,:DUS0WW[/LSV:BN6_X2O6O^A/U'_P)MO\ XY1_PE>M?]"?J/\ X$VW_P < MKD]C+R^]?YFWM%Y_M?\ 0GZC M_P"!-M_\?W,ZFBN6_X2O6O^A/U'_P)MO\ XY1_PE>M?]"? MJ/\ X$VW_P ?W,ZFBN6_X2O6O^A/U'_P ";;_XY1_PE>M? M]"?J/_@3;?\ QRCV,O+[U_F'M%Y_M?\ 0GZC_P"!-M_\?W,ZFBN6_X2O6O^A/U'_P)MO\ MXY1_PE>M?]"?J/\ X$VW_P ?W,ZFBN6_X2O6O^A/U'_P " M;;_XY1_PE>M?]"?J/_@3;?\ QRCV,O+[U_F'M%Y_M?\ 0GZC_P"!-M_\?W,ZFBN6_X2O6O M^A/U'_P)MO\ XY1_PE>M?]"?J/\ X$VW_P ?W,ZFBN6_X2 MO6O^A/U'_P ";;_XY1_PE>M?]"?J/_@3;?\ QRCV,O+[U_F'M%Y_M?\ 0GZC_P"!-M_\?W M,ZFBN6_X2O6O^A/U'_P)MO\ XY6MHFJ7FIK,;S2+C2BA 47$D;[\^FQCT]_6 MIE3E%7=OO7^8U--V_1FG1116184444 %%%% !1110 4444 %%%% !1110 44 M44 %%%% !1110 4444 %%%% !1110 F:,TM% "9HS2T4 )FC-+10 F:,TM% M"9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+1 M0 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9HS2 MT4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 F:, MTM% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 )F MC-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% " M9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 M F:,TM% "9HS2T4 )FC-+10 F:\[^'__ "5#XH_]?]C_ .D$->BUYW\/_P#D MJ'Q2_P"O^Q_]((:ZZ'\.K_A_]NB85/BAZ_HST/-&:6BN0W$S1FEHH 3-&:6B M@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* $S1FE MHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T9 MI:* $S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3- M&:6B@!,T9I:* $S12T4 %%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +1 M29HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- " MT4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:, MT +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)F MC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +12 M9HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T M4F:,T +129HS0 M>=_#_ /Y*A\4O^O\ L?\ T@AKT/->=_#\_P#%T/BC_P!? M]C_Z00UUT/X=7_#_ .W1,*GQ0]?T9Z+129HS7(;BT4F:,T +129HS0 M%)FC M- "T4F:,T +129KR/X\I\;'?1_\ A4,WA&) )?[1_P"$H\[)/R^7Y?E@_P"W MG/M6E.'M)*-TO4F4N57M<]=HKX%^#G[9_P 7=3;XQWWB?3/#OB72/ &F3/\ M:/#<$J0W-ZKX5%D=B63"R$D*.%SZ9YSP'^W-\7I]2^&FMW]]X(\7:1XUU0Z? M)X8T&.0:EIGSA3N&XE2 P;YMPQ]?E?\ +NB>(_BAXB\/IX=@\$_#S6[71KK1[ZVD>[U'S'V.XE##83 9SY8))!W9_AQD9KC?V*OB+XC^)'P:>\\6ZU_;6OV6JW M>GW#2VX@N;<1OA8KA555\U1C)0%>1R>36'L6Z3JWV=K=37G7/R6/>Z*3-&:Y MS06BDS1F@!:*3-&: %HI,T9H 6BDS1F@!:*3-&: %HI,T9H 6BDS1F@!:*3- M&: %HI,T9H 6BDS1F@!:*3-&: %HI,T9H 6BDS1F@!:*3-&: %HI,T9H 6BD MS1F@!:*3-&: %HI,T9H 6BDS10 M%)10 M%)10 M%)10 M%)10 M%)10 M%) M10 M%)10 M%)10 M%)10 M%)10 M%)10 M%)10 M>5?M+_M"Z-^S#\++GQUK MVFW^JZ=!^(WABSU&%YXM=US2/)L @C+J3*"1A@ %(ZY%?1L>M:= M-J+Z?'?VKW\8R]JLRF51ZE:MX@U*7P=<1KX;O+ MUIH=)?[)N:58U8G_ $<*2,#("G%?,'P5CL?@G\6/!>D7OA?P;\2?&&I7\L^@ M>._!OBN6\O?M;9\I[B%964IN92O0XH _03]J[]J>P_9?^'&C^+VT M1O%5KJ6IPZ;'%:WBP@>8KL) ^U@1\G3WZU[-INLV>J!E@N89)XU4S0QRAGB+ M#(# N^%_"7[(O[<&K6_AW3-2?PE<_#B]U+5](74)I9+\FUF:0&21F;+-&K9R= MIR1Z4 ?J[9:_IFHW4MK::C:75S%_K(89U=T^H!R*DN-6L;2[CM9[RWAN9%+I M#)*JNRCJ0I.2!ZU^$>E:CI-AX[^!/CGP1I/@7P"^H^(X8HM)\*>(+V^UJ&$3 MHA^WK-*RH&&0, %@QR,<5V'C^_\ AOJWQ"_:KNOCE3@/\NTYZ9- '[73ZC:6UFUW-=0Q6BC*(]2LYK$7 ML=U ]F5WBX60&,KZ[LXQ[U^(&JZSK=YX"_92\-ZLVA?\(#-H]W<);>,+R>TT M*XO?M=P";J2'D;1Y6,\#=S@,:[1-3TG]G[X&_%[2?$TG@;XI>$=8UK39;/P; MX*\2W<^F:3<2/-(/,N H9(\0CY%D+'8 V.M 'Z^7'BG3SH.HZK8W5OJ<-G#) M*WV6=7!**6V[AG!XKR_]DO\ :3M_VJOA/_PF]KH,OAR+^T)[#[%+="X;,>WY MMP5>N[ICM7YK?LMVX\$?MIW6DZ'<^#++2M7\&7TUYIWP\U>YO]+S]ED=4D>> M1R95*J2 =H.,=37UK_P2!_Y-%/\ V,5__**@#[(-)T!TCU3Q!86(^P0%E5N):^FZ^%_VZ/VL-(O9;[X%^&=7 MTVQUG5O]#U[7=5F$-GI5NP!="Q^](5ZA/0P-)5JO(X]^(OVQ_ACX7^#.B_$S4-8EAT'6H7?383;NUQ^.:ZWX#_&;2_C]\,M,\;:/8W>G:??M*J6]]M\U=CE#G:2.J^M> :M=_![P' M^PU/H6E^+?#VLZ-;:+?:=I>I7D\0^V7_ )3M)Y.__EH78G:O(R!63^P'\:_ M_@G]CJS?5O$VG0S>'8KN^U6SBF$MS:0&X?:[PIEP#N7''.1CK71/"P="4Z<7 M=2MKVUZ?<9QK2]HHR:M:_P SV?\ :3_:JT7]FJ;PQ!J?AW6O$=WXAFD@L[;1 M8TDD+IL^7:S DDN ,FJ'@3]KW3/$OA;Q=XC\1^!O%_P\T?PU:+>7%SXGTTV MXG4Y&V(9^=L@#'JP]:\I_:C_ .%3_M#+\+-:U+XO-\-&2&?6="OKFV:U>X0L M@$JO-L$94H" <$Y!%?-\7Q!^(?Q/^ 7[1O@V7Q=>?$[POX;6VGT[Q)-&3).B M7*E\,-_$.@Z=X/\ $WB^T\,N$U[6-'ME:UT\EMI#,3V;YPSTY MJ/PGX[\/_"CP[^V#X3\8W\&F>)=4N;A;*SNVVRWA9IPHC!^]_K$;CL<]*ZOJ M%"_-R/\ PW?\W+?OMJ9?6:FW-\_E>Q^HG@7QKI'Q'\'Z1XGT&Y^V:/JMNMU; M38P2C#H1V(Y!'8@UNU\^?L"Z-?Z%^R5\/K?48GAG>UEN%20$$1R3.Z<>ZL#^ M-?05?-UX*G5E"+T3:/4IR*M*\#^&M2\0:Y>QZ?I&G0-.3]!R3Q6K7S=_P42TS4]5_9&\;QZ7')*\:V\\Z19),"3HTA^@ R?8&MZ%- M5:L:;=DVD9U).$')= ^#W[:$?QN\::=I_A_X8>-8_"E_)+'!XOO+#98'8K') M89 !*[1\W4@$ \5S7C[_ (*.^#O!OB_7],L?!_BCQ/H?ARY6TUKQ%I5JK6=G M(6V8R3S\P(RQ7)!QFOF'X9>/=4^'_P 1?V=K3X;?%K7/&D'B.WM[?6_"5SJ" MW%KIR#8KQB! %A"@R$ KN'E[LG-Z8R;044\MM(+'T!SWKZ3^SZ/.WRW6EE=WUE9M^GW'E_69\MKZZZZ M=KV/TR\:?M >#/ WP;/Q.OM2$OA>2SCN[:2$?O+KS!F..-3C+MD#!QCG.,&J MO[.?[0&C?M*?#O\ X2_0].OM+L?MDMGY&H!/,W(%)/R,PQ\P[U\ :=X'^-S> M!/A=//\ "Z7QKX%\,>&!=:?:2ZI!:1)=S(SFYF1V+.T2N JE0!C([Y[K_@G- M\:T^$O[,WB75O&NGC0_ &EZBTL7B,2&=KBXE9$:$0("XV_)SCG=[&N2KE\(4 M)2IOFDFMFMG=6MW_ *Z&T,3)U$I*RMV_K0^G_P!H3]K?0?@+XBT/PO'X?UKQ MIXQUE#+::%H,'FS&,$C>W?G:V 2=IZ 9K/\)_MR_#KQ+\$-?^)<_P#:&D66 M@3?9=3TF[A'VV&X) 2(*&PQ8G .0.N<8./GWXE^/=#\)?\%$_AO\0O$-Z-)\ M&ZSX7#V6IZFC6\2;HI@-V\ H&OBOX^L/"&J>$_$/@35=6M#?:0VO0".+4(,%@R-GNJL0<%3@X M;/!YC5/^"F?@;3]?O/)\)>*;_P %66H#3+GQC;V@-BDQ/;GD=QDAB.0IKP3X M@>,-%^/'[27[.UG\.]0@UBZTWPZ/MC6+;OLF(F)CD(^ZRA2"#TW#UKR71?B' MX:T+_@GWXW^'6H7T%OXZ;Q4H&C2'%TQ#Q$N$ZX'EN">Q&.XK6&7T)-2<'K;2 M^UVU?\"'B:BNN9:7U[V2T_$_9#3[^WU6PMKVTF6XM;F-9H94.5=&&58>Q!!J MQ7#? O2;W0?@MX$TW44:._M=#LX9T?[RNL*@@^X/%=Q7RTTHR:1[$7=)BT4E M%0,6BDHH 6BDHH 6BDHH 6BDHH 6O._A_P#\E0^*7_7_ &/_ *00UZ'7G?P_ M_P"2H?%'_K_L?_2"&NNA_#J_X?\ VZ)A4^*'K^C/1:*2BN0W%HI** %HI*XO M2OC+X-USXC:EX#T[6XK[Q7IL?G7NGV\4C_9EP#^\D"[%/(X+9YQBJ492O97L M)M+<[6BDK,\3^)=-\&^'M1UW6;I;'2=.@>YNKEU9A%&HRS$*"3@>@I)-NR'L M:E%8/@?QSH?Q)\*V'B3PUJ":IHE^I>VNXT9%D 8J2 P!'((Y':MVAIQ=GN)- M-70M>$_MF^._&/@SX)ZG;> ?#FM>(?%>M?\ $NM?[%L);IK17!\R=_+4[,+D M G'S$>AKW6BM*4U3FIM7MT)G%RBXIV/DWPK^SOXK^!O[#VL>$O @V_$B]TYK MRYFB($LMW)M,J(QXW"/,:D]P#U-?'/@SX5:Y=:I\)H?AC\*_'O@;XL:/=(GB M7Q!J5M-;Z?(@;YY&=VQAN9\Y?'?\ 9B^%TDOB#XG7O@*_\3^)8(Q?-I.E274@U2ZC'[G?:Q-B M1MV,G;TR6R,U\X?$;]GGQ/X;^$?PY\1>)O#FJ>+9=4\5KXF^(.E:9;-/<2+( M 4B,*\LD*Y3;T!8]*_1RBLJ6.JTDDW>W=]+6LNW_ W8N>'A.[V/B;]D[]G. MR\;_ W\96OB_P +:WX>\'W7BRXU;PKI-S<7.FW=E;E=H91&ZO&""1M)P<$\ M\&OK#X:_"_PQ\(/"T7AWPEI2:1I,4LCR,\C'+.[N2SL>Y8DTSXF_%;PI M\'/#8U_QEK$6AZ.9TMOM4L=I[=JZ:QO8=2LK>[MG$MO/&LL; MC(W*PR#S[&LJ]>K6O.5U%OSM_P .73IPIZ+=?>3T4E%<1N+1244 +125Q?@_ MXR^#?'GBK7O#.AZW%=^(-"?9J.FO%)#/;G.,E9%4D9[KD=Z'^SA\)?#%\;W1OA=X+TF\,3P&XL?#]I#(8W4JZ;EC!V MLI((Z$$@TO@G]G;X7?#;7GUOPK\/?#7A[5W!'V[3=+AAF4'J%95!4'N%P*]# MS1F@#SR;]G7X6W/C3_A+Y?AWX8D\3^;Y_P#:S:3 ;@RYSYF_;G?G^+K[UXWX MI_8-IQ@9&>M?4^:, MT C9HS0!PG MAKX!_#/P;=VMWH7P]\+:1>VMLUG#=66C6\4T<+ AXQ($W;6W-D9P=QSUKH/! M_@;PW\/=(_LKPKX?TKPUI?F--]AT>RCM(-[8W-LC4+N.!DXR<5MYHS0 M%)F MC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +12 M9HS0 M%)FC- "UP6N? 'X8>)]6NM5UGX<>$M6U.Z?S+B]OM"M9IIF_O.[1EF M/N37>9HS5QG*&L7832ENCB)_@7\-KKP_:Z#-\/O"LVAVLS7%OIDFBVS6T,K# M#.D13:K'N0,FO/\ XL?LA>"_&WP_O_"WA31/#_P_359[8:I>:+HD$,MS:1RK M(T&8PA^8J.22!Z&O=\T9K2%>K!J49/34ATX25FCB?$_P1\ >-='TS2_$/@W1 M-DZ?IT4,N#U 95! /<# -'BWX&?#OQYKT.M^(_ ^@:YJ\( 6]U#3HII<#[ MH+,I) [ YQ7;YHS3]K4OS""#U%/S1F@#B?"'P0^'OP_P!: MGU?PSX(T#0-4G!#WFG:=%#*0>H#*H(![@<4SQ)\"OASXP\2Q>(=<\#>']7UR M,J1J%[IL4LQ*_=RS+EL=LYQVKNU5W'&6P>@KVS-&:*=6=)\T'8)0C-6DCF/&WPO\ "'Q)TN#3O%7A MG2O$-C;G=#!J-HDRQ'&,IN!VG''&*N:/X%\.>'O# \-Z9H&F6'A_RVB_LJVM M(TMBC?>4Q@;2#DYR.<\UMYHS4\\KQQO@;X+^ OAE>75WX2\&Z'X< MN[D;9I]-L(X)'7.=I90#MSVZ57O/@1\.-0\8#Q7=>!?#UQXD$@F_M23386G, M@Z.6*Y+#^]U]Z[K-&:KVM2[ES._J')&UK"T4F:,UD4+129HS0 M%)FC- "T4 MF:,T +129HS0 M%)FC- "UYW\/\ _DJ'Q2_Z_P"Q_P#2"&O0\UYW\/S_ ,70 M^*/_ %_V/_I!#770_AU?\/\ [=$PJ?%#U_1GHM%)FC-7_ ,-M0FN9M&\00.ODR6TX^>!B#N1QD$'&-P;VSZ6'E'V% M2+=G>+]4KW_1V.6HG[2+]?O/G?2/VL/B7X4^(?P]U'2_B)XL\>>%/$&L1Z=< MW/B/PA#IFFWBF14;[+*&9B1N/ "D8&<\BNB^('Q(^*'[1\/[1EY:^.SX4\#^ M![>YT]/#D&G13?V@@$JL)';#+N$9.X$X+# &.?=-$_X)O^"-,B\,PWGCGQYJ MMMX:U!;_ $FSNM5B:VM=KA_+6(PE54L,L5 )]16CXU_X)Z> ?&?COQ1XC7Q' MXM\/P^)E"4U**LUUY5W[:*]M M+V.+V->UGMVOY?YGR?X4_:1\7^"OA%\!/AIX4O-9T:#5=*N-0U'4?#FD+J>I MO&+F<+%;PMQ_RS)8]0#GH"#U&H_M/?'3PI^SM\4+K5)O$>FWVAZE9#0/%'B' MP\MA=75K+,49'B>,QLP &<9(W=>E?3.M?L%_#_5/ ?@OP]:ZMXCT?4?!Z.FC M^)M/ODAU.%6D:0AI%C"D;F)X4$=B,G,<_P"PMX=USP#XF\,^*/'_ (Z\5MX@ M>U:[U35=4CFN8Q;N7C2(O$P1/''P0\8_M Z?\28=$T[0]7^S6W@U-*ADMGMP\:E7D8;L_ MO1UR3@\C(Q]H:K^RKX1U?X@?#GQA/J&L?VEX%L5T_385FA\B:-4*YG4Q$L<' M^$J/:O,]8_X)O_#[4M3U*.V\3^,-)\(:G>C4+WP?8:H$TR:8'.=A0G'XDCL1 M@8SAB\(VG**3TO[JZ-W5O-6U*E1K:I/\?)?K<\VLOVAOBA^U/\:] \ ^#/%2 M_"W2QX8MM>U&]M[&.ZN9I98HY"B"3HH,J@8(X!)SP*M_'+QK\0?AO=>%? NI M?'/Q%?\ CAK:>3^S_!/@R&^O]20RL89I$W((\(N"H8YVD^]>V_$_]BKP7X^\ M1:+XCT35M>^'?B72+)-.MM5\)W@M9#;(NU(VRIR O (P<<$D 5S5W_P3X\)S M:OX=UJV\>^/-/\2:5%+#-K]MK 6_ODD=W<2S;,@DR.,KC@X.>#4QQ&$O%K1) M;V\8:%XL@T9=6?3X$ MGD@9"Q66(H4# \' SQU)Y/HWQD^+WQX^$?AWP3H=SX\TK4?%/Q)U2""PU.'2 M(X8-$@*QAD12#YC,TJG<^2 IQU&/5X?^">GPY@^%&N?#Y=;\5-HVL:S'K<]P M][ UTLZ+M"JY@(VX/.X%C_>KTKXT?LU>#OCMX#TOPOXC6]C32BCZ=J=C,(KR MTD10H='VD9( R"I!XXR!@EBL)[1#=*_X1"VU-6;2+>Z$4GD1LY0$*06+8SNPH)P M.E>IZA^P%X<\4>#]6T'Q9\1?'_BO^T9;:1K[4]5CFGA6 N8TC+Q,%4EVSP<\ M=*]%TC]F+PMHOQJ?XGP:AJ[Z^^C)H9MI)HC:^0J*@;:(PV_"#G=CKQ4_6L/& M&MI2UUY5:[Y;:;=&/V-1RTT6G7UN?$.B?MO?%B7]F;0;==8MW\M M:=K$^GQ6]Q97$<$L@X7(*YB;ALCE>G(/K5M_P3_^&4'PCU'X>R7.NW>FW6K- MK<6H3W40O;.Z*A=T+I$J@87&&5NISVQ>^'/[$OA/P-JVOZYJ?B3Q/XU\3ZQI MLFD/KGB*_6XN;>V=-A6([< [>,MN]L D'2>)P34N6.]]+=[6=^ENQ,:5=-7? M;K]_K<^+5_:3_:&TKX)_#KXLR_$^#4(-4UZ31SHD^BP*CX9OGF= -X.TC"A2 M!C!SDU[=\/?C/\3?AU^TM\2/A[\1/B5;ZWI%GX8DUM-;DTN.WCTY_+1PZ1+D M[5#D;"6W;1W->M7'[!?P_N?@YX:^&K:QXD&A:!JS:Q:W NK?[2\Q+$J[>1M* M?,> H/3FND\2_LB>!_%_Q1\3>.=5N=6N=0\0Z(V@7MC]HC6U^SE%0E0(]X?" M YWD9[45,7A)\T>56?-M%=UR_A?]1QHUHV=^W5]M3XCTC]K#XE^%/B'\/=1T MOXB>+/'GA3Q!K$>G7-SXC\(0Z9IMXID5&^RRAF8D;CP I&!G/(KW_P#:%M$^ M''[=/P-\7:0!;WGBGS]"U5(^/M,0"A2WKCS!S_L+Z5KZ)_P3?\$:9%X9AO/' M/CS5;;PUJ"W^DV=UJL36UKMB49)Z)7OMII=_( MF-.JHVGNVK=;=SZMHI,T9KYH]46BDS1F@!:*3-&: %HI,T9H 6BDS1F@!:*3 M-&: %HI,T9H 6BDS1F@!:*3-&: %HI,T9H 6BDS1F@!:*3-&: %HI,T9H 6B MDS1F@!:*3-&: %HI,T9H 6BDS10 44M% "44M% "44M% "44M% "44M% "44 MM% "44M% "44M% "44M% "44M% "44M% "44M% "44M% "44M% "44M% "44 MM% "44M% "44M% "44M% "44M% "44M% "44M% "44M% "44M% "44M% "44 MM% "44M% "44M% "44M% "44M% "44M% "44M% "44M% "44M% "44M% "44 MM% "44M% "44M% "44M% "44M% "44M% "44M% "44M% "44M% "44M% "44 MM% "44M% "44M% "44M% "44M% "44M% "44M% "44M% "44M% "5YW\/_\ MDJ'Q1_Z_['_T@AKT6O._A_\ \E0^*7_7_8_^D$-==#^'5_P_^W1,*GQ0]?T9 MZ'12T5R&XE%+10 E%+10 E%+10 E%+10 E%+10 E%+10 E%+10 E%+10 E%+ M10 E%+10 E%+10 E%+10 E%+10 E%+10 E%+10 E%+10 E%+10 E%+10 E%+ M10 E%+10 E%+10 E%+10 E%+10 E%+10 E%+10 E%+10 E%+10 E%+10 444 M4 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %07U]!IMI- M=74JP6\2EY)'. H'L_P#ONC_A:/A/_H/6?_?==316 MUZ7\K^]?Y&=I]U]W_!.6_P"%H^$_^@]9_P#?='_"T?"?_0>L_P#ONNIHHO2_ ME?WK_(+3[K[O^"L_^^Z/^%H^$_P#H/6?_ 'W74T47I?RO[U_D%I]U M]W_!.6_X6CX3_P"@]9_]]T?\+1\)_P#0>L_^^ZZFBB]+^5_>O\@M/NON_P"" ML_\ ONC_ M (6CX3_Z#UG_ -]UU-%%Z7\K^]?Y!:?=?=_P3EO^%H^$_P#H/6?_ 'W1_P + M1\)_]!ZS_P"^ZZFBB]+^5_>O\@M/NON_X)RW_"T?"?\ T'K/_ONC_A:/A/\ MZ#UG_P!]UU-%%Z7\K^]?Y!:?=?=_P3EO^%H^$_\ H/6?_?='_"T?"?\ T'K/ M_ONNIHHO2_E?WK_(+3[K[O\ @G+?\+1\)_\ 0>L_^^Z/^%H^$_\ H/6?_?== M311>E_*_O7^06GW7W?\ !.6_X6CX3_Z#UG_WW1_PM'PG_P!!ZS_[[KJ:*+TO MY7]Z_P @M/NON_X)RW_"T?"?_0>L_P#ONC_A:/A/_H/6?_?==311>E_*_O7^ M06GW7W?\$Y;_ (6CX3_Z#UG_ -]T?\+1\)_]!ZS_ .^ZZFBB]+^5_>O\@M/N MON_X)RW_ M'PG_T'K/_ +[H_P"%H^$_^@]9_P#?==311>E_*_O7^06GW7W? M\$Y;_A:/A/\ Z#UG_P!]T?\ "T?"?_0>L_\ ONNIHHO2_E?WK_(+3[K[O^"< MM_PM'PG_ -!ZS_[[H_X6CX3_ .@]9_\ ?==311>E_*_O7^06GW7W?\$Y;_A: M/A/_ *#UG_WW1_PM'PG_ -!ZS_[[KJ:*+TOY7]Z_R"T^Z^[_ ()RW_"T?"?_ M $'K/_ONC_A:/A/_ *#UG_WW74T47I?RO[U_D%I]U]W_ 3EO^%H^$_^@]9_ M]]T?\+1\)_\ 0>L_^^ZZFBB]+^5_>O\ (+3[K[O^"L_^^Z/^%H^$_P#H/6?_ 'W7 M4T47I?RO[U_D%I]U]W_!.6_X6CX3_P"@]9_]]T?\+1\)_P#0>L_^^ZZFBB]+ M^5_>O\@M/NON_P""L_\ ONC_ (6CX3_Z#UG_ -]UU-%%Z7\K^]?Y!:?=?=_P3EO^%H^$ M_P#H/6?_ 'W1_P +1\)_]!ZS_P"^ZZFBB]+^5_>O\@M/NON_X)RW_"T?"?\ MT'K/_ONC_A:/A/\ Z#UG_P!]UU-%%Z7\K^]?Y!:?=?=_P3EO^%H^$_\ H/6? M_?='_"T?"?\ T'K/_ONNIHHO2_E?WK_(+3[K[O\ @G+?\+1\)_\ 0>L_^^Z/ M^%H^$_\ H/6?_?==311>E_*_O7^06GW7W?\ !.6_X6CX3_Z#UG_WW1_PM'PG M_P!!ZS_[[KJ:*+TOY7]Z_P @M/NON_X)RW_"T?"?_0>L_P#ONC_A:/A/_H/6 M?_?==311>E_*_O7^06GW7W?\$Y;_ (6CX3_Z#UG_ -]T?\+1\)_]!ZS_ .^Z MZFBB]+^5_>O\@M/NON_X)RW_ M'PG_T'K/_ +[H_P"%H^$_^@]9_P#?==31 M1>E_*_O7^06GW7W?\$Y;_A:/A/\ Z#UG_P!]UP7@;XA^&[;XC_$F>76;5(;F M^LFAC MY&-13YH:K?MY/S-O_A:/A/\ Z#UG_P!]T?\ "T?"?_0>L_\ ONNIHKEO2_E? MWK_(VM/NON_X)RW_ M'PG_T'K/_ +[H_P"%H^$_^@]9_P#?==311>E_*_O7 M^06GW7W?\$Y;_A:/A/\ Z#UG_P!]T?\ "T?"?_0>L_\ ONNIHHO2_E?WK_(+ M3[K[O^"E_*_O7^06GW7W M?\$Y;_A:/A/_ *#UG_WW1_PM'PG_ -!ZS_[[KJ:*+TOY7]Z_R"T^Z^[_ ()R MW_"T?"?_ $'K/_ONC_A:/A/_ *#UG_WW74T47I?RO[U_D%I]U]W_ 3EO^%H M^$_^@]9_]]T?\+1\)_\ 0>L_^^ZZFBB]+^5_>O\ (+3[K[O^"L_^^Z/^%H^$_P#H M/6?_ 'W74T47I?RO[U_D%I]U]W_!.6_X6CX3_P"@]9_]]T?\+1\)_P#0>L_^ M^ZZFBB]+^5_>O\@M/NON_P""(]5M-$T6S4-<7]]*(H8@2%!9CP.2!^ M- &Q17FO@G]I?X3_ !(UJ/1_"_Q'\,:[JT@)CL++5(9)Y,9&"63 M\0*YSX5_&_P/\;;75KGP1K\.OP:5=FQO7BAEC\F8#)0[U7/'<9% '=4444 % M%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !112$X% M"T5YO9?M'_"_4_'$7@ZR\=:)>^)I93 FG6MVLLC2 $E,KD;A@Y&<\5TWCCXB M^%_AGI*:IXLU_3O#NG/*(4N=2N%A1G()"@L1DX!./:M'3FFHN+N_(GGBU>YT M5%5]/U"VU6PMKVSGCN;2YC6:&>)MR2(P!5@>X((-/OBMX.^%FC0 MZMXM\2:;X?T^=MD,]]<*@E;&<(.K''/ /%2^%OB9X3\;>%6\3:#XCTS5?#Z* MS2:E;W*-#&%&6WMG"X')#8QWHY)\O-;3N',KVOJ=-17GO@+]H/X;?%'6KC2/ M"?C;1M>U.!2[VEG=*TA4=64?Q >JY%>A42A*#M)68*2DKIA1114%!1110 44 M44 %%%% !1110 4444 %%%% !1110 4444 %%%% !1535=5LM"TRZU'4;N&Q ML+6)II[FX<)'$BC+,S'@ #N:Y_0?BOX,\4>$;KQ5I7BG2;[PU:EQ/JT-XAMH MBF"VZ3.T8R,Y/>J49-72%=+0ZNBN#^'GQW^'GQ9O+JT\'^,=(\0W=J-TUO97 M2O(JYQNV]2N?X@,>]5?'7[1?PR^&6M)H_BCQSHNC:JV/]!N+I?.4'H609*@] MB<5?L:G-RD45QGQ&^,O M@?X16UK/XS\4Z9X<2Z)$"WUP$>7'7:OWF XR0.,U;A^*/@^Y\#GQE'XGTE_" M@C,IUD7B?90H."3)G YXQUSQUI^SG92L[,.:-[7.HHKB?AQ\;/ ?Q>%W_P ( M9XLTOQ&UICSX[&X#21 ]"R?> /8XP:[:IE&4'RR5F--25T%%%%2,**** "BB MB@ HHHH **** "O._A__ ,E0^*7_ %_V/_I!#7HE>=_#_P#Y*A\4O^O^Q_\ M2"&NNA_#J_X?_;HF%3XH>OZ,]$HHHKD-PHHHH **** "BBB@ KS']HCX]:1^ MSA\.)?&.MZ?>ZG8QW45J;?3PGFEI"0#\[ 8X]:].KYZ_;?\ #7@?QQ\(K/PU MX\\:IX#TK4M5@$6JRP>8AE0.X0DD*@(#?,Q &*Z<-&$ZT8S6E];=OD956XP; MCN,^$O[8L/Q1\0BPN?ACXY\'::+.6^?7/$.F>18I&B;R3)DCD=/6N)L_^"E/ M@JYU"VO9/!_BNU\!76HG2H?&DUHHL6G]QNR%[_WL?P\$5XQ\"?%7B"]_:.U? MX*Z;\6;SXO\ PPU3P[<0WFIN1*+!3 RCRY?45D+-DS./EB&YON98DL>@%?0PP&'E M5Y&M[-;[.]WMOY/0\R6(J*',GW[;Z:>GH?LM%*D\221L'C-_$_AS0/ WBCQR?"JE]?O\ 1K=3;V 'WLDG)VX.20!P>3@FM37/ M!'[2%CKVDV_@_P 7>#+'P?:6EE UIJEM*]X=D2+-\PB88LP<-(,M)M!"HIP9!@=2>'!8.E4D MW4:DK=+Z:I:VU^[YG17KSBERJS_X'0^Y_&'[=_P^\-?"3PGXYL;;5M?/BN5K M?2-$LK"_'OA?QQJ.JZ7K'@W5/!<# M7.M:)K%N%NH8QGE5S\W(VX.T@D9'(-?"B>+H8-%_9$\E>K_ L\*:)^TY^U]^T7_95]]K\$ZSH7]ER: MO8$/&TC^2JNC=&^:)V'8[:ZYX"A3A)R3TN[WVM*UNVQC'$5)25GVT^5[GTY\ M$OVQ=(^,'C6U\+W?A+7O!VI:EIG]M:0=86/9J%GG_6(48X..<'L#S7H'PA^- M.E_&C_A);G0K"\32-'U.32X]3G"B&_DCXD>'!)* \9(&>U?%WQ(^!_C'X'W' MADS^/8_&'Q#U735\ ^"[6STT6?V.U?B:ZE(=BQCB+<]BP.37'^-_&WBOX(7/ MQ'\)^&_B3+X%L/A7IVG)H.A1QP*-657!:4NS,Q SC<.U8O T:W\![[ M;VWLWM?=I??V-%B)T_XBV].WW=_P/KG]HG]IGQ3\"?$VFPIX-TG6-$O;B"VM M5;7UBU747=E5Q:V8C8OY9=PYKN_CE\<;/X0_"?Q3XNM(;77+_0K=9Y- M(^V+&_,B(0Y 8I@O_=->6?$7X!^-OVG_ IHDNM>.;'1O"^L66GWUSHQ\.12 MWME)Y<^,-8U/7;?7?$'BF[CNKV33]-33K.(1J51(H%9@.I);.3G\_::Y,1[/ MVK]E\/S_ %U-J?-R+GW"BBBNU5HY+73O ]N?#VFH9=HMY[UFR2/NARAWD<==U?IS\*OAQIGPA^'' MAWP5HT]W7>-/VAOC5\3?V@/@AX, M\&^/8/ 4'CGP1#J]ZPTB"^BAN'BF=Y%20!B?D&T;P!@9SSGSK0_V]_C!\-?V M*?&OAWQ=%X9TW7[NTC41B3SMTCHH"MM\ABNX'EQG(&*^Y-$_8P M\$Z#\3_AUX[M]4U]]7\"Z&GA_389+B V\UNL;QAIE$(9GQ(W*LHR!Q6'9?\ M!/GX60^%?B5X>OVUK6M-\>ZF-7U 7]S%OM+E6=E>V:.)"FTR-C=OXX.1D$ \ MD^(NC?M$_L^?L^>,?B'J/QX;Q'OM1M)="M8C97K20[7@?:P= &D7# #D' M'IY]XG_:6_:!^#O[(NE?_ !YIGB2Z\765C8:+IT.B11_V;-)EVNY& _>R M%$8;,;-S#"X&*]]TO_@G-X=3PYK.@:]\4OB3XJTB]TIM%MK75M9CE33[9GC8 M^0K1%5;]T@SC&.,=,>IZO^RAX"\1_L\:=\&-9@O=6\):?:16EO-<3*+R,Q?Z MN42(J@2#U"@=01@D4 ?%_P )/VDOC1X8^)\4&O:Q\0=2^&U_H=S-JOB;QSX' M&FQZ'=I!(XN(V12K1 JN%8X.[&,X->>:-^V/\5?!_P 3/AIJ>D?$WQE\0_!_ MB36XM,NKKQ1X*@TG2KY6E5'^QRJ[,2-Q. %*X&)/B ME\2O'&@0V<]A:Z#KVNB6S@BEA:$X0(/F5'(4C&,#BL70/^"7/@+28?"D%[\0 M/B)K%IX5U)=1T:QO-7B:UM-KA_+6$PE54L 6*A6/J* /G[]FSX;?$C5/^"@O MQQM],^+,FCW>E7T%SK-V- MYO[:M_-5A;E6<"#"_+O7)[XKEO#'[:OQ$^''[ M.WQ O](ETQ?%.I?$)O#NFZ@NDVMO%8QF,L9&2*-5D<8P#(&ZDG.,5]PZ]^PQ MX=OOV@;OXMZ%XW\8^#M:U*:&;5K#0M16&UU'RRIV2#9N*-L&Y22#SC&:IZ?_ M ,$ZOA1:_"SQ?X!NY-._C(WQ*T.[T_]Y8W.CPVDEK>;E.Z*1,EH]N\8)';CT]Z MKP?X"?LFV_P-\2RZY+\2/'7CNY6Q.F6D/BK51=06=ON5ML2;!@_(HSGH.E>\ MT )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 )12T M4 )7AW[;OBK4_!O[+'Q"U/2)9+>^%@(%FB.&C621(W8$=#M=N:]RK(\7>$]* M\=^&-4\/:Y:)?:1J=N]K=6[Y >-A@C(Y!]".0:VHS5.I&&O&$L9L_$5E \^O1S2%097GD^ZP\T?(@VXR MNX')KSW]L/\ :)\._M%7'C"^U+6KFTN]$NTTWPIX86&78(Q*/M-Y,X&S>X7 M7/ ^@S]X^ /^">O@3P1XN\/ZQ=>)/%?BFQ\-RF;0]$US4%FLM/8MNRB!!T;! MQD#(&0:]9^.7[/\ X8^/WP_N_"&O&ZT[3[J:*9[G2/*BN R-N #/&XP2.>*^ MB_M##0Q$:MFWU>UM>SOTT>QY?U:JZ;A>R[?+Y%']F3XD^'_B#\!_!>IZ)?>? M:)I\-@6E0Q$S0QK'(H#8)PRD9[]J_.+P+X,\/>//V&-UEX8AUZRA6VMN(H4-Y(A10. -H"X] !7Z+?&#]C+P)\6=%\ M)6D4VJ>$+_PG"MOHNJ>'KD07%K$H ";B#D# .>&!R0>3E/A_^Q5\.? ?PI\3 M^!##?Z[9>)R7UC4=4N ]Y=/U5]Z@!2I^9<#@\G))KH694$E+7I[OI+FO]QD\ M+4V_'Y6L?'7BOP;X?^%_Q3_8YU/P3IMII.IZI:VHOI;"-8WO _DAWE*_?)$L MH+')(..U?I_7S)\'OV O _PD\>:5XK?7_$OBR]T2,PZ-!K]XDL&G( MFXX[#.<9YKZ?[1/AZ_ M^(\7P=\2:U=>&?"%K9C4MS3RP2L9.UG8X].W/@?P=T_5/C M9^P1XF^&G@,W&I>,-(UY=9O]'A5D:XLV("JK'"N=R[M@.?D]<5^M.M^';#7[ M"\M;NWC874+P/*$4N%92N02#R >*\<\&_LA>&_AU\#-6^&/AGQ)XETJRU"X: MY_MN*[C34H7+(WR2QQH /D ^[G!/-?04,?1IT(TU&S3B^ZNMWM^%^W8\VIAY MRJ.3=TT_^&/A[1/$%Q8_M??!.30?AA??"[5[31&MM0TJX@C@>\1(I0TAC3#% M2%(W. 6P#VKS_P"%.L^*?#WPI\9_&Z^\ > /B'8/X@:+6KKQ?#)>:B"[)\L* M'"1KF0?-\S$D<86OT>^!G['/@[X(^*KWQ8-3USQEXQO(C#)KWB:\%S<(AX*I M\HQD DY..,XXKB-?_X)P?#O6]>U.6'Q#XLTGPOJM\-2O_"-AJ2QZ;<3@Y!* M;"0.3WR.Q'&.M9CAN9Q>UDKZZV;;6]^NAB\-5M?KK^2/=-"^(,'B_P"#UCXH MTN/[#)J>AC4;2T9AOCW0;U4#O@\<>E?E/H/@7PSJ_P#P3N\<>.+_ $ZTG\:K MXK7&L2QJ;M"7A&P2'Y@"'S?M9:[X^UC14TWPSX;T:U\ M/^$K+K?BBS\-7E^-2N/ M"5MJ"KILDV3_ [-P')'7(!(# 5RX:O0PK:YGJXRT\KOEW\_O-JM.I62=NZ_ MX)X%\.--MOC/^VUX#L/B)80:_:1?#RRGALM5B$T4DC6:.S%&R"=SR-TZC/:O MG'4-2O+3X&^(O"4$\J^#E^)B0K&KGR]GE2C;],*I_ &OU%^./[%_@WXU:WHF MNIJ>M>"_$6D6HL;;5/#5R+>3[. 0(FRIX + 8P<$CD<5!;?L*?"^W^!$_P * MC:W\FCSW/V^34WG7[>;O&!/YFW;N ^7&W;CC%=-/,J$%&3O]E6MM9O7\3&6% MJ.Z]=>][:'@5EX5T7X5?\%-O!ND>"--M=#TK4/#)%[8Z;$L4+#R93N9%P,GR MXR3W(SUK] J^?_@+^QAX2^!/C"[\6IK>O^+_ !3/;"S35/$5V)Y+> #9'A1 MCA0,G/ P,#-?0->+C:T*TH\CORI*_<[Z$'!/F5KN]A**6BO/.D2BEHH 2BEH MH 2BEHH 2BEHH 2O._A__P E0^*/_7_8_P#I!#7HM>=_#_\ Y*A\4O\ K_L? M_2"&NNA_#J_X?_;HF%3XH>OZ,]#HI:*Y#<2BEHH 2BEHH 2BEHH 2L/QAX%\ M.?$+2#I?BC0=.\0Z:6#_ &74[5+B,,. P5P0",GD<\UNT4TW%W0FD]&5&6Q[U1\)? GX=> M;DUGP[X& MT#1=7D+%K^STZ*.?G[V' R,]P#S7=U\:?M#-=?'G]L'P'\&I;J>W\'Z18GQ+ MKEO!(T?VP@D1Q,00=OW1C_IHWM7904Z\I)S:5FV_)?F8U'&FE9>A]E5PGC#X M#?#?X@:TFK^)? GA[7=47 ^V7^FPRRL!T#,RY8#T.17PA^U!J5K!4\/0R&?2M6:SB@D6)R@"YV@KS-/C9\2-0_8W^*#OXUUW M5]*T7Q196>A^)Y;F6.[GB+OO7S<[RNT1M@DXWX]J]&EEU3EC4A.W-;NOB=M^ MOH,_B)XV\+^"_AMJ^I:3/IWARX\6:G_9MW);OY?E>8J.4()(1. >\@J(X& M=1QA&I>#OKKI;>Z*>(C%.3C[RM^)^@MYX4T34=>L= MYMU?[ZQR$;D#=P",U@^*?@SX"\<>(+37?$/@S0];UFTP(+^_T^*:9 #E1N92 M< \@'IVKX_\ C%^V-K]I^P9X,\9^&+TVWBOQ$T.BS7Z\O:SJKBX<9Z.3$<'M MOSU KMOAA^Q#K/A)O"7BN/XQ^-KGQ5'+;WFL17NHM-8:@A(:: Q\-@@D LS> MI'IC]6E1CSU*G*[M+?IOZ(OVJF^6$;[/[SZ\ P , =A17QEX"BF_9S_ &Z[ MWP#IT\O_ A'Q TQ]8L]/>0LEE>1[BXC!^ZIV/P.S*/X17V=7%7H^Q:L[II- M&].?.GIJG82BEHKG-1**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@! M**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@! M**6B@ HI,T9H 6BDS1F@!:*3-&: %HI,T9H 6BDS1F@!:*3-&: %HI,T9H 6 MBDS1F@!:*3-&: %HI,T9H 6BDS1F@!:*3-&: %HI,T9H 6BDS1F@!:*3-&: M%HI,T9H 6BDS1F@!:*3-&: %HI,T9H 6BDS1F@!:*3-&: %HI,T9H 6BDS1F M@!:*3-&: %HI,T9H 6BDS1F@!:*3-&: %HI,T9H 6BDS1F@!:*3-&: %HI,T M9H 6BDS1F@!:*3-&: %HI,T9H 6BDS1F@!:*3-&: %HI,T9H 6BDS1F@!:*3 M-&: %HI,T9H 6BDS1F@!:*3-&: %HI,T9H 6BDS1F@!:*3-&: %HI,T9H 6B MDS1F@!:*3-&: %HI,T9H 6BDS1F@!:*3-&: %HI,T9H 6BDS1F@!:*3-&: % MKSOX?_\ )4/BE_U_V/\ Z00UZ'FO._A__P E0^*/_7_8_P#I!#770_AU?\/_ M +=$PJ?%#U_1GHM%)FC-&?$'@#^R%LY-)U%6N)I)1&P5_*:(QE06!!WY]JZG]J_P#9JN?B M_P#L\R_#GP#;Z%X:(O+>>W@F0VMG$B.68!88VP3GLM?0$4:01I'&@CC0!511 M@*!T %.S6GUNKS0E?X+6^1/L86DK?%N?#3?L8?&7XOKX-\/_ !C\=>&V\ ^& M3"T6B^%HI2]WY2!%$CR1I@[1C=S@$X )S5E/^"=TGQ*^,7C[QG\4=:V6FJ3* MFBVGA749(VM[5046.8O"O1%C&U(?\ A0WC?X5>)/$6F?V5)K0UGPKJ-E)+-+:. RXG1HT #+M! M",>68CH,]M\-/A[^U?I]WX8T#Q1XR\&0^$]&N(/M6HZ>DLFHZA;1,/W1+1A1 MN5<%L*?4GG/UOF@@,"",@]014RQ]6=U-)WUU6S[H:P\(VY;KYGQ?X=U%/VA? M^"@W_"1Z$PN_"?PUTB33I=2BYBFOI=X:-&Z'&]NG_/,^HK[1JGINCV&BQ/%I M]C;6,3MO9+:%8U9O4A0.:MYKGKUE5<;*RBDE_7J:TX&52KJK%21]001^%39HS33MJ@.7_ .%9>'?^?.?_ M ,#9_P#XNC_A67AW_GSG_P# V?\ ^+KJ,T9K;V]7^=_>S/VP]G#^5'+_P#"LO#O_/G/_P"!L_\ \71_PK+P[_SYS_\ @;/_ /%UU&:, MT>WJ_P [^]A[.'\J.7_X5EX=_P"?.?\ \#9__BZ/^%9>'?\ GSG_ / V?_XN MNHS1FCV]7^=_>P]G#^5'+_\ "LO#O_/G/_X&S_\ Q='_ K+P[_SYS_^!L__ M ,7749HS1[>K_._O8>SA_*CE_P#A67AW_GSG_P# V?\ ^+H_X5EX=_Y\Y_\ MP-G_ /BZZC-&:/;U?YW][#VP]G#^5'+_P#"LO#O_/G/ M_P"!L_\ \71_PK+P[_SYS_\ @;/_ /%UU&:,T>WJ_P [^]A[.'\J.7_X5EX= M_P"?.?\ \#9__BZ/^%9>'?\ GSG_ / V?_XNNHS1FCV]7^=_>P]G#^5'+_\ M"LO#O_/G/_X&S_\ Q='_ K+P[_SYS_^!L__ ,7749HS1[>K_._O8>SA_*CE M_P#A67AW_GSG_P# V?\ ^+H_X5EX=_Y\Y_\ P-G_ /BZZC-&:/;U?YW][#V< M/Y4P]G#^5'+_P#"LO#O_/G/_P"!L_\ \71_PK+P[_SYS_\ M@;/_ /%UU&:,T>WJ_P [^]A[.'\J.7_X5EX=_P"?.?\ \#9__BZ/^%9>'?\ MGSG_ / V?_XNNHS1FCV]7^=_>P]G#^5'+_\ "LO#O_/G/_X&S_\ Q='_ K+ MP[_SYS_^!L__ ,7749HS1[>K_._O8>SA_*CE_P#A67AW_GSG_P# V?\ ^+H_ MX5EX=_Y\Y_\ P-G_ /BZZC-&:/;U?YW][#VP]G#^5'+ M_P#"LO#O_/G/_P"!L_\ \71_PK+P[_SYS_\ @;/_ /%UU&:,T>WJ_P [^]A[ M.'\J.7_X5EX=_P"?.?\ \#9__BZ/^%9>'?\ GSG_ / V?_XNNHS1FCV]7^=_ M>P]G#^5'+_\ "LO#O_/G/_X&S_\ Q='_ K+P[_SYS_^!L__ ,7749HS1[>K M_._O8>SA_*CE_P#A67AW_GSG_P# V?\ ^+H_X5EX=_Y\Y_\ P-G_ /BZZC-& M:/;U?YW][#VP]G#^5'+_P#"LO#O_/G/_P"!L_\ \71_ MPK+P[_SYS_\ @;/_ /%UU&:,T>WJ_P [^]A[.'\J.7_X5EX=_P"?.?\ \#9_ M_BZ/^%9>'?\ GSG_ / V?_XNNHS1FCV]7^=_>P]G#^5'+_\ "LO#O_/G/_X& MS_\ Q='_ K+P[_SYS_^!L__ ,7749HS1[>K_._O8>SA_*CE_P#A67AW_GSG M_P# V?\ ^+H_X5EX=_Y\Y_\ P-G_ /BZZC-&:/;U?YW][#V=_#__ )*A\4?^O^Q_]((:ZZ->K[.K[S^'N_YHF%2G#FA[ MJW_1FY_PK+P[_P ^<_\ X&S_ /Q='_"LO#O_ #YS_P#@;/\ _%UU&:,UR>WJ M_P [^]F_LX?RHY?_ (5EX=_Y\Y__ -G_P#BZ/\ A67AW_GSG_\ V?_ .+K MJ,T9H]O5_G?WL/9P_E1R_P#PK+P[_P ^<_\ X&S_ /Q='_"LO#O_ #YS_P#@ M;/\ _%UU&:,T>WJ_SO[V'LX?RHY?_A67AW_GSG_\#9__ (NC_A67AW_GSG_\ M#9__ (NNHS1FCV]7^=_>P]G#^5'+_P#"LO#O_/G/_P"!L_\ \71_PK+P[_SY MS_\ @;/_ /%UU&:,T>WJ_P [^]A[.'\J.7_X5EX=_P"?.?\ \#9__BZ/^%9> M'?\ GSG_ / V?_XNNHS1FCV]7^=_>P]G#^5'+_\ "LO#O_/G/_X&S_\ Q='_ M K+P[_SYS_^!L__ ,7749HS1[>K_._O8>SA_*CE_P#A67AW_GSG_P# V?\ M^+H_X5EX=_Y\Y_\ P-G_ /BZZC-&:/;U?YW][#VP]G# M^5'+_P#"LO#O_/G/_P"!L_\ \71_PK+P[_SYS_\ @;/_ /%UU&:,T>WJ_P [ M^]A[.'\J.7_X5EX=_P"?.?\ \#9__BZ/^%9>'?\ GSG_ / V?_XNNHS1FCV] M7^=_>P]G#^5'+_\ "LO#O_/G/_X&S_\ Q='_ K+P[_SYS_^!L__ ,7749HS M1[>K_._O8>SA_*CE_P#A67AW_GSG_P# V?\ ^+K6T3PWI_AU)5L(GB$I!??, M\F<=/O,<=>U:6:,U,JM22M*3:]1J$4[I"T4F:,UD6+129HS0 M%)FC- "T4F M:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M% M)FC- "T4F:* %HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ M HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** " MBBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH ** M** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHH MH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ M KSOX?\ _)4/BE_U_P!C_P"D$->B5YW\/_\ DJ'Q2_Z_['_T@AKKH?PZO^'_ M -NB85/BAZ_HST2BBBN0W"BBB@ HHHH **** "BBB@ HHHH **\Q\5_M._"? MP/XDDT#7OB#H&F:S$XCELY[U \+'M)CA#S_%BO14U*TDTX:@EU"]B8O/%TL@ M,1CQG?NZ;<@>+-(U;1],+ M+>W]M=HT%MA=QWOG"X7GD]*@^'/QN\ _%R2]C\&^+=*\1RV6/M$5C]#IS5VXO3?38.:+MKN=O16)X<\;:!XPGU2'1-7M-5DTNY:RO1:2 MB3[/./O1OCHP[CM7GWC?]JGX=_#KQHOAG7]1U"QO!/#:RW9TJY:RAFE ,:/< M"/RP6##^+C/.*<:52_V9/$WBKPZPAUYFAL+*X9 PMY)G"^9@\$JNXC/&<4 ?0U%?E'\1?@ M/X_^!W[*FB?M$:1\:O'%U\1D@LM7U**^U1IK">.X9/W0B(R0OF+D.65L'Y1D M8^E_A5^WW+XF^)O@+PAXI\+0Z)9>*_"$7B2S\0+>DI+(("\T7DF,;0&CF .\ M\*OK0!]BT5\2^&?V\OB%\1O@]-\0/"?PGTN>+H-/MQ;Q*#]H= MYD0?,QVA%).0W/%.^$O_ 4;?X@?#/XOZOJ/@NULO$_PYLC>W%CIVMQWMC?I M\V#%=1J5QE",C>.003T !]L45^:/QQ_; U3XZ?LE:IXF\6_!#7-(\ 2P6EW% MJ<'B5+7[;=?:TC$4++"SA "S;RHW;",#K7L/Q*_:F\=_!#P+X)_X1;X>>'[S MPI_PB]C>)J7B?QM::=(Y,()MXTFV-*ZJ%RX'S%N@/% 'V;17PMK?_!3V&W_9 MR\#_ !1TCX?3:C<>(-??P_<:))J8C:VG12Q,EH?D(60HNW<5<-E21P00"* /K M&BDS1F@!:*3-&: %HI,T9H 6BDS1F@!:*3-&: %HI,T9H 6BDS1F@!:*3-&: M %HI,T9H 6BDS1F@!:*3-&: %HI,T9H 6BDS6%X[\.77C#P;K.B66L77A^[U M"U>WBU2Q)$]JS#'F(000PZCD4TDW9B>QO45^<&H^"M7_ &>_VS_A=X0^'7Q' M\7>+KO52)O$VFZWJ1NU2#=\SR * 4WL-P)& 0>17':L?%W[1MY^T5\1+OX@ M>)M"G^'\TBZ!IVDW[06T0B:4X9!ZK%U4@EF))/2O967*5I*I[K2=[/J[+0XG MBK:*1HRY]VV MGW)KX!GN?&?QY\$?'7XU7/Q#\3Z-J_@[4MNAZ?IFH-#:01(^2A0?[!4#:1SD MG=FL*.!=2[E4S*QW 8Y^SD@$%07)QP*P=._:'\?? [X4?M M#^!H/%&I:O<^$M4@T_1-8OYC+=6L4UP\+8<\Y"J"/[I)(Q70LKJ-)-3M/'?B/Q%:?$:WA_MZPUF^ M:XA>27R\E%/3'G @G+ KUP2*_37-<.)PWU=Q:E=/KZ.S.BE5]I>ZLT+129HS M7$;BT4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +12 M9HS0 M%)FC- "T5\K_MI_#?1+VRC\;>+O&_Q"TKPU8VZ6*Z%X&E*F2=F<^S:/N>BOAO_@G7XO\ $]UKOQRB M\<^++OQ!<:-JZ1S7M]<,88]IG\QT5CMB0[&?$5[X;^&L7B)-$TB"RNWMY=5VG,]Y(%8'RR5"*&XQGH*BJ:J6WZ'ZGT5F:OK,>G>';[5(BMQ';VLEPI4Y#A4+<$?2OR5BOO'O MB_\ 9T\4?M*2_$KQ1;>,K#Q(L%K9P7Y6R2WWQ@IY7IF084';A<%3G-887!O$ MW;E;5+YO8TK5_96TON_DC]?:*_.'Q!XL\1_MB?M*^"?A]?\ BO6_"?A;_A#[ M;7+N#P_=&V>:YEMEE+$X(.&D0#(. #C!.:\DD_:@^)6D_LV:SX!7Q7J,FKVW MC1?#D?B!IV-X+,JY*"7.[[T?7.0IQG%=<#7KLW#17 CD8NG "_-$W0 M#AL'. :^_,UYV(H>PDK.Z:NF=-*I[1/2S3L+129HS7*;"T4F:,T +129HS0 MM%)FC- "T4F:,T +7G?P_P#^2H?%+_K_ +'_ -((:]#S7G?P_P#^2H?%'_K_ M +'_ -((:ZZ'\.K_ (?_ &Z)A4^*'K^C/1:*3-&:Y#<6BDS1F@!:*3-&: %H MI,T9H 6BDS1F@!:*3-&: /AK]O;0OA9I'AC5/">B^"-+U_XR^.[E&L4M+19M M260NN;AI,%XU 4@#(!YXP&(X?XW_ !'A^!7PT^%/[.WB_P 1W'AZQGT>*?Q9 MKUK%)/)]DW-FS@" MEV5D+8P% ]2*]R\9_\ !.GP-XT^)6M^.I?&_C_2M?U: M=YYI=+U:"$1[O^6:'[.6" 8 !8\ 5[G\+OA%I7PM\$V7AJ'4-3\20VC2%=0\ M13+=7C[V+8:0(N0,X'' KWUBZ-*G"*;G;7736UM&[Z+HK'G>QJ3G)VM?3Y?\ M$_-7]CNRL_BU^SM\=_A!X0O#'XIU61]4TRUE#HDEHC1*H:0C W':F"<_-D\9 MKM$C^('P5U]OB)<_#U?A_J2>%+7P)H>CK"?VA]?\ V7_"GB;PWX?\$67B'P[\/KFW M3QEKEUJ)BO+W4+IQY\D*;2#AR5!8G(4=*])_:4\-?$3X]:UX8B\+^ M42UL[ MZRU'3/$-SKUL=&D@)25I;FP:^C+.UAL+2"UMXQ%;PHL<<:C MA5 P /H!6%7%THRC6I1O/K>_9>?>_E8UA1FTX3?N]-OZ[$B!@BAB"V.2!QFG M4F:,UXIW"T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:, MT +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)F MC- "T4F:,T +129HS0 M%)FC- "T4F:* "BEHH 2BEHH 2BEHH 2BEHH 2BE MHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2BEHH 2O-/VC_ (&:7^T? M\'/$'@'5KAK*'4HU,-Y&NYK:=&#QR!>^& R,C(R,BO3** /SAU3]C+]J7XB? M#+1?@KXP\>^"X/A=IKPQR:KIZ3OJ5U:Q$&*,JR ': N 2O*C+-CGTG]L/]@C M5/B[\.OAKI/PLU33?#6N^"86TRUN]5GEB5[!H?+="\4;MN^4?PX.Y_6OM6B@ M#\_OC1_P3T\6W_PS^!.A^!Y_#&KM\/5/]H:#XG,W]F:G,Y1Y96"+EP7#Y! ) M5NO8Q_#;]@#XD>%](_:%BU&[\!V-Q\1M(%EIEGX<6XM;"RE^8E3$8?W40W # M:7/'2OT%HH ^+_&?[%_C?Q%_P3YT3X%6VJ: GBZQ2W62]EN)Q8'9+-,'P[\7:<_A6ST":V\;PW%W#IM_\;GO]'/A2X\/#25LUFE^ MW"4(@W%/*V;?E/._/M7T[10 E%+10 E%+10 E%+10 E%+10 E%+10 E%+10 ME%+10 E%+10 E%+10 E%+10 E%+10 E%+10 E6.G^ M*Y;5DTV[U($V\,QX#/A6.!R?NGG'!KI:*J+Y6F)JZL? _P #?V4?VD_@OXOO M]=AU[X:ZIJ6LWBS:SK6H27MSJ-Q$7!=%D: !1C. ,#.,]!@\=?L5?&+P_P"* M/BEI_P ,?$'AF+P/\2)"^HQZP94N;/E_:-;G M<[+7R[;?=T.3ZK#EY;O[SXU\+:%XM^%_Q9^#GP&\#>(Y;7P_X;T1]8\5W<5M M$WVM&E.U#O5BF^3'YOB/X/^'WB/PQ%\-O'E\+N\.J M&9;RS7?N**%0@]=N03N 'W:_0,1()#($42,,%P.2/3-/I+'U(.\4O.ZO=WO? MUOL-X:+5F_\ @*UK'Q=\1?V)?%?ABX^$GB;X1:SI47BSP!IRZ9Y>O*ZV]_&- MQ+'8"029) M_%_7OB;\,]7^+6N^&Y?#WPX@6#2;?1#*\UV4QY;2%T4#[J9/H@&WDFON:EHK MGKXB>(:<[:=M$:TZ4:2:0E%+17*:B44M% "44M% "44M% "44M% "44M% "4 M4M% "44M% "44M% "44M% '@?QMTW]HN'QH+_P"%.J^#I_#DMFD+Z7XDCD$D M,X+;I4:-1D$%>"Q''W:XK]G7]F/XD?L^_#/QY>V.M^'-4^*GBJ]6_)O5F&DP M.&)*G8H)(+">_-WL=905MB8T"\RG[Q)QWS63\=?^ M"6OA'6[#0%^%>FV'A^[BU!9-4?6-5O'6:UQRB<28;/LOUK[RHK?^T<0JGM8N MS\MGZHS^JTW'D:N?*/PX37;S]I35?AIX6U";3/@WX \/P:;=:4JI*MS=31DK M&9G5I/E1LG#?P#/6O%+K]@3XT6'A76OA)H_BOPROPDU76EU5KRX$O]HQ("/D MV!=I/RJ<9P2H^902*_19(DC9V1%5G.6(&"Q]33Z(X^I3=Z:73?75=?6]P>'C M)6D^_P!SZ>A\:_%']D3Q]X2^*_A7XC_!'5=$MM8TG0X] N+#Q%O$4L4<7E)( M"BG)V[<@XY4')Y%<@G_!-O6I_P!G+4/#UWXEL#\2[O71XD.I*'^QK=/!W[9/[1/A75/W.K:I>0:U9^9 MP9[8ECE?7'FI^OI7?AHQ<*LVKM1T^;2O\D<]5OFA&]DV>A^+_P!O[X'^!]8U M?2=6\6R1:II5Z;"ZM$TVY9TE!(;'[O#*"IRP)'3U%:OAW]MKX,^+OB)IG@K1 MO&=OJ.MZB%^RF""4P2.R[EC\W;M#D?PYZ\'GBODNV^#WB^70?VR!/X(UMI]; MNM^C!])F+:@/M$K VV4S+_"?DSV-/O?@_P"+X]._8U:#P3K:SZ',#K)CTJ8- MIX\^%O\ 2<)^ZZ,?GQWKT_J6$M;F=_5?R\W;OH/KFWUV1X? K,FOM]BG'V4J6!P"G[SE&^YNZ5G>)_P!L#X4>#_AUH'C; M4_%"PZ)KZE]*"VLS7%X <'9"$WX!X)( &1SR*^'M6TOQ]\.?$G[47@L?"SQ= MXAN/'4D\VF:AI&G--:B,M*PFMOR/H/XB?M@Z/XTM_ &I?#CXF6GAJRO?$']DZA;ZKH-Q++= MO^Z/V< PMY38?[_ ^8<\<=WX[_;R^"OPXU[7-#USQ7);ZSHUR+2[L4T^X>02 M=PI$>& QR0<#CGD5\Z_M$ZQX@_:.U+X3^(O#/PE\8Z-96'C2.2YDO]$DCN9H M56#-S*B*VR,8*AF8C"'D8P+7A[X3^)W^)W[85U>>#M7-KKFFSQZ1/-IDNR_8 MK+A;=BN)23MX3/:G]5P_)%SNK7TNK_$EJ[:Z,7M:O,^77SL^W:Y]1^*_VM/A M7X,^'&A^.=2\50KX?UP9TQX(9))KL]U2)5WY!X.0-IX.*J^&?VQ?A/XM^'?B M#QKIWB;?HOA\*=562TF6YL]S!5W0[-Y!)P"H(Z\\&OA;PY\)/'_PY\%_LV_$ M+4/ /B+6=/\ !T]ZNL>'H=.D.H6H:[D=)?L[@-R""#@#Y5R0"#6W/\(O'GQM MF_:5^(FD^!];\-:5XITF.VTC1]6M3;7M_(DD,C.(>N<0L>,Y9\ DYH> PRWG MI?>Z_FM:W>VMP^L57T^5GVO?[]#[COOVG/AUIT/@&6XUQT3QT5&@'[%.?M18 MJ!G"?N_OK]_;UKD?%7[>/P7\'>,KKPS?>*99;^SG^S71$ M(SG@XS@_2OC/2%\=_$FZ_9/?!WQ,U?_ (4GH'Q7\+^(-8UII-1\-:MHRRZ%,I=MTIG8 MA6B.>#)']UC\W'-0RZA>TI:Z]5;=VN[.VGE]PGBJEKI?AY?YGV%X\^-/C3X, M?M2^#]'U_5(M8^%_CS-IIQ:UCBETR]^7:AD5074EEQNR!X1')XKN?$D&IRQ6_/DQ1!?,?U"YW<^B'TK[3KR<1&*I4IVLVG? MY.R?]=CLI-\\X]$_T$HI:*X#I$HI:* $HI:* $HI:* $HI:* $HI:* $HI:* M $HI:* $HI:* $HI:* $HI:* $HI:* $HI:* $HI:* $HI:* $HI:* $HI:* M $HI:* $S1FBB@ S1FBB@ S1FBB@ S1FBB@ S1FBB@ S1FBB@ S1FBB@ S1F MBB@ S1FBB@ S1FBB@ S1FBB@ S1FBB@ S1FBB@ S1FBB@ S1FBB@ S1FBB@ MS1FBB@ S1FBB@ S1FBB@ S1FBB@ S1FBB@ S1FBB@ S1FBB@ S1FBB@ S1FB MB@ S1FBB@ S1FBB@ S1FBB@ S1FBB@ S1FBB@ S1FBB@ S1FBB@ S1FBB@ S M1FBB@ S1FBB@ S1FBB@ S1FBB@ S1FBB@ S1FBB@ S1FBB@ S1FBB@ S1FBB M@ S1FBB@ S1FBB@ S1FBB@ S1FBB@ S1FBB@ S1FBB@ S1FBB@ S1FBB@ S1 MFBB@ S1FBB@ S1FBB@ S1FBB@ S7G?P_/_%T/BC_ -?]C_Z00UZ)7G?P_P#^ M2H?%'_K_ +'_ -((:ZZ'\.K_ (?_ &Z)A4^*'K^C/1,T9HHKD-PS1FBB@ S1 MFBB@ S1FBB@ S7G7B_X!^$?&?Q+\/^/[J"ZL_%NAJ8[;4=/NF@9XR<^7*!Q( MG+###HQ%>BT5<9R@[Q=B7%2T:#-&:**@H,T9HHH ,T9HHH ,T9HHH ,T9HHH M \ZTSX">$=.^+]]\37@NK_Q?=6_V1;N]NFE2VA_N0H?EC&..!W/J<^BYHHJY M3E.W,[VT)45'8,T9HHJ"@S1FBB@ S1FBB@ S1FBB@ S1FBB@ S1FBB@ S1FB MB@ S1FBB@ S1FBB@ S1FBB@ S1FBB@ S1FBB@ S1FBB@ S1FBB@ S1FBB@ S M1FBB@ S1FBB@ S1110 44M% "44M% "44M% "44M% "44M% "44M% "44M% M"44M% "44M% "44M% "44M07T4\]G-';3_99V4A)M@?8?7:>#30$U%SC_.OQ_R,^9_RO\/\SJ** MY?\ X1_Q/_T-@_\ !;'_ (T?\(_XG_Z&P?\ @MC_ ,:/9Q_G7X_Y!S/^5_A_ MF=117+_\(_XG_P"AL'_@MC_QH_X1_P 3_P#0V#_P6Q_XT>SC_.OQ_P @YG_* M_P /\SJ**Y?_ (1_Q/\ ]#8/_!;'_C1_PC_B?_H;!_X+8_\ &CVSC_.O MQ_R#F?\ *_P_S.HHKE_^$?\ $_\ T-@_\%L?^-'_ C_ (G_ .AL'_@MC_QH M]G'^=?C_ )!S/^5_A_F=117+_P#"/^)_^AL'_@MC_P :/^$?\3_]#8/_ 6Q M_P"-'LX_SK\?\@YG_*_P_P SJ**Y?_A'_$__ $-@_P#!;'_C1_PC_B?_ *&P M?^"V/_&CVSC_.OQ_P @YG_*_P /\SJ**Y?_ (1_Q/\ ]#8/ M_!;'_C1_PC_B?_H;!_X+8_\ &CVSC_.OQ_R#F?\ *_P_S.HHKE_^$?\ M$_\ T-@_\%L?^-'_ C_ (G_ .AL'_@MC_QH]G'^=?C_ )!S/^5_A_F=117+ M_P#"/^)_^AL'_@MC_P :/^$?\3_]#8/_ 6Q_P"-'LX_SK\?\@YG_*_P_P S MJ**Y?_A'_$__ $-@_P#!;'_C1_PC_B?_ *&P?^"V/_&CVSC M_.OQ_P @YG_*_P /\SJ**Y?_ (1_Q/\ ]#8/_!;'_C1_PC_B?_H;!_X+8_\ M&CVSC_.OQ_R#F?\ *_P_S.HHKE_^$?\ $_\ T-@_\%L?^-'_ C_ (G_ M .AL'_@MC_QH]G'^=?C_ )!S/^5_A_F=117+_P#"/^)_^AL'_@MC_P :/^$? M\3_]#8/_ 6Q_P"-'LX_SK\?\@YG_*_P_P SJ**Y?_A'_$__ $-@_P#!;'_C M1_PC_B?_ *&P?^"V/_&CVSC_.OQ_P @YG_*_P /\SJ**Y?_ M (1_Q/\ ]#8/_!;'_C1_PC_B?_H;!_X+8_\ &CVSC_.OQ_R#F?\ *_P_ MS.HHKE_^$?\ $_\ T-@_\%L?^-'_ C_ (G_ .AL'_@MC_QH]G'^=?C_ )!S M/^5_A_F=117+_P#"/^)_^AL'_@MC_P :/^$?\3_]#8/_ 6Q_P"-'LX_SK\? M\@YG_*_P_P SJ**Y?_A'_$__ $-@_P#!;'_C1_PC_B?_ *&P?^"V/_&CVSC_.OQ_P @YG_*_P /\SJ**Y?_ (1_Q/\ ]#8/_!;'_C1_PC_B M?_H;!_X+8_\ &CVSC_.OQ_R#F?\ *_P_S.HHKE_^$?\ $_\ T-@_\%L? M^-'_ C_ (G_ .AL'_@MC_QH]G'^=?C_ )!S/^5_A_F=117+_P#"/^)_^AL' M_@MC_P :/^$?\3_]#8/_ 6Q_P"-'LX_SK\?\@YG_*_P_P SJ**Y?_A'_$__ M $-@_P#!;'_C1_PC_B?_ *&P?^"V/_&CVSC_.OQ_P @YG_* M_P /\SJ*\[^'_P#R5#XH_P#7_8_^D$-;G_"/^)_^AL'_ (+8_P#&N"\#:+X@ MD^(_Q)2/Q((I4OK(2R_8(SYI-E"0<9XP,#CTS771IQ]G5]]?#Y_S1\C"I)\T M/=>_EV?F>RT5R_\ PC_B?_H;!_X+8_\ &C_A'_$__0V#_P %L?\ C7)[./\ M.OQ_R-^9_P K_#_,ZBBN7_X1_P 3_P#0V#_P6Q_XT?\ "/\ B?\ Z&P?^"V/ M_&CVSC_.OQ_R#F?\K_#_ #.HHKE_^$?\3_\ 0V#_ ,%L?^-'_"/^)_\ MH;!_X+8_\:/9Q_G7X_Y!S/\ E?X?YG445R__ C_ (G_ .AL'_@MC_QH_P"$ M?\3_ /0V#_P6Q_XT>SC_ #K\?\@YG_*_P_S.HHKE_P#A'_$__0V#_P %L?\ MC1_PC_B?_H;!_P""V/\ QH]G'^=?C_D',_Y7^'^9U%%SC_.OQ_R#F?\K_#_ M #.HHKE_^$?\3_\ 0V#_ ,%L?^-'_"/^)_\ H;!_X+8_\:/9Q_G7X_Y!S/\ ME?X?YG445R__ C_ (G_ .AL'_@MC_QH_P"$?\3_ /0V#_P6Q_XT>SC_ #K\ M?\@YG_*_P_S.HHKE_P#A'_$__0V#_P %L?\ C1_PC_B?_H;!_P""V/\ QH]G M'^=?C_D',_Y7^'^9U%%=_#_ /Y*A\4O^O\ ML?\ T@AKKH?PZO\ A_\ ;HF%3XH>OZ,]$HHHKD-PHHHH **** "BBB@ HHHH M **** "BO+OVG?BG=?!;X#^,?&-@B/J.G6?^B"0943.PC0D=P&<''?%?!'[, MOQ!\,1_$KX>:_P#$WQE\6QX[UV<7-K?:JOD>';MY,JL*!\NZ?.HW* F<8P.O MHT,%*O2E53T7E=MVNPAHVV!\;E+*#\O/2O M9_V&_$D_B;X V,KZ#IFA6EM?W=K9C1K5K:SO(%E.VYBC8DJKDD]<9!(KFGA) M4Z'M9;WM;M_P?(UC64JG(NQ] 4445P'0%%%% !1110 4444 %%%% !1110 4 M444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !11 M10 4444 %%%% !1244 +1244 +1244 +1244 +1244 +1244 +1244 +1244 M +1244 +1244 +1244 +1244 +7C?[7_ ,6M;^!G[.?C/QQX<2T?6M(@BDMU MOHS)"2TR(=RAE)X8]Q7L=?/?[?\ X8UGQG^R)\1-&\/Z1?:[J]U:PK;Z?IML M]Q<3$7$1(2- 6;@$\#H#0!V7[/GQ3OOB)^SIX.\?^)3;P7VHZ*FIWYM(F6)3 ML+.57+'& >,DUSI_;:^#P^#:_%3_ (2>7_A!VU'^RAJ/]F76[[3_ '/*\O?^ M.W'O7SY^RQ\>/&QEC*LS! M@=N(K_P?J_\ PC)^'\%FNK7&F2_8_M'V:)6B$I79O^\"N<]1 MBOEKP_\ LK_%B[_95L)K3X?ZP^J^&_B1-K#>%M4LY+2>_M3#" T<4JJ9%RA' MR@Y!;&<&@#]*O@Y^V]\(/CQXQM_"G@_Q#=7OB*:T>]%A MXZ'G/%>\5^9/P$^(&O\ Q3_X*E2:[K_@B\\ Z@O@YHI-$O;A)YH$"(%9]H&P MMD84@$#'K7Z:T +1244 +1244 +1244 +1244 +1244 +1244 +1244 +124 M4 +1244 +1244 +1244 +1244 +1244 +7QY^TI\1OVF?A=:^,/'.C_\(-9> M - FWV]A=I+)?7EMN5?,?!VY);H'0X[9Z_85?G)^U[X_^)?Q?^*3>";_ .%/ MQ$D^$.C7W^EIX6;77C/#>=LV"$GIMSZ\G&WU,OASUK-)KK?MY>;.3$RY M8:-W\CW35OC!\9?BC\(/A_XR^'0\&^#[#6-,:]UK4_%TSK#9R;@J)&03PQW$ M%E/&WD=_/?A)^W!\0+OX/_&37/$VA:1XDU/P RQ6VJZ!O%AJ#EV0_-D[E7 < MLN,H>@ZUTGCCX\V$?PF\-Z'KO[-_CF\^'^J6+03:-#ICF?3_ ")=L44L&%V@ MA%=6+CCL:\-^$GPU^-,?P;^.]QX"\-Z[X&\-ZUM/ACPKJ;.MS'&9T@E[RM=K;FU5TV]O*UM3EE.2FN63>FOW=CJ_AA M^VM\6[KQE\*7U?4/!7C71_'UR8)-&\-QR"^TC#*&\SYCM*A@Q#;N%;D?>KZZ M_:;^-:_L^?!;Q#XV%FFH75DB1VMK(Q"23R.$0,1SM!.3CG -?G9\-?ACJUQ\ M0O@[-\)_A=X[^'OC/1WBB\8:OK%M-;:?*BE!*Q:1B#N DRN%R"!M)YKZ%^*O MB;Q/^W-^S?\ %K3/#GA1;.VT75Q;Z).MYYKZPUM+ND*J44+E0,#)R3C/%/$X M:BZU.224+^]LOM65[/M^&H4JL_9R3=Y=/N*/PX_:Q^,WA#XG?"W3?BS:^'+K MPY\2K=9M.DT:)XYK!GQY:OG@\NF1\W#<-D$5S_B;]M/XV^+!\3/'7P_L/#$' MPY\ WPM9[34XI'N[Y-^TN&!QT&X@%< C[QKGO"MAX\_:5^+/[/UA-\./$GA+ M3OAO;PC6M1URR>VA:2+R\B,L!G=Y*@#[V6/&!FN4NO#OQ&^!G@_XX_!A/ACX MG\0W/C34M^BZQI=B\UF\3/@LT@&/N!?H<[L8KI5"AS:QCSZ76EK]^$'A3X16&DV?BGQ]IJZI+=:X&D@L$^8%, M+UP8IA?L<_M'^*/B_?>.O!OCZRL+7QMX,OOLEW-I898+E"SKO" MDG!#(?8@@X'2OFWQ!\$_''[,/BW]GSXAIX2U7Q?9>%]#&F:[9:##]IN+>1C, MS85>H_TA@&^[E,$C(KUW]@GX?^*G\>?%WXJ^)O#E_P"%(?&.I"33M-U.(Q7 MA$DCEF0X('SJ 2.<''&*X\12PT<-)TTK='UOS;?<;TYU752E>_5=+6_S/LVB MDHKYL]06BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6BDHH 6O%/C MROQXO=9TZS^$;^$]-TP6KS7NI>(Q(S^<&^6*-4W<$_:O:J^1_V\/B[\ M5O#>EVO@OX9>!_$VIMK-L6U#Q+H>E37ILX2Q5HHO+4@2D G+$8!&.3D=F$A* MI648I?/8PK248-N_RW.E_8>_:2\2?M#>#O$H\7:=96GB#PYJ1TZXN--!%O<< M$[@"3@@@@X.#P1C.*ZGX\K\>+W6=.L_A&_A/3=,%J\U[J7B,2,_G!OEBC5-W M!'))3'OVKYS^%'QYT[]EO]F_4XM)^#/C/P_<:;=6D,4?BZV:QFUZ]N7VLRN4 M.6 0G !P H]ZZW]LWXT_&;2_!>A^%? _PZ\1MJNOZ3Q5Z<$HMNU[6V5W:_G?\#F55>QM)MM=MSD_"'_! M0SQ-;_LQ^._&'B;0M.F\9>&=6CT.$6FY;.[GDSM8C<3\NURP5N0!C&>-/X9_ MM0_&?PE\9O O@KXM6WAR[MO'VFB]TFYT>-XVLY74F..3/!Y 5A@XW ACR*\R MU#X37WQ*_8S\0?#CP/\ "3QMX1U/P_=6NM;_ !5I[6]QKL^6$Q3(&YPN3M'0 M!0*UO \'C?\ :;_:5^"^N3_#OQ%X-T3X>Z;&FJ7FNV;6R27*#)6(L!N!8( . MN,D@8KOE1P_+4:@DO>OW6BY;:]7_ )'.IU;QU?3YZZ_@;/[0'[0'[4W[.>@V M6K>);OX:3IJ-X+*QL=-@NYKJX<\_*AV@@#&3GN/6OMWPEK&J+\.])U7Q3%'9 MZP-,CN=3BA7"13>4&E &3P#GN>E?(FF^ ?%?[3/[;4OBOQ=X9UG1/AS\/UV: M'#K-A+:IJ%P&XE02*-X+@OD=DC!ZU[5KWQMO?$_[0^H_!72O#R7=DF@->ZOK MS797[%YJLJ((PAW$[D_B'WCZ5YN(A&<80C%RQDJ-^\'&?G4%@0 6^Z0#7 MJ/Q,_:Q^(GQ!^+OA3X;?!*#1+34=4T&+Q!=:IX@5W2*.2+S5C 7./E*Y.TY+ M#H 37RZGA?XH^$_V??$_[-O_ JOQ->^(=0\1K<6VL6]DS:&T\(V^@WA\.VQN)8;B*W6 M(Y Z F-""< @GN,5ZLZ&'4O=C&_O&OLRAQ9M*5+"&T"N"?*QNW;I"=N-VT9Q7NOP@MO%W[1_ M[;&D?%JY\":_X*\+>'-$^Q;O$%J;>2>X,;J50'[WS2L>,X"C."<5%:CA5"IR M)6]Z[ZIZ62^=QPJ5G*/,W?3[M;GWQ1245\F>R+1244 +1244 +1244 +1244 M +7G?P__ .2H?%+_ *_['_T@AKT.O._A_P#\E0^*/_7_ &/_ *00UUT/X=7_ M _^W1,*GQ0]?T9Z+1245R&XM%)10 M%)7!_''XQZ+\!OAGK'C/7M\EI8H!' M;1D"2YF8XCB3/=CW[#)[5<(RG)1BKMB;45=['>T5Q/PU^(%]XM^'.E>*/$VB MIX*EU"(7 T^[O5E:&-N4WN50!B.=N.,^N:Z^TO;>_MTN+6>.Y@<966)PRM]" M.*4HN+:?0$TU=$]%>'_%?]J/3?AE\4_AQX,ATH:ZWC&]>Q%];7JJMFRNBGQ*G&3 M:3V+=%0RWD$!8231QE5+D.X&%'4_2DMKVWO+5;FWGCGMV&Y9HW#(1Z@CBL[% MG&_&_P"%EI\:_A1XE\$WMPUI#J]J85N57<89 0R/COAE4X[U\A>'/V+?C#XM MU+X6>'_B/KGA5? WPYG$ME-HIG:]OU5E9%?>H4<(JYXP,\,>:^[+#5+/58FD MLKN"\C5MK/;RJX!]"0>M(=6LA?BQ-Y +TKN%MYJ^9CUVYSBNRCBJM"+A#UVV MTM=?(PG1A4?-(Y+XP>&_$6O^ M<@\$G2[+QE=6C6ECJ6IED2VW_*S[T1VR%) M( '7&<5\_>-/V/-=\,>%O@U+\,[C2)?$/PYN)+DV^N-(EOJ;RJ//=G0%@Y<% MAQWZC%?5:ZYISWYL5O[5KT=;83*9/^^N*FEB*E% M)1_X?2WY7^\U64[8S-*J!SZ#)YK@( M/BIKLOQNNO!#^!K^+P]#8_:U\7-<#[*[[5/E!-N54W M'T&3R:PLS4MT5')<10[?,D1-YPNY@,GVJM_;.G_9[BX^W6WD6[%)I?.7;&1U M#'. ?K19@7:*J7>K65A:"ZN;R"WMB 1-+*JH<]/F)Q7/?$'QCJ/AGP!J?B+P MYHJ^+[FS@-S'IUO=B$W*+RPC?:P+8R0,7*A1MK%3@C!P1R/K6!\._AWX?\ A5X0L?#' MABP&FZ-9!O)@\QI#EF+,69B68DDDDDFNDHJN9VY;Z"LKW"BBBI&%%%% !111 M0 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110!RWC?X9^'?B M-/H$OB&P.H?V'J":I8HTKJB7* A'95(#XRB%9+4****D M85RWASX9^'?"GBWQ+XGTVP,6N^(GB?4KQY7D:;RTV1@!B0J@?PK@5U-%4I-) MI/<32>X4445(PHHHH **** "BBB@ HHHH **** "BBB@ KSOX?\ _)4/BE_U M_P!C_P"D$->B5YW\/_\ DJ'Q2_Z_['_T@AKKH?PZO^'_ -NB85/BAZ_HST2B MBBN0W"BBB@ KXW_X*1;9M+^#MK?'_BGY_&EHNH!ON%<' ;VP7K[(KS/]HOX' M:;^T-\*=5\':A.;*6?;/97ZKN:UN4.8Y .,C.01GD$UUX2K&C7C.>R,:T'.F MXK<^=_\ @HEXO\+V=[\-/"6M>#]&\1WNK7DIL;OQ+J<]AI6GG"(TDS0LI8?, M.I &>>*^/? GB/Q)X!^%O[3VC^%-4L%L+460QX4O)I].BC>X,@?!B+Q-\,= \-_%VQT#X@ZEI2A/MMQIX>.4J-JR;9,[7*@!L M'!Y]<5T^D?"3P-X?74UTOP9X?TU=4A%O?BSTN"+[7$!@)+M0;UP2,-D5ZE'' MT\/25'EYK/OH[2O?7;3R.2>'E4G[2]OSVL?EEHFA?"?0_BQ^RP_PRNK*]UNY MEMYO$!@O'FF^U$Q'$REB(VW>8-H"\#ITKE-+T#4_C"/B;+XJUKX=Z+XW_MJ1 MI]9\PN+"< MW-I/#I%N)+>4XR\;[-RMP.0<\#TH\6_L_P#PS\>:V-8\1^ ?#FMZKQNO;[3( M997QTW,5RV/1LUNLV@GL_5[[M_=_D9_4Y-;KTZ;6/S^B^'6F_&_]L/X9>'O' M=Z/%5G??#VW>]N]/O)X8[]EAD(<2#RY"K$!N0,]Q7CUKKGB'P[^R%XR\.Z=J M%_;^$K?XB+I^H-#(V8K,QG*$CHK,JDCH3CUK]?K3X;^$K#7K/6[7PMHMMK5G M;"RMM1AT^%;B" # B20+N5 "1M!Q@]*AL/A7X*TK1]5TFR\(:#9Z5JKF34+& MWTR&."\<]6E0*!(3ZL#6<C=W^)3PC=W?5W_&Q^<*Q^'_A;^U/ M867[,]^E]I]WX+O)]2MM(OFOK=IUMYFB9R68;]PA.,\,0,#=BK7[)/A?]GS7 MOA5IGC3X@Z_#+\6EULW,TUUK$B:H;I9\PHD&_,@;"Y.PYW-DC''Z'>!/A!X' M^%[7+>$?".C>&WN>)Y-,L8X'E'8,R@$@>AX%9\GP ^&(1+Y MXU(Z7#YWFYSYF[;]_/.[K[U$LQA*+C[RVUOJ[7W\M?P*6%DG?3KIT6VQ^//Q M4U_PWXK\&7GC[PAX=\'> [B'Q#BWAC\07D_B>1]Q2"6V#!&%KZB MU7X7Z-\>/^"@-SH'BR2_FTV\\$VES=1V=X]LUP1#"=KLA!*DG)7N0/2OMYOV M;=M-HMO)YSYSE@R')SS]>:Z:U^'_ (7L?$O_ D5 MMX;TBW\0?9Q:?VM%8Q+=^2 (O-"[M@ VYQP*TJ9I%K]VFG9I.^JO;KY6(C M@VG[S6Z_"Y^CCT_PU8:_JSV5O%8IE4\I M_,3)$8B(YYW,W)YJ31K/PYI_[6?BNU\(7CZAX7A^%$R:;=2.7,D M%"'<0"> M.Y%?H%XY^"G@#XFWD%YXL\&:%XBNX %CN-2L(II%7^[N89V^V<5:M/A/X(L- M0:^MO!OA^WOFLO[--S%I<"RFUV[?(W!<^5M &S[N!C%9/,8M7UUC:U]%MJO6 MQ?U5^6][]3\?9_A=H6@?L6?#OXIZ>EW;>-O^$J:S&H+>2X2%7E*JD>[8F&0- ME0#DGGFO;_$MCX%^)/[67QD@^/VJQVUKI>BJ?#<.J:@UI$B&-2&@PRAGP0P4 M9W%FX-?H=)\&_ $OABW\-OX'\-OX=MIOM,&D-I%N;2*7G]XL.S8K-?[H9E)V_[/3VK66:QFVY)_:U3 MU2;35ONL0L&XK2W3T=DS\GY+C6_&_P"SE^SW8^)KB]N+!_'-QI]A/+*RS-9; MH% 1\[@ 3(%(/&..@KM[3]G/P6/C_P#M%> 4MM0C\):!X=DUC3],34[@1I=) M"C1R/\^92ID?'F;OO&OTXU+X9^#]8M-'M;_PIHE];:,ZR:9#L7%CI6FP_:"G[QHG4M]T#D_* , Y&/H#_@EG<3V&O?&7P]%?6%SH MVGZE UM#HUS)/IR%C,K-;-(2QC(5<,220 237V'J7P"^&FKZ#I^B7GP_\,S: M-I\K36>GG28!!;NQRS(@7:NX]<#GOFJOB+X3PZ'X/\26OPNTOPYX&\2ZS%Y; M:K!I:1 -R/,<1!3(RAFV[CP3^!FMCZ5:E*BDUS/J]%[U[_\ ##AAITYJ;=[? MY6/G[_@GJJ6_B3X^VFG?\B]#XSF^PA/]6"2^\+[8"?I7V17E?[-7P&L/V=?A M98^%+2Z.I7ID>[U'4F7:UW=/R[XYP. ,] *]4KR\74C5KRG#;_)6O\ ,ZZ, M7"FHO<****XS<**** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH M **** "BBB@ HHHH **** "BBB@ HHHH **2B@!:*2B@!:*2B@!:*2B@!:*2 MB@!:*2B@!:*2B@!:*2B@!:*2B@!:*2B@!:*2B@!:*2B@!:*2B@!:*2B@!:*2 MB@!:*2B@!:*2B@!:*2B@!:*2B@!:*2B@!:*2B@!:*2B@!:*2B@!:*2B@!:*2 MB@!:*2B@!:*2B@!:*2B@!:*2B@!:*2B@!:*2B@!:*2B@!:*2B@!:*2B@!:*2 MB@!:*2B@!:*2B@!:*2B@!:*2B@!:*2B@!:*2B@!:*2B@!:*2B@!:*2B@!:*2 MB@!:*2B@!:*2B@!:*2B@!:*2B@!:*2B@!:*2B@!:*2B@!:*2B@!:*2B@!:\[ M^'__ "5#XI?]?]C_ .D$->AUQWA#P[?Z5XZ\>:EZ_\ ;HF,TW*%N_Z,[*BDHKE-A:*2B@!:*2B@!:*2 MB@!:*2B@!:*2B@!:*2B@!:*2B@!:*2B@!:*2B@!:*2B@!:*2B@!:*2B@!:*2 MB@!:*2B@!:*2B@!:*2B@!:*2B@!:*2B@!:*2B@!:*2B@!:*2B@!:*2B@!:*2 MB@!:*2B@!:*2B@!:*2B@!:*2B@!:*2B@!:*** "BBB@ HHHH **** "BBB@ MHHHH **** "BBB@ K/UO7]-\-V$E[JE[#8VL:LS23/M&%4LV/7 !/'8&M"N' M^,?PDTCXV>!KSPMKDDR:?TB72H[ MW7-.M)-6NC9:>LUTBF[G&-O$&N+I/@;P_#< M:/X T*.31;K6;J:V;^T&G6X4VNRW<3M&EK%%RR_ZT@L22:EC\,>,_'-U+XG8 M^/\ 1+[5O&4-HMNUYJ%NMEI$^GH)<6Q8)&J2.W[S8"KI]X$4 ?8=9OA_Q'IO MBK3%U#2;R._LFDDA$T1RI>-VC=?J&5@?<5XI^RIJGB_QE9ZUXB\6W=RTED4\ M,6\!N"\$[V1:.YO0H.TM-,7^;KMC KP"3PU\0+""UTZ_U#Q+X,T0P:B^ESV& M@:O>O%?OJMVY^(M-T[6=-TFYO(X=2U( M2M:6S'YIA& TFW_=!!/UKY%\0Z1\:UT_QKHFFW7B1E\)VES-I6K9FWZT+V6. M10@WAI7MH/M*!-V5(- @DU)LW_ (?U:PAT MQGM(E*!]1DEE8.RY^]M#;@.'O$VO:OHNE:M;ZAJ>D.([Z" MEOL[G^%FQC<.XSD=\5\[?M#KXF/COQ-Y*^,CJ/\ 8]G_ ,(.?#OV[[&-0\R7 MSOM'V?\ <@Y\G=]I^3R]V.-U=+\$/ .O>"?A7\2)--MM4M/%E]JVMS64>JW= MS)&TGG3&VDC2=RJJQ93N4 .""2>M 'T)17PMX6TWX@?\(;?3:-XB\:77C22W MT];?2YM#UJSA@U<2Y,MW/>32Q/$07698\1E "!GRZR;_ %/Q#?SZKI-Y=_$X M>/4\*6DVF6$4VJ#R]=:\O!)+((?W A,BKM:7$1A4;?E' !]_T5\9>*O"WQ%@ M\.ZMK5QJ/BU)+CQM<6VJJ7U2[BAT==Y1K>RMIHY#"9?+R\&&V9&2F5K$TZU\ M7Z)XC\,3QZUXT\=Q,T<-M;2:1XBTAK*$W4Q-Q$SN\4PCC90T=X2SI"GS$. 0 M#[:U'7-.TBXL(+Z]M[2:_F^S6D*\)UJ'6+[X:_!N+1 M-3U71_ 1\+.EQ=:1IFJ7S1:IB(#SDTZ:*8.#Y^"^Y/,#9&[;0!]N45\S>.=; MU[5O#7@;2[ZT\=:MH>D7=O;^*KW2]-O-/O=45K O'+&D3"=H_.9/-6,Y5@5; MA6J]\!OC#;>&?@-9:EXC3Q'<6MI8ZMJTFJ:A'-=[;>"^D1('N'9BTY1D"H6+ M,$.#@4 ?1$DT<(7S'5-S!5W'&2>@'O5?5M6LM!TVYU'4KR"PL+:-I9[JYD$< M<2 9+,QX [FN!^,]Y!J7PDN9Y_"T/B.&[2$_P!DZKI]S=A=S*0SP6L$\K,F M=V$3@K]Y?O#QNVT&W3]F?XE:7?W?B_QV;BRF2VTG5O"&JJMK,\++#%907<+W M4B!]IW,\H0@',8XH ^B-6^)7A30;K1K?4?$6FV4^L[?[.CGN44W0)4*4R>02 MZ 'H2RCJ16S8:Q8ZK)>1V5Y!=/9S&VN%AD#&&4 ,4;'1@&4X//(KYM\0KCR]QZ886? M@)-X[\)_$FY\&ZE'>W6CP-?R7MQ-I30P&3= \5VET5 E>X>6Y9EW-MV@ +L. M0#Z5K$\5>-M"\$6UO<:[J<&F0W#O'$\Y(#LD3RL!]$C=OHIKYA^)7_"4'Q!\ M4A$/&_\ PL3?)_PAATX:D=*%G]D3;CR2+3?O\[=YQ#;]G^Q7GNN>#/$^N^%E M&F7?B?Q7:?;)'_LZX\-ZS;&PD.D:A&Y#7\LTCEW>)6"ML#E?XGY /O/3[^WU M6PMKVTE6>TN8EFAE3HZ, 58>Q!!JQ7R)\)+7Q-H7QI\-V]S:^(]9MYK2"*9; MN+5]/CT*--/0%"K?Z#'M>O88)=0\RVD?5+F:Z2-83O\R&&6-2B99%C0 MX&U<=G\-O &L^'?%VC>(](M_%]LE_P"/]02XBN[C4/(?29+>8QR2V\K;0&=8 MCYSKO+8RV>* /KJBOD7]J2_\8S?$R*/PY8>([&\T^'3I].O-*M-9O$U FZ_T MA +:9;2 (@^FFW%Y=P6OVB58(?/D">;(V= MJ+D\L<' ')Q7CG[,7B'Q)\0? NH>/O$;7=I<^(I%:TTPS&2*T@@C$(,2Y*_O M)%EER/O!TSG KYH/AK6=2BLHM>L?''B#1]&\0:9J-_XFMV\1VES,I>=)=UE( MV])4#(S/:Y0!AC:% !][:SK5AX=TNYU/5+V#3M/MD\R>ZN9!''&OJS'@"I+ M[4;73-/N+^[N(K:RMXFGEN)7"I'&HRS,3P "E=MXL\*_$&TM-7\1Z M;)XYD\03^)];LEB2]OY(ETTV-R8/+M]QC5/-$1215!W;=K=!0!]CV5Y!J-G! M=VLR7%K/&LL4T3!ED1AE6!'4$$'-35\9+X5^)#6MYXD@D\:?\)19Z]H,&GQ7 M%Y??9OLSV5HMV6MBWE/'O:;S'9#M8,200:V/V:M1U.+XO:+IE^OC6TU0^#9+ MCQ!!XHNKQX9]2%S KRQ)-(8\9,@#PJ$*G"D@8 !]3V&N:=JEYJ%I9WMO=76G MRK#=PQ2!GMW*!PK@?=)5E;![$&I8M3LY[^XL8[N"2]MT22:V20&2)6SL9ESD M [6P3UP?2OF7Q#X6\7^,/C?<:7J,GB^'P;-XID+M87M[9P&T&BH5 EA9=L)N M,CA@IDR.N:\7L/"_C[1K/7M0-OX[@\"ZN([P,J.J-,M MKM*JS+*2^Z,[WW$ _0NJ^H7]MI5A^#_ +K_BK7?#VFR^)?&FK^#9[G59IUM;77=!CML6L'E0F2XG-PZ&4.R[I- MNXNJ\ BN/TV3XF6T5A-=1>-O$/B6[\/"!X)HM;L+C2)5TUQYBLO^B7(:4*2K M 2^;)W*C !]U:3X@TS7T=],U&UU!8PAAK0KX7@ MTO6/AK%\0/&#_P#"7V/BW2QI/BC9=W6HK9:G:165J+V%R[?9FD8K.FQOG#!< M 5[O_9OCZQ_9;UF>UNM0N/B)J6FW.IA1,9)[>XG+2^1#N/RF-6\M%' *#% M'JGC'QQH/P^T?^U/$6J6^DV!E6!99S]^1ONHH&2S'G )X/I4/BSXC>%_ >C M6^K>(]?T_0].N&5()[^=8A*S#(5 W+,1S@<\&OD:/P#=>.?B+X871[3X@R_# MJSU_3IHWUBZUBVN(+G['>B[D#S.LZQY^R@L2$WLP4_,V?;?BL\G@WXX>!_&V MI:5J>J^%[+2=0TUY],T^;4)-.NI7@9)FAA5Y-KI&\9=5.,@' ;- 'I_A7XA> M&/'2%_#OB'3-=40I<%M.NTG C"8W /JC#L:R?#GQN^'OC#4[K3M#\ M<>'M6U&U1Y)[.SU.&2:-4)#L4#;@%(.3C Q7D7A'XAV&C_'KQ7KL_ACQC8Z/ MXBTC2XM/G3P;JCK)(DUV)/,\NW;R3F16/F[#AP2!S7FVB:-JWB[X2?#WP;8> M#O$EMXJ\.ZS/J-YJ&I:#=6,5C;K-<-(L<\T:"8S1N(PD)?(DR< 4 ?7>C?$/ MPOXCLM&O-*\0Z9J-IK(D;39[6[21+P1@F0Q$'#[0"3CI@YJOJ/Q3\'Z3X=;7 MKOQ-I4.BBY:S^W&[0Q-.K%&B5@?F<,K#:,G*GCBODSX/_"_Q+\./&OP?TZY\ M-:E)X(DT6XUBZ!L))%TJ\?31%=VLT84E?-?:ZH1EG>4 9XJ+3]-NA\,?"\&F MZ+XK\'6NC>/]3OSJEGX5O([O2;:62\:WEALY+?\ >Q2+(D;8C=460Y"G!4 ^ MQ1XX\.GPE_PE(UW3CX:^S_:_[7^U)]E\G&?,\W.W;[YK)T/XR>!_$UKIEUI/ MBG3-2MM2O&TZUFM9Q(DETJEC#N'"R;03M.">PKRKX-^,;_X7? C3[/6/!?B2 M]U*RTR_U8PZ=HL[27P6[.W,9R8[F?S5E\@_,,OP A X*^DBU/X$>.=>O(=4M M_'/B/Q!I]^+>]T&_TM;?43+;QV4%L+N")I?+$48:10=Q#DX!P #[$HI!TYZT MM !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 M %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 M4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1 M110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%% M% !1110 4444 %%%% !1110 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9HS2T M4 )FC-+10 F:,TM% "9HS2T4 )FN6^)_Q$L/A5X%U3Q1J-M=7UO8HNVSL4#7 M%S([JD<4:L0"[.RJ 2.3755YC\;/A;J_Q8E\(Z=:ZY)H&C:?JJZKJ%U9LGVQ MGA1C;+$LD4D9 E*NV\<;!@$] #+D_:I\!65YX4.JZO::#I7B30SKEGJ6K7<5 MM'MWQKY)W'_6?O3VVBOX=\5Z3'INKZ'82Z[J4EM<0V MM[/'.KRK%9LC%&\U2B; 5V8(R0)?"O[,'C7P]:6WA)VT*7PS!XAL=>&OB_F- M^XM;6")8C;^0%5G>'E_-(",W!/% 'L6D?&+X0>$?#%O'I?C7PCI^A02FWC%I MJEOY,;D>:5^5L X;>?9MQX.:Z/4_BEX7T_P[/K,>NZ7=VJ/-;QF/4(%6:XC1 MG:!7=P@D 1L@L,8). ":^?[G]EOQ)I'ASX;)90V.KW/A_P .S:!J6EVOB.^T M.&8RM$S31W%M&6<$QD,CH P;/48-B']DG5+35-6CL;G3+#PN_AZ:/3=#%S/, MMGK,UBME)*973#Q#I75 M+00PJTGE^6ZB4NKAN"=NW=\NXMQ7A%W^RO\ $WQ!J&EVFM:OIUU8:;)*(-0/ MB"],<=L^FRVJ01Z:(1 K(\F3,6+L,G(R5K9OOV>OB)K&I>"O$D]OX;M]7\*: M;IUK'I/]J3RV]]+:3NWS2_9@45T?W7_ ,?_ (9Z7I>G:E>? M$#PS:V&HHTEG<3:M B7"JVUBA+?,%;@XZ'KBKUY\8_ FGZ_/H=UXRT*WUB"! MKJ6QEU")98XEC\QG92V0!&"Y_P!GYNG->(Z#^S1XJ;6O%VNZK)H5O>>)=(UR MW>PMIY98K*XOGA,:*YB7>@6'+OM4EG.$(IWAGX$?$/PAXIAN-&_L:QTW[%MU M2UFUJXNK#6IUL!;IYEF]K^X8R)'NDBDY1.5)8@ 'N'CGXE:3X&^'&I>-I"^J M:-9V8O@VGLLAGB(!5HR2%8$$$'."*XCXB_&KPC\*O&ER]UH-Y=^)+O2;21)K M**(27:R7GV>WMM[NH!\V8GYB% 8DM71_$7X>WWQ&^".K^#YGL=)U34M(^R%K M16:T@GV#A!@,8PPP. =O;->;:K\*_'GC+6=8\1>)?"7@G4YI="@T"/PO>:K- M #V?P3XEU3Q-ILTVL>%]0\)WD4QB-GJ M$UO,9!@$2(\$CJ5.<4*OEO%(TR MA5YSN!@;.0!R.>M>7_!3PGXW^%?B*W\.OI%O:^'-7NKO4WLX=0N=0M-!MDBA MCBM8+B54+/+*7DV;0JC>%'&:V?B)\/?&T7Q$UOQ-X/M=$U5=>\/)H5S!K&H2 MV9M'CDF:.=2D$OF+B=@R?*?E&#R< &]X-_:*^'WC.'P]%!XITFRUO7+:"YMM M!N[^%;]?-B65(VB#DA]C X[]LUF>%?VIOAYXDUS4-%GU_3M%U6PL4U"X@O=3 MM&586\PDK)',ZMM6,LQ!PH9/;'PIJ/AR*XT.:#4M-TY9;R/5+F MW,-S97LURD?R0[S'*)%4R*RLGS$*V!D ^B+[X]_#K3_"B^))O&^@)HKS-;1W MKZE$L4DZC)B#%L;P.2O4#D\5S>D?%SPIX2^!FE_$+3O#\MGIWB)K>]@TC3EC M$MQ=WLB!%!++&&>209Z=J_C' M4-1$PN(;>-;K[7-;,XD06X7RPF"A^\#Q7H6F?"W6M#_9M\/^!+G0_#/C'4K' M3+6POM+UB>1--O @42 2>2[#IE28CR!D#J #)\:?%+P#XBF\.>$/C!X4@\-W MFLWUK'[0GP.\->"8;6/Q%X6O/ M#-M>6>D&QL+BU>VM3(^V'='N"K&I0MGH!&Q&=M<+X5_9]^(?@[4M%UK24T:T M^QZI?26OAN76[FYM]'M;FUCA_<7$D!:0K)&93%L1/G*J1C)YVP_9A^*DFIQ^ M(=4GTF^U^RM]+XO?%-_?#4KBTOUN9')EM]MFDBA@L<2%5)'!Y- 'TS;?&3P' M>:P^E0>,]!FU%+RD'IS2^'_C%X%\5P6LVC>,=# MU..ZN_L$#6NH1/YMSL,GDKAN7V N%')49Z&6\\:ZI%#%+=QRAH39I#Y1(,SQ>\OVU"_E@F*R6TMOB)$@D#D"8M\S)]T#OD>2Z+^P[H^F^$OAM9QZ M%X4TO7]*2Y@\1ZWI=FL5U>QS6-Q;OLF$0>0[YD;]X5^Z3U ! /9?AU\8+[XB MSV%S!X#\0:7X;U. W.GZ[?-:B*:/&49HEF,T8<%O#>O2:)81Z?9WFGZCRO+'<+NVFU>W62 J^QE<;^"K?*1U!JSJWQX^&V@ZC%8:EX_\ M-6%[+$LZ6]QJT".T;1^8KX+_ '2GS ]".17FV@_L[ZYIVK>'[RYFTAA8:MXD MOY@CNQ*ZB7,(7,8RP# /G&,<%JYWPE^RIXET3PO#IUY=Z)/^%[DNDLK*4 MTU(5G&3$#DF-MG'.1G;S0![]I'Q2\':_IT=_IOBG1[ZRDM);]9[>^C=#;1MM MEFR&^XC<,W13P<557XS^ 7\2VGAU?&N@/KUV56#3%U*$W$A9!(H6/=N.Y"&' M'(((S7@^K_LY_$'2=1\1WGA\>&]0?7[?Q#ITD=_J$]LMK#?W(GBF!6W?>R@$ M-'A1DC#&K[?LN^(I_"6KZ3)J&E0W%]KNB:D+F*23*0V=M:PR\^6#OS#(4'0A MADKDX /1?%/[3/@#0?#^I:K8>)=(U^/2[VTL]0CT_4H6-GY]PL'F2'=A55F) M)/'R,,Y%:K?&;P3KMG826FN:1J_A[4XKT2ZK#JEK]EB2! 9@^9 S \[ VWJ MVT$$^%G]F'QYX@L?"-EJJ>&=,B\(Z=8:/:O97DTPU.*&_M+B2:53 OE?):?+ M'\_SR-E@.3M>+?V8M>U[Q;X@U.2+0]6TO4+_ %>Z_LRZOKBU\Z.[L;6W1&DC MB)C;? Y++DJ"I&XY .ZT3]H_P"$&E:MX5\'Z)XJT%8;^WDATQ+&]@%M&(/* M00<.-KGS$"H!R :ZFQ^.?PZU+2-6U6U\=>';C3-((74+R/4X3%:DG"^8V["Y M/ SU/ S7A5K^S_\ %*=K2;5-5LM162WU;1O)OM:DN+K3+"\AMT5UN_LJFYDC M:%V"NJG#JOF';FHKO]G/XBZWJGA3Q!=VGA2PU/P99Z=9Z?I5KJ$[VFKBVEWL MT\AMU, Q@QJ$EV-DDF@#U;1OVIOAQK/C:?PZGBO18]T5H^GWC:G#Y>I-.TJA M(/F^9E:+:1^(?@;XS\=VWQ"U#4[?P]HVK>*+32(8+6VOIKF.W:TN9)7W MRFW0G*LI!"?>ST !/&W/[)'B6;2O$F@R6EAJ*S#6I-*\07OBS4L1/?+.!NTW MRFA1OWY1V5B"!N +' /?=*^/_PQ\0ZA::=IOQ \,ZC>WL[6MO:VVJP223R@ M E%4-EC@C@=&KR'+N&5-.9#,#B/@D*0@&0 M>Y6N3\,?LU?$#PA=^$UT>ZTW2+FUCM[?5]8LM;G:.\MH[B61H)+![8QRG9*R MI('C92Y.?E&0#UGPK^U/\*/%?A32_$$7CSP_IUGJ$?F1Q:CJMM#,A^7*,IDX M<;URN3C[\1Z5:SW"P-#%->QJT@G?9 5!/(D8%5Q]XC MS7BWP>^ GB/P]JGA9_%UEH,ECX=\,77AA?LEW)%/+#(CADR2, M@98$XYKX'>#/$?@KP/8WIT0^)M4UOQ%;Z592:O9NO]G:'9O(EM-*IY1EBC>1 M2<9DF7IF@#W;XI_%%?AE!H 30=1\27^MZDNEV=AICP)(TIBDDR6GDC0#;$W5 MO2O/--_:WL?$&H7%GH7P_P#%VN3V%FUWJD%HED)]/V7$UO)&Z/.;X->+?AM\0[O4OA?HWA2#0KKP_!I")J^IW,,EI,EQ/,TYC2WE^T;C/ MD[I49FSEN(P?L1>(K+P[JL=KXZGM]7LH=/BT!(?*%I(UF1<1276ZW M>6/==O.Y6%\!6 RV*])\">&OB5\&].O=$L]'\/:YX734+K5([\:E<+?10S2O M<2VZVJVS":0,[JC"10P*D@$8(!Z7\4?B%:?"OP%JWBF]LKK4;;3D1FM;+9YT MI9U157>RKG+#J0*Y'3OVE_!\$>KQ^+YC\.=2TFZBL[NP\3W-M$P>2+S8RDD4 MLD#O%7QQ_9MFT/5;:ST'Q3KEE;R7-KYTL45H_FI(T> M]075E4%>)]0L;O4W:$1Q2R M:B@FN7\LC[A8;A@9 &" >E/\:_A]'KFGZ*WCCP]_:^H>5]DL1J<)FG\Q0T11 M-V2'4@J1][(QG-0W/QX^&UEJ6HZ?<^/O#5O?:#?#O@*^T_PQ+X>\/Z];:K'K)U"9[C4(H[X7!$EL;;:DA0M MN/FL&<#H"2 #V.'XV?#ZXU*+3XO&_AZ6]EMOMD<*:G"Q>'R_,\P8;E?+^?/] MWYNG-)M&\.V]S>W%E:MJ&K6N+EH9"C,C)*RD< MD9W+D!@IXK3^(>N>!O#5II7B#QKJ&CZ;;6%R)+"^U>>.-(KAD908RY WE2P& M.<$X[UXQX/\ @C\0OAKXRD\5:99>&O$%Y?C4[:XT^]U2>VCM8[G4'NXY(Y1; M.6.'VR)L7.U<,<5Z)\6/!/BC5O%?@7Q7X7M=)U/4/#LEVLFEZO>26D$JW$(C M,B2I#*5="!CY.59QD9H O_#KXZ>%?B%X!L_%2:I8Z9:RV\5S-#[9JAX_\ VG_AA\-WO8-8\9Z.-0L;B&VNM.AOX#70N M"H4R*6SRJ\D=*\-TO]ESXFZ!X.NO#=L?"MW'K6G:3;ZC>RZEH:I^T7\/+6VU5=/\7:)K6JV.FS:FNE6.HP MO//''"9OD 8YRF&^A!Z5T$OQ*T#2_ 6G^+]=U*U\/:/=VT%P9]1G6)(_-52B M%B0"Q+ #J>E?-WCC]G7XL?$SQ+-?:U=:2B_:[RZMY'\3WTD%M#/I\UO':I9 M+;K!F-YN9S\[@$\9VUZ_X\^'_C.?X.>&?#OAB_AAU;3?L,=_%'J4VGB]@B0+ M-#'=QQM)!N(!#JF[ Q\N<@ L?$']IKX=?#_X?MXKF\6:)?6L]E->:;##J<(; M4O+!W+ =WS'=A>.C$ \\5T+_ !D\$6VJKI-YXKT:PUG[-]KDTZXOXDGBC\OS M"64MD83+'/\ "">G-?,6F?LI_$[PSX9\7Z?IR>%[ZX\6Z1?:3.=0UZ]D_LL2 MWEU<(Z3O;/)+- M2MEL;B6V,8#:>D30R%&)4/D90\C(P0#Z L?CI\.=4T75M8L_'?AV[TK22@O[ MV#5(7AMBWW-[AL+NZ#/4\#FB^^.GPYTS1=*U>[\=>';;2]5++8WDNIPK%0^)/V;_%3:_H.O:3)HD]SH6G:"D.G7,\L4-W/8/<&1'<1 M-L0K."C[6(91E0!4/@WX(_$;X?\ Q"U+Q]9Z=X7U?5O$/VQ;_0[C59X+?3!- M.DBF"<6KF7A?W@,:;FP1TH ]ELOCC\.]1N-8@MO''AZ:71T:74534H3]E16V ML\GS?*H;Y23P#P>:KWGQ_P#AO:BR5/'?ANXN+]7:Q@BUBVW795BF(R7P?G4I MG.-P(SD5\[:M^RM\4/&4VK2>(=2TF[O9]$U323J%UXBOKI+MKB>%XF6T: 0V M<:I%M*19).,[NM>L:I\,/&.A^._&%WX=TWP]J>B>+;*SM9Y=0OY;2?3/(A:$ MB.-+>02H00RKN3#%NQS0!V6F?'CP'>W.B:?<^+-#T[7=6B@DM]&FU:V>Z)F0 M/&H$_95\>>)/!FG^#Y7\.6FG>'K35+?3M56\F>?4S=DA?M$?D 0@*Q9\- M)N=5(P* /H'1/CY\-/$NIV>G:3X_\-:E?WKO';6UIJL$DDS(,L%4-DD $_09 MK4\&?%3P=\1IKV+PMXHTCQ#+9$?:4TV\CG:+.=I8*3@'!P>AP<=*\F\2_L^> M(M1UWQ!J.FWNDV4M]XLTK7K:5RY:**UM8X6##R\%]R,57."#R1DBH?V?_@MX M[\%_$.Y\4>-+FUN;F70(M(FG7Q%>:K+=W"3F1IPD\2);1MDXBB^5?UH ^A\T M9I:* $S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3 M-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* M$S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B M@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* $S1FE MHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3-&:6B@!,T9 MI:* $S1FEHH 3-&:6B@!,T4M% !1110 4444 %%%% !1110 4444 %%%% !1 M110 4444 %%%1S3QVZ!I9$B4L%#.P R3@#ZDD"@"2BJQU.S6ZDMC=P"XC3S' MA,@WJO\ >(SD#WJP"" 0<@T +114/VRW^UFU\^/[4$\WR-XW[,XW;>N,\9H MFHJ);J%YFA65&E7EHPP+#ZBGI(LB[D8,N2,J!7!=0>A*]0*L4 %%%% !14<\\5M&9)I$B0=6=@! M^9IZL'4,I!4C(([T +1110 45#=7EO8Q>;Y) [DU M%J6K6.C0+/J%Y;V,+.(Q)8 XWA?7;UQ[T MU=2M'BGE6ZA:.!BLKB08C(ZACG@CWH LT54?5[&*W@G>]MT@G($4C2J%D)Z! M3G!S[5;H **K_P!HV@N/(^U0^?G'E^8-V?3'6EM+^VOU=K6XBN51BCF)PP5A MU!QT/M0!/13=Z[PNX;B,[<\XJ&_U"UTJRFO+VYAL[2%=\L]Q($C1?5F/ 'UH M L45236].D2T=+^U9+P!K9EF4B<$9!3GYN#VJ[0 444UW6-2S,%4#)). !0 MZBF^:A95WKN8;@,\D>M.H ***0D*"2< =2: %HJ&TNX+^VCN+::.XMY5#)+$ MP9'!Z$$<$4V2_MH;J*UDN(DN903'"S@.X'4@=30!8HIJRH[,JNK,APP!R0?> ME)P* %HIL-:"XB-VJ[V@#C>%]2O7'O0!8HHHH * M**CGGBMHS)-(D2#JSL /S- $E%(K!U#*05(R".]+0 445#=WEO86[3W4\=M MN TDKA5&3@9)XY) _&@":BJNI:K9:+:-=:A>6]C;*0IFN95C0$G &YB!R:L@ M@@$'(/<4 +12$A022 !R2:I1:[ILPA,>H6L@FWF,K,IW[?O;>><=\=* +U%) MN&W=D;<9SVIHE0Q^8'4QXW;\\8](-XW[?7;UQ[T 3T5734+603E+F%A;DK-B0'RR!DAO3CUIAU6R%FEX M;RW%H^-L_FKY;9.!ALX.30!;HHJLVHVB3^0UU"LV<>69 &S]* +-%-5U8L P M)4X(!Z5";^V%X+0W,0NRN\0;QYA7UV]<>] %BBH;R\@T^UEN;J>.VMH5+R33 M.$1%'4DG@ >IJK#X@TNYM;.YBU*TEMKS'V:9)U*3YZ;"#AOPH T**BNKJ&RM MY;BXFC@@B4O)+*P544=22> />G&:,*C%UVN0%.>&STQZT /HHHH **** "BH M4O+>2ZEMDGC:YB57DA5P716SM)'4 X./7!IT\\=K"\TTB11(-S2.P55'J2>E M $E%4XM8L)G1([VVD=XQ*JK*I+(3@,.>A/&>F:N4 %%5[F_MK)X5N+B*!IFV M1B5PI=O1<]3["K% !1110 44A( ))P!4<%S#=)OAE29,XW1L&&?PH EHHHH M**KPZA:W#3K%X6WENX(YVC:81/(H8QKC<^,YVC(R>G(IKZQ8)9Q M7;7ULMK*0(YS,H1R>@#9P: +E%00W]MVZW%O/'/ V2)8G#*?Q'% $U%-$BM&'# H1G<#QCUS45G?6VH0>=:W$5S#D MCS(7#KD=1D4 3T4U'61 R,&4C(93D&HI;VWAGC@DGBCFD!9(VWGCN$5VC9HG# ,IPRG'<$$$=JFH ***AAO+>YEGBBGCEE@8) M*B."8V(! 8#H<$'![$4 345$]U#'.L+31K,_*QE@&/T%2T %%13W,-JH::5( M5)P#(P4$^G-.EE2&)I)'6.-069V. !ZDT /HJ*UNH;V!)[>:.XA<962)@RL/ M8C@U+0 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110!'//': MP2332+%%&I=WF7=[9ZO8ZBIU29H5C6"=)&*,L4AWE5*C@?>//KW5<]XW\1Z MKX9TI+G1_"VH>+;MY-GV+3Y[:%D&"2[-/+&H7C'!)R1QC) !\,>/-8\-_#N? MQC'HDOP^^)6I:BVOW2ZE':13>)-%F-O<2R?;4<2"6!"/(.\1C:T:E6'7H-6^ M/'Q0MM=\1MI7B/0+'5M'GFM[#P9?:C#'<7UJEF6A,%@+3S97D;;(KI<;3@KM M !%>U#]KGPQ+I]IK>G>&-:O=/;3(-5UF]CCMT;2+:29X4,X:4,Y#QRY$6_"Q MEAGC/H%C\1]"\5^._%7@\V>H6=YHNG0W%UJ-Q$UK&\,YE4&";(8@>4QWK@#C M#9!P ?)][^T-XHL8]6A\,?$VX\6Z/Y&A&^U[519VD>DFYEN5NG\Z.S*Q+F*) M"9(Y!$6.<8./0?V)='\63)X7DB@U/1-0COXV@&HOL22>. M&%'D4':Q6-1P.^:Z[X$>,_ABD7C35M(O-4@@M]1MM(NO$'C#4Y9VU#W-YXX@CW:I8%;*V\N!VV MCR[65V$;OO8#>0R '(?!&E>#TT74[;P_IVJZJ;74M;O+V M.QCM8_(D>-3<2V\Z0^9(JKN:,]=H*E@:\V_9HUS5=2^.FL7'BCXF6FLZM?Z% M8R6MGI5[9S6.KQI)>IYD3"WC>4QJBEVBVKO+9&W:!ZUXJ^/%]X3\,:1KFN_# MG7(]"O8;:2_N4N+-Q8?:)!&D;Q-,LDCC#/&]IXJUWQ%I$ MNFMIFL^';H6LUO*5;=#(H>&:-A_RSD7Z8*LI^[0!\N?&7X\ZU:_&B^T+2?$[ M6]FNJC0K[P[J.HV@DEBDL6=I8+);3SO*R5(G:X'S9 4KQ7OG[-7BG2M1^$O@ MW0K:]CFU?2_#.DSWEHH.Z%)K?]TQXQ\WE28Q_=-:_P 2OB:/AWK.@6PTA+QM M7=XC>37*VT415HPJ-(RE=[F7"*Q4$@C(KF_"_P"T1=:WXJUW1]4^'NN^%K;P M^$;6=6U;4-,%KIZ/#YRO(T=VQ*E.25!QGG'- 'E?A/5_A%HGB'QW<_%F3PW% M\1+?Q3 [+XG:-?ZNVO7SVL\4=W"9+BWECC620C992 ;947/V<#!Y%?47_"_?A9 M)HR>(&\>^%QIRS-:)?R:G %$H7/ R: //OC]XJO!^SU8Z;H=U<>*=9\ M81VFB6%Q:B*&:_%PH\V9 Q1$)@$TG)51["J/[+]_JFE_#'Q5X"_LJZT#6_!U MY<6-AIFH21230VDJF>Q#-$[H0$D"95B/W9]#7?>&?CYX1UGPJ=;U35[#PVB_ M;)'M]3O8HW2&WN7MWF.2/D+J.>F6 ZUUWA+QGH/CW1DU;PWK-CKNF.[1B[T^ M=9H]ZG#*2I.&!Z@\B@#X]\'^./@]X!^!&GZT)=+MOB]8:;(VHR6@M5\2P:BR M[;R2=ID=DPS.SO,K(% ." HJ#X9_%?Q]\1O&$/@]/B9(NG+J.I1_VUX?N;#5 M'FBCL+6>-!=-8QQOMDE<;EA!QE36-W;1S1F2! MHY&CW%48[48HQ4G&0,T ?,W@_P"/_B;Q)I@O_$/Q"/AW7[7PYIU]H7AZ-+*! M?$]U) S2'$L3/+OF40[("NWJ,$@C(\(?&/XD^)Y/"EM:?%C1IE\07^FVUX-+ MO[+4]2T^243&8& V,2VZG:%$Q326[75PD".<$X7+DY[[2!7IS1K:QSR0VX:0@N4C 5I&QZG R>F2: M /)_VD[_ ,):-\"/$6G>-M4TJ=+C2;B"U/B%K=6O;I8&*%$(56F+ ,!&HY^Z M!Q7SMX3^+WC+1M(T;3[?Q?<6_C2TOX-"C^'1MK8E--6R4B[\HQ>?N 'G>:7V M<;,=J^J/ OQ3L_B#X6UW6)]!OM(ET"_NK&[T_4/(DFCFMP"Y4QNZ'KP0U8E_ M^T1X=L/#7@OQ$=-NF3Q5ID^H68DDMX6ABBM3=,LTDDBHGRC&2VT'J0.: / + MK]ISQ%XLT?1(/"WCVUEOW\-^'VU*XLH+6Y:UU&YU*&"YWKL(638[ QG 7/W0 M:Z'7O'/CSP=XB\17\OQ US5['PWXNTC0AILMA8;;VVN+>V,[2>7;(QE+3,R[ M&0 @#&.*]A\:_M.?##X:Z?J$FK>*](M[VQ6.6ZTJ"^MVNHS(R#E-X!(\Q2>> MAST(STFG_&GP!JVN:=HUEXV\/WFK:C$L]G90:E"\MPC LK(H;+9 )&.H!(X% M 'Q/:?&W6_B+;7NG3^*E\1Z%<'P[K$$,VJ6E_=V,S:S ACG-M:6ZP2;2NZ#, MFTC[PR17T)^TEX;G\2?%GX2I'=W++;'5KR/3D@MIHKB:*UWH&6:&3D\ID8(# MG:0>:ZKQ)^U!\-?"XMOLWBG0M1A.KQ:9?R6>IP;-/:02'S9CNPJ@Q,"3WR.H M-=//\: /DI/CWX MUN-&T0>'OB=+KVI:QI^G3ZXYL[*4^'+^;4K2!K<(D0\O!/ EKXIU&YUKP9;^(+1?%=_J,<:K/:!),/=K$B1B'S_ ""^$5,= M1MS7>:G\>_A=X)/ MB+X>\-?#^\\9W6HQ7'ANWL_MWVRT(G2:(C*F/;G?NR N.I(]: /CSXU:Q\.M M-U2XU#X5+X5FLH?"^NO=?V%:VUQ8/'Y M]8O/%USJMEJU]XKT9]#O-/LFL88+2"\:W*J( S,# H.]F5@2"IKZ0\%?%&;4 MK^TTW7?!NH^ 3>KG2UUBZL<7C8+&)%AG,OVE?$ M^D>-YXO#WBTVB0&]TV;0;Z]LFGB:'2Y9EGBL$LQ)'#YD:,DLDYW9(V%2,?6D MWQQ^&D'AVW\4R^-_#<>C3RM9Q:H^HPB)Y!RT0E 'S]K_Q*^(/A:RG MT^7XG*QO-'T+6FOO$$^GZ8ZM3$76)=GFHV""-P+ CW_X"_%O M2/B%X0T6WCU:_O==;35U":#5UA^V&!II(DE,88 ,.M:P^.7PT MOM*U*\/CKPS+IMBZ0WEP^J0>3"SDA [%L#<00,]2#C.*M>%/C-X \<:I%I?A MSQGH&N:C);FZCL].U&*:5H@<%PJL3@'&?2@#YJ^*OB#X?>*_CYG6,D,R. LRJT0W1AL.P;RV! KZ@^#NLQWDL- ME_;MZ9H?#VE2OX5OXE:;2 T38:68(&>23&"&/!CR ,FK>C_&OPYXJ\:>&_#M ME9ZA=/K>BMXAL=0DLRMH8%\K&)&ZOB=#A<[>:C\2];M[.X\ M-MI.I+#K^I:XAM5D:*UB82_O6^2)8F7!(4<$XYR0#S_QA\/? OCK]HF&1?"V M@6T/@^/^W_$>O+IT*7$]W(C"V@DG"[R F^9P3T$6>#7"> =7\%Z!X[^*FH>$ M/%WACP[X:.F:48?$W@2R@_LVP3[5(J6\T0\R.2Z8, 9,_<=?D3 )^FOB;\3K M/X;>"1XD^P76OQ2W%I:VUKICQ>920QXD( ^4,F?O<9%W^T=82^$?!&KZ)X9UGQ M!?>+K%]2L-&MC!% O$,@N=55EE9E?2IFC4EI6E+[!;A=XX9<<=)K?[3>O6]FNC MVWBVV3Q=:ZIXJ2_TP1VYNK>WMH+R2R\R+;E D#*Q W@.?B9HW@7P=#X MF2&36H=0EM;>PBTHQN^H2W#JD"QNS*A#%UPS,% YSB@#YU>PT34]6\37%E9+-HZ7*7?F^64MQ''&\D$"!I$?9O)SDYKM+7QGJ M'CO]BCXE:GJ&N3^(W6T\0VEOJEU#'%)/;Q27$<+,L<<:YV*O(49ZUO\ Q'^/ MGA&]^#^N:MXFM_%/A^\T?4)+*YT+1[YK?5A=PIYK1QO;3 .GE'S"V_9LY;&# MC:LO'NE_!>#POX?LO ^N6G@V_NK:T@\0-=03Q_:KQMRF0/.UPY:1\/(5/S,3 MR,F@#S/1]9UKX=_&#P+KWQ%\5Z#<:+9^ M1N%N=-T6?3Q:1"6PW&4O=7'F=5 MY4)T/!SQZ9^U-X]\0> O"7A^70[ZWT6WU#6H;+4M9NKI+2*QMVCD;$;OQ!J,%S=Q0O%#':V:JTUQ-+(L442;BJ[F M=U7+$ 9R2!7F]W^TS MK!8GP+KUSXIEUP^'IO#*RV0GBN/LK708R/.(6C:%= MP8/SG&,Y% 'E'[/WB#5=3_:"^U>)_BC9ZK>7OA^);"#2-1LKFRU=([R]78LG MV:-II(DV%S"$^;)/RX G^,?QUUK2/C[;Z#H_B=]/BM]:TO2+S0=1U&T0W<-R M$\R2VL_LC3R)B09F-P@5U( (!!]D\2_&BY\$G0;G7/AQKNF:1<2VMI-J33V$ MB:=-<2B&.-DCN&=L,R!C&& ##!;!QZ#XN\1:?X)\-:OXDU%3]ETRSDNIVC4& M0QHI8@>IXX&>M 'EO[*/B[1[CX.> O#4=_&^NVWAFROYK$ [T@?K_"+1/$/CNY^+,GAN+XB6_BFYN%;Q"L7]H_9UE#:>UIO_>&(1"/; MY7 (?ONKT_2OVI?#UQXI\%^'M0LYK/4/$Z71BF@E6:VLY(6 \F=SL9)&R !L MQNXSR"7_ Y_:;\(?$ZXNKJUMI-,LK*:_B;4M7GM;<"*V6%FG56E\PPNDZ,' M"X ^_MRN0#Y_^"?B?7?!_C/5_$OB6PU3P'9?$[1K_5VUZ^>UGBCNX3)<6\L< M:R2$;+*0#;*BY^S@8/(KWOXX>-;W2?V$-:\47'AO3_$^DWOB"W4M+ID%[&]P@&-V4 M!SQN7/ID9ZB@#Q[]D>6[\*^&O%GPVGT:\\.7'A6^9M,TS4IH99HM/N09K?+0 MR2(0'\Y.&/"#.#Q7EO@3QC\)/ WP9_MK6SI:?&K3(+ZYU/RDMF\3IJ:K+]HD M E5G&!N(9U,>S;P5P*^RM2K%%$OJS,0 /K M7GEG^T;\,M1\=Z+XJZY:23V4\%W R3A)5B,(;?N,A=CA,9^1O2@# MYL^&GQ>\>?$#QU9>#(?B8[Z7/KGD?VSH-[8:M,8#IYTFV5;&V/B>\^T7$4@;SH6WDF*%# M'!L(,I/!*X^I-=^*/@KP;K^G>'=7\3Z-HVL7H06FFW5Y'#+*&8JFU"0?F8%1 MZD8&31\./&]G\3_"T&OPV+6J"[NK9(Y\,RM!/) S CIDQD_0T ?&WA;XX?$[ MQ%IV@21?$_1([S6[C3+?4+&SO[34-2TN>:\BCE M#91?9U"O)&4E,A#*O).X MGZ3_ &B[OPIH'P"\0:7XYUG3+X3:1<06TGB0VRR7]VL#%"J;41IBP# 1H.?N M@<5K7_QKT7PY\3-<\,:OISZ#:Z=ID.KW?B2_N;6"P\J20Q1[F,N\$NK+\RCI MUY&:>K_M-_"JTF\,B3QAH=]:ZY?S6-G?0W]O);QSQ1EV#N7PI^Z!C)RZ#^(4 M ?/GASXL>+-!&CZ6/%T^F^*M.U#1M$L/AXT%MF\TY[6W\ZY,;1FX8C?._F*X M1?(VD<,#7N_VI?$VN>"="CT'QS:R^(D\'0W.L&V@MII+34SJ%E YFCV81PLL MP,1 QGH.#7U3\2_B3!\-;GP[/=:!?:G:ZKJ,&DG4+-H-MG)/*D5%M\V>625T1$!=!D MDDE@ #S@ \'\6>+?'_@[Q)XNF_X6-K6I6WA/6/#]E'9SV&GA+Y+QH1<>=Y=L MK9(E;;L*;<#K7DNI_''6OB+H_BO3V\4G6] OM'@U9-/N]2M+R]T^9-8LXU2= M+>TA%J^V4@PL\I&T9((.?L_3?C?X6-_I6C:_J-KX/\6:A@1^&=:OK9;X,695 M&V.1U;<5.TJQW#IZ59T/XS_#K7;C4[?2/&WAN^ET^%KR^6SU.!_L\0.'EDVM M\JCNQZ=Z /-_VFO"S>+O'?P&W/[0?C>+PK976B?$5]5\1:CI37&O:8;.SD'A:[%]:PI&(UB#1_Z MV:+RYRQ;9N!R":^L%_:%^&#Z7;ZDOQ"\,G3[B9K>*Y&JP;'D4 LH.[J RD^@ M92>"*WM*\>>$M5\2WF@Z;XAT:[\00J9+G3+6]B>Z0 +EGC5MP WIR1_$OJ* M/)_VD-,N-&^#_A^TU_5;[Q!X=@UVP_X2G4+N*-7GTWSLS&98(T01 F,.%4#R MPV[(R3XO\:]6^&-C?0:A\*!X2FC@T#Q%)>GP];VL]DTRZ>AC$B(K0R';C*L# MQ@,,8KZ[\?\ BS5?"&DI=:3X2U+Q=,6;S+;3KBUA,2!22[-/+&,<8 7))(X MR1Y?:_M9^%Y;73;S2?#VL7/AU[/3[W4=3BC@CBTE+Y]MN)D:0.QSRWEJVT.$M[;6)_%UU=Z==>)]4\-'P_+860L4M([&>2/ 6 2%U:)>2Y!& M05.:Q/ 7Q:N];^&6N+X@^(<'AO6-/\/)'I'@5+338;;4;%8X);Z[U* V\#)*)"'C9B"R 1 M-E\!3V)K)^'OQ\\'_$?3-1UJ&1M&LK+6!H<%WK:I:F[E=8VB,.YLE91*FP'# M-D?+TH ^7+W]H[Q'IWBWPW::)XI%@(GLM+N_#UY>6,;,KZ8)3-;:>EGY@A#% M")FG W J$*X%:TGQ1^(NB>%M.\_XGH;C7/".D^()+[Q$]AIR6\TMRJ3PV\XM MO+B,D9VJ94&!YXGMEMVO3()"B0- M*R!@3&P#,53)X;&37$W7[3Z017FG7OP^\0+XFAUFUT)_#XGL9'DEN8'GB83? M:/)VE$;(+@@XXY!(!L?L^?%_2?'WA/1[)M8U"]\02VD]Z8M7-N]U);QW+P&; MS+9%@DCWKM61 Z[6[DUY)\6_$/PW\2?M&:7H.CWWA'PYX]T*\34=0U>YN+: MUU6\NFMFCM;"#<1+,7$B%\94*JKRS87V/5?CQ:^&'MX-8\.ZAHLUMHUSKVKV MT\L$C:390Y"F0PNZ.TC*0BHQSM8DC;BL=/VG;>WTS5;K5?!VM:%-I,5GJ-]: M7TENTL>F7+,JWJ^5)(K*A1MZ9#*%;@\9 /G+X6^(_ACX4TO3M5U2'1KCPY8? M#W/C^ V\#[-:,48PK-Y*S-QC,DDFS.03]JZUXXMK"WU5?#>GC MQ?KED\/VK1M(N[5+F,RC*/*99$5 4^;+') X!KSS4/VEHO\ A73^,$^'WB&_ MT:P:[&M@26(;2FM93'.KJUP/-92C,/*W A>N2 0"']F#5+\^%/"6F:QXGN9] M7C\(:=/-X:N+90]HI+A;EY=N_=( %VLW_+,D#J:S?'GPX\(?$C]HW0-.M?"N MB?VCH+0^)?$&O1Z="+QI%)6QMC.%WY9T,AY^["HZ-6CI_P <_!NF?$K5;J#P M]J-O9ZI?PZ)>^,9&C^R/>1VQFCMRK2^8JK&Q&X1A=[$'DDUWWPM^)[_%*PFU M6V\.:CI&A2*DNGW^H209OHVR1(L22,\8(VL!(%8AQP.0 #PKX;^-/!VDR?M$ MQ:)\0[+04M=;6\?6+>\34YK%#96JO.5D,FY1('3Y@0""O&, ^+T_@:X^/GPZ MFT>Z\):AXLB\16HU.PTV")/$KN86"SO*I+BV2,AI$9 &4#YP/E/OEQ\4=.MO MBK8^ 6L=2&J7>FSZFEXUL5M/+B:-642G 9\RKPN<=\<9S/!?QI\-^/\ XE>) M?"VC07-Q=Z#;Q23:J85%K/ODDC9(9,Y?8\3JQ V[@0"2#@ WK3Q/8?$#P,^K M>%Y+/Q!9WD4BVK2RM#!.RLR,"_EN5 96&=AY'2OC+XA^$M%^#MW+J'B._P#A MWXN\06VEL)_ /BO$UW+&]W/.ATV9E!:>0R[&Q 0[HGW>*^]*CDMXI9(W>-'> M,Y1F4$J?8]J /S\^+OQYUKQ'J/C+1++Q%+'HU_8>(=,N_#&IZC:27MG]GL)W M1OL<5HLEO'OB^1Y+ARZMRO(([+Q9XS\6>"M7A\.W'B27Q+#8W^@WUG=ZSIUE M)-;-/:WI=8]D"JH#0(5;;O7+#<0:^TEB1'=U15=\;F Y..F:?0!\O?![XL:U MX7O--O?'OCJZUC1=2\#6'B6ZN-4M;:,6EU)*(V6(6\*'8V]0%.XY P>37I7[ M2?Q2U#X5_#1=3TB6PL]0O]0M=,AU#5YO(L['SG"F>>0JP15&<%E(W%<@CBO0 MO$?A?2_%MA%9:O:+>VD=S#=K"[,%\V*19(V(!&<.JG!R#CD&M*6))HVCD19$ M8896&01[B@#XKT>_\2_$;XD>!O#&O_%F'^S[J^N_$FF7.B:I87KW*6\<4,<* MS-8Q1SL+AYI-J1':J'))"E>@_:7^/6L1^,9?!?@3Q.^B^*M-N+*Q^SMJ=I!) M=W-VT?E,EK):3R7"1JVYR&A3!8;B1\OUG]GBW1MY2;HQA#M&5'MZ4HB02&0( MHD( +XY([#- 'AW[-/B?3?&FK>/O$(OX[K7-6U!+IH0"'BTU=]O8MTQMD%M/ M*,?\]#4'[3+Z-'XI^&$GC;[-_P *V74[G^V#J0']GK//&NI^)_A[/KWC"^\0VWBW1-4 MO;FQN[6UBAM9;:XA6(P^3"C#Y9&#;V;/!XQ7T_'&L2*B*$11@*HP /:G4 ?* M^O3?#"#XY?$L?&K_ (1T321V0T#_ (2U83$VF_9UWK:>;P6^T>;O$?S9*9_A MKR7Q7^T]XJL]=\0'PCXT>*Q>QUI(=+O;VRN[W3)+5U6%VLTLT-LO#;!++*74 M@L,\U]_201S,ADC1RAW(64':?4>AI4B1&=E159SEB!@L?>@#Y"\1?$OQ9X,\ M=7W@S6_B5?Z=X737+.*\\9W\%C%0((U>= JN\>0&V@Y*D<_+ M\UNC?:8K9+'_2))2SE)(I43=' MC: &S]NRQ)/&T(R))Y2>8@*HVT94>@/:@#R3X5SZ]J7 M[.=IK/B3Q)=^)M6UC05U&:XN;:W@6(R6H8QQK#&@V DGYMS9)YQ@#XV\ ZWK M7P4\%Z;KEAHVB>!]:U#P1ID>E3:/&%MM7@::$W=_&O%&F3ZM/$L$#+''//9 M);W#QNTA\E41V$D0W'!!^R/!GC72?&6FW,FFWS7N0.QJ:@#\]_%NO?#/QS+X_USX>WO MA/1M'M;*#2;O1-#GMH[[5;-=2ADU"]N;6(AQ"D8D0%UW%7E8X5AFPLOP\'Q4 MOKC4SX=_X42=6U4:<\HA_L,WW]F68/E?\LLEA=A=O\?F8^;-??Y&1@]*C^R0 M>2L/DQ^2N,1[1M&.1Q0!^:OA8W:ZMX8FUJ6P;78I/"*-H^K+CQ'4^)O$7AS49/'D. MK>.HIM#71;:XGT_SEM(--AD$FV?[6FUL38'5^ @Q@$Y^6_%)\1^/?V&O"T?A M9M+UWP)I_@N1M:^RZUY,S7<5N-D3E4?BZMJ^ MIV=HL-_J\LQL&L]+M]+T^\L;Y%NX8;%;*WFBA4.H#J\\TAY #-C/W>.&L#\)KOX!>(IK MCQ/\(K*_UG4;_4],T[49;+4]-T4R1QA[2 )*%$_EA&;RS]^0D*Z]?LF'P3I5 MMXUN/%4$,D&L75FECHVEU>^#I-2^&UT-6GO@)[FS@M8K=K>XG#*!(\+2R M8++SN88QQ6A\3/ G@WXR^*OAYX;&D:+XHUK4+2VUS6/%TVE0?;#I<&PQL) F MZ,W$NQ0%QA?-QC%?0%GX)TJR\8ZCXI6*236[ZVBLWN)96<1P(2RQQJ3A%+,6 M.!\QP3G QO4 ? WPU\?^'_!VJ:M#O$"ZDNO3>-8Y=%W:QI$<,Q*B\D: M60R0.!%&D;1HI'E;00#5[0=-O?&_PI\63?#*3PC=>%M?U*XU37O#7AKQ#!%_ M9=K]E1(+3?;+(B/+Y9DF"XSED4\EJ^Z%B1)'D5%#OC%[7X>?\(E;?VM?:CK;L\<0M\$-;-:>4T94*6+3+@,V0=O/C MWA#1M9UYOB=I/POB\+:SX9O=6M7U6_\ "-X-*TR>S^R'_1;3RUF5)OE19Y%9 MB0XQL) 7[GZTR*&.WC"1(L:#HJ# 'X4 >%_L@^*[1/@;\,O#5Z;?3]??PVM[ M!IL4QE+6D3)%YH;: !F2,$=BV.>M]8NL^+VU'P+R(O+<[F38,$YSDCUH ^9OVPOC%J/P]@TNQT/Q7)X9U1])OM4@O+K4 M[.PL[IH0FV/=-:7#3S$L"L$83<"V6'!&C^SI\0;&?QIXR_MB]AM]:\3ZK8O: MV^TC[1,-#M9Y50=L(KMSV%?1;Q)(4+(K%#E21G:?44^@#Y3_ &GO$'A_PU\= M/".I"YT:U\7V7A'Q%&P@:P:>\>.202#]UTV2-)HV M215=&&&5AD$>XH ^>/VN]3\'7?[.>I:5J^KZ1K6JZAIP;0!J$EO)1ZXG_"1B\&;-4^S2_9S=9^7R M1<>5G?\ +G;NXKW=K:%S&6B0F+[A*CY/IZ5(RAU*L RD8((X(H ^'?CC\ZS+<>*M5T.W\+-9VHLVBBLIYH54I")C)YD2#<9#D$C'. M:^PTM88UB588U$7^K 4#9VX]*EH ^(-3^..KPZ!X(.C?&JWUQ=< D\0ZC?ZG MING1:-_!_XE^*;[7M9U?QM\2;.?PUX M7\.V&HWCZ%';3Z;>F1;KS+@W'V<2,FV)&_=[!N!Q\ORGZ<-G;M'*A@C*2G=( MI08<^I'>I0 H P!T H ALKV#4;."[MI!-;SQK+%(O1E89!'U!J;-+10 F:, MTM% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9JO;:?:64 MMQ+;VT,$MP_F3/%&%,K8QN8@-;[3-5TK1]&\*^']*\3^'[+PYJ5G;ZO<3)I$5M++MD MMV-HAN=T,I&UQ%AP.6!)KM-2^#&N^+_B?XU;Q%I^E?\ " ^(=!M="+6.MW"Z MB4@>=]QC%LBKO\[:0)C@+U;=@>X[J-U 'SGHWP>UCX*W/BZXT:TE\9?\)1XA MTM+"UU>\N+]+.W2.&.2>XWCY3&(Y&# G[L0R. /1OVA_!OB/XB?"37O#'A># M2Y=2U6+[-OU>]DM88D)R7W1PRECP/EVC.>HQSZ-NHW4 >$?%;X<>.OBA>^%X M'\.>%-*FTVZM+V+Q3%K,\M_I+JZ-2SQ3JH1R4\MRC[LG[S*<'J/K+=1NH ^? M?BAX;\3?M!>&_#VU?P_NSX9@\2ZQ\7/&_BK0["WAL>K00^L"6 75O;22O>3Q *2Q'VADC) 5 MFC/(7FO:=U&Z@#!\5^!=)\:_8UU=+N>&UE65;:*^GAAE965E\V-'"R@,BD!P M1Q[G/GVL?"WQ?'=_&/4?#^L66EZKXK@M1HUUN8M;2Q6HA)E^0A?F'!7?@'., MC%>O[J-U 'RW\,OV:?&.B_%2R\8:V=.MK=-46_DLY/$-[K5R --DM<_:+F%6 M9B[AL<*JY Z 'G-5_96^*5SX7TWPL-4TN\T6WM[5843Q%?6-O8RQWSW$K&VA M@VWF]#&%\X@(5.%[G['W4;J /DOP]^S#\2_AOH?BJ'PGK^D_;/$LLEU>RS7L MT-Q ZWSRI#;7(@9HXY+>1D(Q^ZD)=-VXUVGP0\(^.?A5X@?0+S1[9K#Q#JU_ MK]_>#5;S518PBWM8H8#=W"J\LSR*Q.[/R*2/0?0&ZC=0!\Z_%W]GO6?&'Q.U MG78+"W\2:'K^F6FG7FGW/BK4-%%OY#R')6V1UN(V$F=K;2&7@X8X[CX3>!O% M/@;2O&.B72Z;!;7.J7^HZ3JEM=/-(_VF624"6%HU"&,N!P[[L=J]2W4;J /C M_1OV6_B5J5_)J/B*_P!,;4FM-)MI[JX\27VIM=RVNI1W4LP66!4ME=4;;#$- MH) /RQ6<@$K>2#,T3,I,>S<=APQ8#( MP:Z'=1NH \M^%_PXU[P_X%\7V^N?8(-<\2ZGJ&J/;64[S6]J;CA(O-9$9]H" MY;8.2<"O%M5_8:M[7X?>#-/\,Z'X-T'Q3I_AZ^TK6=5M+06[WTT^G-;AC+'! MOD7S6W$O@XR<$\5]=[J-U 'R3XN_9E^(FJ7&OV>@7&EZ#HM^'NKFS?7)[JTU M.Z'E-$_V=[7-FY:(;WBD8'^XVXXV-7^ OC_Q9)K.EWUMX?TK2/$7B.S\3WNI MP:G-/>Z?)$D(:VB0VZB7F !92Z85V&W@9^GMU&Z@#YW\-_!WQX_A;X;^%]8T MSPO8Z?X'U+3YDO[+49IGU"&WCD0OY)ME$3'*+7Q+X M@U!K;3O$VFZ_]NM;G2E\5ZCHD<4$U_<7"%FMXF\Y62Y*O&R\%1M9LFOK[=1N MH ^?_#?[.VKZ-KN@7LDFD^1I_B_5-?=%ED=OL]S:R0Q("T>3("ZYR<8'WB>* MU[;X#:A=?LMVWPOOM1M;75X=-2V2^M@TL$=Q'()(F 8*60.J9&!D9KVG=1NH M ^;?C5:_%/Q#\*[V?5-!T/1_$NCW%E=>'YO#]_<:G)+JBSJJL4:WA\N%E=E; MEB%=LD (+NXN1+X7?5YDM8(9 M+:UA65+O[*29LVN6_<@%9" >.9M2_9F\1^(/#7V"ZO=)TN[N?%>I:["%&%Z]J^E-U&Z@#Y0\+_LN>)(8/#ZZCI6E6>H:-<:0 MC:G)XMU+51=VUIS6T2>9>7$J6,,IVB9D<1.W W["T9Y"[EQD5XO:? WQ_XS&06VZ5(!;,GRFVX!E&=_5</_ ':?&37;_PIH6NG7[D7VE:5IVH3WSW$GV>&V2&>-[6,!#Y8=F#, &(Z M#MJ4)OM-\2ZA8P>'[&ZEWK9P1P1H;V% 2 M1%+Y<>X?="GCZUW4;J /!OA]X7U3X9^(/B)X.TK2UNGO8+74=#N;^22"TN8U MLX;1XI)TCDV/&T )&TG;(I /.,/0/@Q\2/"?@_X77%I8^&+OQ7X/TFZT*:R; M6+@6=S!-%$HF6?[)N5U>%&*&/&"PW9Q7TKNHW4 ?-GA3X:ZOH6O>"_"FF6L& MIOX#\&W5EW?^RX=2FTZV6XC*,##=1H980C+E'50PVKT[=WNHW4 ?*$O[$,> MK?#KQ2U]J=[;>/\ 6HM1,2*+*7SIE!819E3;D MGAB&7Z#W4;J /(_$W[.WAN;PYJ<4%KX@\3SR0,(]+U[QSK+VLS\%41L" M RR!"R, RX(!K@--_9PU71O!6L1ZCX&\(_$/5->U@ZG=Z3XMURZOH+ +;K!# MY=W;/2=1\2^'-7TOQE9Z9+#>2W M-O\ 9]/EE>.2R9BL>\L%(D*$;@O .=I/6NBW4;J /!_%G[*.A>*O$L,4BR1> M%I-'NK6Z(U"=]1-Y)=6TZ3K,^YLCR/O%\C"@#'3@O%'['/B'5M3\2?V;?Z)8 M:9=R:B]A;EY2%60::;>*11'C9_H+HX!.%<8W9('UKNHW4 ?,?C[X$?$/XK^. M/#_CB^M_#?AC6O#EI)_9VEPZG-?V=S<">"2,7.;:,&,B.09"EHSY;KEEXS_" MWP5\5_".>[U^[\-Q>*KC0Y=5UG3+FU\5ZE/))/<"9UA333$(=Y,IC+A@"OSX M!.!]6;J-U 'E'QA^&_B+XM_"#3M,:6UL?$T-QI^J2P1W<]K;23P2)*\/GQ9E MC4E2!(N67@X.,5Q7PX^"?BKP-\2])\6VOA[2K)+M+VVUFTG\5WNISKYS6K"Z M$\]ONE?%MM,7R#[N&/-?1FZC=0!\X_M"?!'XA_%3Q5=1Z9?VDWAF>&P^S17/ MB"\T]+":&X\V9GMH(F2[,@"!?-;"%>G>O0?@QX'\5?#C2K/0K]M'GT96U*[F MGMII6N/M$U\TT*JI0*4\J1]Q)R'"@ C)KTW=1NH ^=_B]\#?&OQ$\?>++RTC M\/PZ%JNBZ;ID$MSJ,_VC?;7WVER\(MBH5@S*,2'[H)^\=LVM_!'Q?I_Q5F\; M:)'HVHX\3KJ\>G7-[);;[=M+%E)N<0N%D##< 0RC[P-?06ZC=0!Y;\8/!WB MOXAZMX9T>QLM*M_#5GJ]AK%YJT^H2?:E-M.)3#';"$JV[:HWF48RW' ROQ(\ M$>*%^(WAWQ[X.ATO4]2TZPN=)O-(U>[>TCN;:9XY R3)%*4D1XE."A#!B,C@ MUZCNHW4 ?+?Q!^"OQ>^)_B>"\UJ;18K WNEWT5K:>*+^*UTP6URLLT8MDMU2 M\=P@(DFVX/ 5< U!K?[)/B75OAYX2T%-1T6WN]'T/4;"=]TK133S7=O<1*1Y M8+1-Y!63.#AN U?5>ZC=0!\P^/O@M\0/B+XKB\4ZMX;T3=-I$N@W7AZP\;ZC M81&$N'$IN(+53(&RZM$T>-JH0Q((KN_AO\*_$OPJT3Q8-"M?#YU/5M;@O+>. MXN9VBCLUAMH71Y?+\QG5(I=F003MR1DX]CW4;J /,?C_ .&O'GC'PK:Z+X*_ MLK[->3^7K2ZAJDVG32V>T[HH)XK>_&FJ#5]+L= M*\+Z'H'BJUT>VU2WM=4GE_L=;&3!2U!M4^T*\*HHW"+:V<@BOI[=1NH \+N_ M@IKGC;XA?$C_ (2[3]+3P1XJL[&T1M*URY%_BU:0J706T84/YG($IQMQ\P/& M9X6^$VM_!:XUF'3;23Q@?%/C*VN8#JUW<7Z:?9K#'ON9FD'R2J(7P03EC$-W M8?0^ZC=0!X_HWA/XA:+\6OB)XHCTGPS+8:S8VL&F(VMW'FM);"4)YR_8\1J_ MF\E6 MQ9?/D=@2!"HP,[BQ.?IK=1NH ^8?A9\)M3^%?B&/POXHLHO$=AXE\*#2S(@D MDL8IH)[J0V+2,I98C%=A$9@,B$\9PM9,_P &-7^'G@3XB:C-H\AU[Q9I,'A/ M1O#UIK=_KRVJ$2HA>ZN@&50T[.P"K'&D?&3DGZTW4;J /'_%/A/XF6'@_7=, M\%)X5L]4DAL+2PU6YN9K>XDB2()<23.+>4+*N"(CMD49RPXP>&UGX0?$JY\& M>$_"-AX2\%VW@ZP9Y-6\/GQ?>YU)U_P!BV'@[4_$;^*9[VVOI9+R&9[7RVM4B,"JRB8[A M*77*C&P&G_!K]EB]\-WDR:[IVD^$M.CT&VT22+P%JUWI\FK30R;Q?326ZV[Q M.0,;0SG#N&\+ZA96FFR^#-+T*\T.>XO-?NSJ MC)<&#=(,P.691!C\;ZSKW@&]6YMSH%EI&EZ;XBU MJ\EAC:.XD:0.-K801N-FW)#;N "2?H3=1NH =13=U&Z@!U%-W4;J '44W=1N MH =13=U&Z@!U%-W4;J '44W=1NH =13=U&Z@!U%-W4;J '44W=1NH =13=U& MZ@!U%-W4;J '44W=1NH =13=U&Z@!U%-W4;J '44W=1NH =13=U&Z@!U%-W4 M;J '44W=1NH =13=U&Z@!U%-W4;J '44W=1NH =13=U&Z@!U%-W4;J '44W= M1NH =13=U&Z@!U%-W4;J '44W=1NH =13=U&Z@!U%-W4;J '44W=1NH =13= MU&Z@!U%-W4;J '44W=1NH =7/^)/&&G^%#"=2GEA6?S#&8[66;/EH7;.Q3@A M58@'KCC)XK>W5A:WX6TWQ!=PW%] \DMLLBQ,DSQE0Z[6^Z1G(XYZ=L$HSX MF#VLP*1J,ECE.A'3^]VS4I^%7A/["MJ-$MQ!'*DD:Y;]VRAD4J$'VI+H5K.F>4GW2*?G+@%6)! 8L<$8&YL?>.0#KX;M+F".:*4&*1 F0Z/U# \@C\**K:?IT&D6-O9V48M[6"-8XHDZ(H& ![ =J* /_]D! end GRAPHIC 10 elev-20230417xex99d2g005.jpg GRAPHIC begin 644 elev-20230417xex99d2g005.jpg M_]C_X 02D9)1@ ! 0 0 ! #_VP!# ," @," @,# P,$ P,$!0@%!00$ M!0H'!P8(# H,# L*"PL-#A(0#0X1#@L+$!80$1,4%145# \7&!84&!(4%13_ MVP!# 0,$! 4$!0D%!0D4#0L-%!04%!04%!04%!04%!04%!04%!04%!04%!04 M%!04%!04%!04%!04%!04%!04%!04%!3_P 1" +M!34# 2( A$! Q$!_\0 M'P 04! 0$! 0$ $" P0%!@<("0H+_\0 M1 @$# P($ P4% M! 0 %] 0(# 01!1(A,4$&$U%A!R)Q%#*!D:$((T*QP152T? D,V)R@@D* M%A<8&1HE)B7J#A(6&AXB)BI*3E)66EYB9FJ*CI*6FIZBIJK*SM+6VM[BYNL+#Q,7& MQ\C)RM+3U-76U]C9VN'BX^3EYN?HZ>KQ\O/T]?;W^/GZ_\0 'P$ P$! 0$! M 0$! 0 $" P0%!@<("0H+_\0 M1$ @$"! 0#! <%! 0 0)W $" M Q$$!2$Q!A)!40=A<1,B,H$(%$*1H;'!"2,S4O 58G+1"A8D-.$E\1<8&1HF M)R@I*C4V-S@Y.D-$149'2$E*4U155E=865IC9&5F9VAI:G-T=79W>'EZ@H.$ MA8:'B(F*DI.4E9:7F)F:HJ.DI::GJ*FJLK.TM;:WN+FZPL/$Q<;'R,G*TM/4 MU=;7V-G:XN/DY>;GZ.GJ\O/T]?;W^/GZ_]H # ,! (1 Q$ /P#]4Z*3CTHX M]* %HI./2CCTH 6BDX]*./2@!:*3CTHX]* %HI./2CCTH 6BDX]*./2@!:*3 MCTHX]* %HI./2CCTH 6BDX]*./2@!:*3CTHX]* %HI./2CCTH 6BDX]*./2@ M!:*3CTHX]* %HI./2CCTH 6BDX]*./2@!:*3CTHX]* %HI./2CCTH 6BDX]* M./2@!:*3CTHX]* %HI./2CCTH 6BDX]*./2@!:*3CTHX]* %HI./2CCTH 6B MDX]*./2@!:*3CTHX]* %HI./2CCTH 6BDX]*./2@!:*3CTHX]* %HI./2CCT MH 6BDX]*./2@!:*3CTHX]* %HI./2CCTH 6BDX]*./2@!:*3CTHX]* %HI./ M2CCTH 6BDX]*./2@!:*3CTHX]* %HI./2CCTH 6BDX]*./2@!:*3CTHX]* % MHI./2CCTH 6BDX]*./2@!:*3CTHX]* %HI./2CCTH 6BDX]*./2@!:*3CTHX M]* %HI./2CCTH 6BDX]*./2@!:*3CTHX]* %HI./2CCTH 6BDX]*./2@!:*3 MCTHX]* %HI./2CCTH 6BDX]*./2@!:*3CTHX]* %HI./2CCTH 6BDX]*./2@ M!:*3CTHX]* %HI./2CCTH 6BDX]*./2@!:*3CTHX]* %HI./2CCTH 6BDX]* M./2@!:*3CTHX]* %HI./2CCTH 6BDX]*.* %HIF?I36;GB@"6BH=QHW&E<1- M14.XT;C1<":BH=QHW&BX$U%0[C1N- $U%0[C1N-%P)J*AW&@.0:!DU%1@YYI MR]*8#J*3CTHX]* %HI./2CCTH 6BDX]*./2@!:*3CTHX]* %HI./2CCTH 6B MDX]*./2@!:*3CTHX]* %HI./2CCTH 6BDX]*./2@!:*3CTHH **6B@!**6B@ M!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@ M!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@ M!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@ M!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@ M!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@ M!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@ M!**6B@!**6B@!**6B@!*1\[#@_ARX_\"%_PKYO\2_\ (R:K_P!?Q_Z%RY_\"!_A1_PV-8_]"Y<_^! _PKQ3 M0?@QXN\3Z)#J^GZ4TUA,I:-_,4%@"0>"?4'%<5)&T+M&XPRDJP]"#@U<\TS& MFE*;LGY(N>;9G2BI3T3VNEJ?4'_#8]C_ -"Y<_\ @0/\*/\ AL:Q_P"AM=QJWP6\7Z'H4NKWNDM'8Q1B5Y!(I*K@;9E63=/6V^B/:O^&QK'_H7+G_P(7_"C_AL:Q_Z%RY_\"%_PKY= MJ]HNAW_B*_CLM-LYKZZ?I%"A8G_#ZFLXYQCI/EC*_HD9+.L?)VC*_P D?2G_ M V-8_\ 0N7/_@0O^%'_ V/8_\ 0N7/_@0/\*\Q3]F?QX]J)O[.A4[<^6;E M-_TQ7GVO^&]4\+7S66K6,]AH/0CZ9K>KF&:45S5$TO-(Z*N99M0 MCS5%9>:1]'_\-CV/_0N7/_@0/\*/^&QK'_H7+G_P('^%>%>#_A7XE\=V,MWH MUA]K@CD\IF\Q5PV >Y]ZV+K]GSQ[:0M*VA22*HR5BE1C^6[FJCC\TFN:-VO1 M%PS#-IQYHIM>B/7?^&QK'_H7+G_P(7_"E'[8EDQ 'AVY&3C/VA?\*^9+RQN= M-NI;:[@DMKF)MKQ2J593[@U''_K%^HKF_MC&J5G+\$221@D:*69B M< =37Z-!WBF^Q^FQ=TCP3]IG]MSX.2:WM])M5F=40 M@%GW.H ); ZYP?2O5_AM\1]%^+'@+1/&'AZ9[C1M8M4NK=W7#A6'W6 )PP.0 M1D\@U^,'Q$\/:_\ \%'?VQ?B"WA^>0Z/HNGW0TZ0+N40VR,MN@]YIB#_ ,#/ MI7TU_P $$O$WPDU69DU#0I6U'3X9>&%O(X69 #S\DI!Q_TUK0H^Q_ MVF?VK_!?[*/A_1]8\:0:M/::K=-:0#2K9)F#JFX[@SK@8]S76_!KXS^%OCU\ M/M.\9>$;QKS1[T$*)5V2Q.IPTHS^E?"?_ 6VR/A)\.,?]!R;_P!) MS7RM^Q+^T/XD_8G^*6E:1XTMYK?P#XQM;:[FW@LD<#O%UMKLVK:O:1WENVF6D?\ P5NU M"VU;]JGX5WUG.EU:7'AVREAGB8,DB&^N"K CJ""#FM3_ (+80&X^+_PRA3&^ M31YD&3@9-QB@#]8/!OC71_'_ (7TKQ%H-XFH:/JENEU:W,?1XV&0?8^H['BO M$_$?[=7PY\+_ +24'P0O+;76\937=K9K+%:1FSWSQ)+'F3S V-LBY^7@YZU\ M#?\ !._]I[6OV8_B?=_ OXH;]*TBYNREE)>-A;"Z;H-QX\J7((/3)![FJ_QC M._\ X+0Z0WKKVAG_ ,D+:@#] M7_ &Z?ASHG[1UM\$[BVUT^,9[N*S25+2,V MF^1 ZYD\S=C!Y^6OHKR$G'_3,>M 'UC^S/ M^VU\.?VK;S6[/P8=5@O-)CCEGM]6MDA=D:;\+O M /B'Q?K"7#Z5H=C-J%TMJ@>4Q1H6;8I(!. < D5^+OPWT?6_^"O413IG_MF#WK]7_VR'63]DGXNLC!D;PKJ!# Y M!'V=Z %_9F_:M\%_M7^'M8UGP7!JL-II5TMG.-5MTA)Q:I=&W?TNS\APV&>*Q:I=+Z^ESUW4_'>F_#GQ7X/\%Q( MB6EQ$8F8GF/ VQ?FP/Z5\X_M$^"O^$0^(5S-#'LL=3!NHL= Q)#C_OKG_@0K MJ-,\.0_'KQ[XCUV;7TTA;6>-;5BJL#&,[2,D?W0?QKT_]H#P6/%_PS^U6\J7 MVHZ2HF$\//F "0<9ZCG'L*^EQ$)X[#5?=TB_=].I]9BH5,PPU7W=(N\/1:- M'SW\!_!?_"9_$:PBE3?969^V7 (ZJN"%/U8@?3-?3]E\0]-\8>/O$G@>:..2 MW@M0@SSYC6'CN7Q.EGJ#W4DLEM(J_/EB&R2P/.3V[U&!C4PU.G3@M9OFE_AV M2(P$)X6E3IP6LWS27]WL>)>-_"\W@SQ7J>BW&XO:S%59NKIU5OQ!!_&OICPE M;Z=\ /@W'X@GM4GUB_1'8G 9Y'&4CW=@!U_&N>_:R\%+(--\56BAD;%K=.G( M(ZQM_P"A#/N*Z+XCZ9+\5?@'H]SHJ_:);9(;DV\9R24C*2(,=QN/Y5E0PSPE M?$J:G^U7XCTB2*/4/",5HTL8E1)VD3: MVN5GDDC$D95LB(8(!'K7%_#_ .)GQ2U7QEIMM*MW?6LEPBSQW%GM01EAN.[: M,8&3GVKV;X5?%FY^(7@[5]:FT^*SDL6=5BB8L&VH&Y)^M$:[BNEOM>I MP'[7FGVEOXJT6XB1$O+BU83A0 6"L-I/_CWY5X/%_K$^HKTG]H31-9T?XBWT MFKSO>1W7[RTN'&!Y70(!VVGC]>]>:Q\/?\ ("T[_KVC_P#017S7_P %'?CN?@7^S-XAFL[GR-=\0@Z)IVTX=6E1 MO,<=QMC#D'L2M?2GAX_\2+3O^O:/_P!!%?.W[6_[#6D_M>ZUX?N]?\8ZMHUA MHT3I#IUC!$T;.[ NY+#.2 H_"OU&G\*]$?K$=D?E_P#LH6G[5'P<\.W7B#X3 M_#V]N=,\3QQ3'4GTA+D7$2%MFQF/"Y9CP.:PO 'B_P")'[)O[7?ASQ[\1/#E MYX1N]7U!KK4K22V^S)<6D\FVX*(IQCYF8#ID"OWD\*>&+#P9X;TO0M,B\C3M M-M8K.VB'1(XT"J/R%>(_M=_L8^%_VOM%T*SUS5+W0KS1[AY8+^PC1Y"CKAXR M&&-I(4_5?>M2SY6_X+4ZA;ZG\%_AC=VLJS6\^L2RQ2(>'5K8D$>Q!%=1XR_9 M%L?VI?V!OADMC"D'C;1O#EO<:/=@ &5O+R;=V_NOV]&P?6O5?B[_ ,$_=(^, MWP+^'_PTUWQQK)MO!QQ;:HEO$9[A!&8T60$8^5,#(Z[:^@_A9\.[;X5_#CPY MX/L[N:^M-$L8K&*XG4!Y%1 M ?C_ /%B#X@/K&H^%]7)C>\CTV&-H[R1&R)&##AB 2.N!WZ[W[6?[!GAW]K M7Q?X:\0:SXGU30I]#MVMHH;&&-UE!DWY;<,]>.* /'O^"B/[%K?&SX4Z;\0O M"%B?^$ZT'3XVFAMU ?4;54!*\188TAC+'N=D:@GOBOZ![&Q2RTVWLPQ=(8EB#$K"PUJQP)H >2A!X=">=I_ BOC.Q_X(BV*:P6O/BK<2Z7D8BAT=4FQW M!$/ _[.NM_"3P9>7GABQUJW:"^UB$+->3EP%D=BPP2R@KT / %+^R/\ ML=>&/V0_#FM:;H.I7FM7.KW*W%S?WR*LC!5PB87C RQ_X$: /R9_:QL?VH_B MYHUIXI^+GP_O;+3O#<3XU1-(2V$$3LN0[+R5SCKTR:^WOAI\>A\=_P#@EKX^ MN+RY-QXAT/PKJ.D:GO;+EX[=O+.=(?2[V"YMXAY)* MLJS)@??578<\'//2@#Y[_P""//Q9\%?#OX4^/;7Q1XKT;P]<7&M120Q:G>QP M-(H@4%E#$9&>*_0[0?C_ /#3Q3K%KI.C^/?#NJ:G=/Y<%I::G#)+*V,X50V2 M< ]*^%3_ ,$2O 1_YJ/XCX];6W']*[WX$?\ !*3P=\"_BSX:\>Z=XYUS4[S1 M+@W$5KZ^5S\ MAHXFIAZE25-V;NGZ7,A9"GW6(^AKUSX*?&ZU^'.FZGINKVL^HV%RPDCCB(.U ML88$,>A&/RKS,ZM;YYT>R_[ZG_\ CE']KVV?^019?]]S?_'*BA7J8::G3?WZ MF6'KSPTU4I2U\T^IZK\6_CGIWC3PA8^'=!T^?3+&)U\Q)=H&Q1A$&#TS_(5X MT)64<.1]#6K/>QVS!9=%LD)4/C?,?E(R#_K/2HSJML#SI%E_WW-_\JG M'Y"N;^%'QIU/X83R0*HO](E;?):.Q&UN[(>QX'UXKCEU.!V"KHUDSDX #3') M_"2I;ZY&FW4MM=:%:V]Q$,K&I#J?4N;&$R _[^&/3X;&P MMF+19 :8GDRR>!\TW/\ MY$K2OF->O#V]HVN>G?"7XTZ=\/O!6L:-=6=Q/-> MN[*\6W:N4"\Y->2VM[-8WD-U;RM#/#()8Y$."K Y!_,5H3WD=M])FIS=WMM86(Q$\ M5-3F[O;:Q^COA[_D!:=_U[1_^@BORJ_X*Y?&SXB?#7X\>%K#PAX]\3>%;&;0 M$FDM=%UBXLXGD\^4;V2-U!. !DC. *_57P]_R M._P"O:/\ ]!%?D3_P6 A2 MX_:N^'44J!XY-'ME96'!!NY00:_5Z?PKT1^O1V1]J_L!_M>6G[07P&^V>(M3 M2+Q3X6B%MKTMQ)MWHJDK=$GLRJ2Q[,&]J_,;]J_]OSXC?%+XSZSJ7@GQWXG\ M)>$;9_LFFV6C:O<6221(<>]:EGV5_P5#^*OC7X?\ [.WP?U+POXPU_P - MZC?3HMW>:1J<]K-<#[(&Q(\; M\W/)//->+_ Y_94_;3^*'@30O%NC_ !VU M./2]9M([VV2[\<:JDH1QD;@%(!^A->@?\%%OB MSKWQ3^)]YXGLCX1OAIH3Q-?7SVMTL3.LJ"95",,<,IR.*^+/V8="_:J_:R@U M^3P9\;O$ULNBM"MS_:_C'4H[[]ECXR-^T DB> M(5TW41IWF16^@FNK<^-]4D\ MV%9 778R8;*@C!X.:Y+XV?LW?MF^"+/QSXWD^+>N6WA;2UO=7,-MXVO@\=I' MOEVI&"!D(,!1QQBO:?V7]8_;AN?CCX9C^+<-PG@!I)O[2+VND(/]2_EY,"^9 M]_9T_&OK/]K[_DU+XQ?]BCJO_I))0!^1'[-WA?\ :U_:IT/6-5\$?&+Q2;72 MKE+6X_M+QI?P-O9=PV@.I?MM^(/CC^S;^SI\ -!UOXC^);'QPTNO#6=2 MTOQ'=&2]'VF)X/,F#AI=D4J@;L[>0,"O5?\ @B*,_"[XE_\ 89MC_P"037/_ M /!ZG#Z=,[AY48,VY@&.3R0">:P?\ @ES^W5??$$M\*OB+KESJ7B1- MT^C:QJERTT]\F2SP22.26=>2I))*\?PU7_X*0?\ *-KX/?\ 7SH7_ILGKYH\ M4?LHZII?[(7PF_:%^'0GM-?TRU:;6_L8)D7R[J017B=<% H5N.@!['(![E_P M5G^,_C_X<_'WX?Z?X1\=>)/"^GW6BI+/:Z+J]Q:12O\ :I5W.D;J&. !DC. M!7LO_!2']N?5/V=K33O W@>11XXUB$SR7;)YGV" L50HIX:1R#C(. ,]Q7YQ M?M:?M.Q_M3:_\+?$5Q!]F\0:;HT>FZQ$HPC7*W#MYB?[+JRMCL21VKVO]L!X M+3_@JSH\WBIHQX>75M"<>><(+01P!\YXQO$M &WX7_X)W?M-?&O0;3QIXI^) M4VD:S>I]J@M-8U2ZEND#?,NXJ2(B<_='W>.!T'TU_P $^?AK^TI\.?%WBG1_ MBQX@N;OPAIFV"SAU*Y-\]U*W/F6T[-N6(+C(/G/-?$GP&_;,_:3?]L?PE\)/BEJ%G M8RS7ZPZKI:Z=:"15:W:9!YD0.,J4;@]#0!^KU%%% !1110 44F:,T +129HS M0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F: M,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%) MFC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +1 M29HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- " MT4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:, MT +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)F MC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +12 M9HS0 M-?[C?2ES39#\C?2D]A,_-[Q.N?$FJ@]/MB[KD+ M#;PR+,W^J-PK%GPFW/.]DSGLOI7*^)N?$NJ\9_TN7_T,UU&H^"=,6#3G@U#[ M)$UK;&>>5&1O=S[PUNJG]V%D="2W3JA/TK2U30]/&MMH M%I:7(OHI1$]ZSEPY&=[; O3TP>G)SFM?:5;--:FJJXBTHM*_^9>/B"PETN6. MUOX=/NO(A6:5[4L9P( K(#M.#OW=< YSGBM:Z\4^'[&RC-G=03744,T<$AMV M+A6A4*'R@&X/Z<#KGK6"GPTTS3+$/EQCC,@Z].OK6_:>+=#NM56]FN&@^T62VUTUU'YL MP9&P)$8(02RA1R.<')%'K&2>?4(V?SO*BA",'D^1')_V<"3D'D' K M5@\%6)-'>STX"]@@OX[62"*1;4^5;MM4*[#9D,<,#M+#)W8%0ZAX@TR>SO(K&_ MM;.9I,W#M9_\?J^4B_+\IQ\ZN<''WLU!/\++BWO3;27Z(^V4A3$P>1T90RHA MY;[P(/< ^E5&^&]X+"UG,OSS&-O*\EON/G!4_P 1&,D#IGV-5)5VM8%R>*:U MIFU)XC\/KINIM#56E#ZC"IW6R6V5.9S-OVXQ]W M'EMDGTINF^#]*O8+Q$U=9'2>W@CN! X =S("FWJ?NJ<^AIJ6(VY$BE/%/3D2 M_P" :DGC+38)HHXY(71YU%[,+48G40*K, 5S@L&X !Z' KSY.9EZGYN]7=92 MTBNA#:P20&%1%-ODW[Y 2&8<# /I5*+_ %B_45Q5*DJC49=#S:M:=22C+H?H M[X>_Y 6G?]>T?_H(K\U/^"F'[.?Q*^+G[27@?7?"'@S5/$.CV.FV\-Q>6489 M(W6Z=B#D]0I!K]*_#Q_XD6G?]>T?_H(K1$@''ZU^M4_A7HC]ACLC'U7PGH_B M2[TRYU;2[;4+C2KC[98RW,0=K>;:5WH3T;#,,^_M7Y[?\%:/V?/B'\:M>^'T MG@7P?J7B:'3[>Z6Y:P0,(BS(5!R>^#7Z1[A1N%:EGYZ_\%*O@5\0/BU\ /A- MHWA'PGJ'B'5-+G1KRTLT!> "U"'=R/XN*\+\#>/?V^_ASX/T?PQH?@._@TC2 M;9+2UCDT.WD98T&%!8G)X[FOU^W"C<* /S]^ WB[]JOXF>'/BKHGQA\+W5G8 M7'A.]BTI#I<5L9[QXV144IR20W0U\@?L^^ /VR/V88]8C\ _#C5[!=7:-KO[ M5ID-QN\O<%QN)Q]X]*_<'<*-PH _+/PA\:/V_;GQ;HD.L^"[J+2)+Z!+R4Z# M;+L@,BB0Y'(^7/-??O[3/A_5/%W[.GQ.T/2+.74-5U+PUJ-G:6D(R\TLENZH MB^Y) _&O3]PHW"@#X*_X)-_!3QU\$OA]X\L?&_AB_P##-W?:G!-;Q7T>TRH( MB"PP>@-8O_!6WX$?$#XX67PN3P-X4U'Q.^FR:F;L6"!O($@M=F[)[[&_[Y-? MH<9 ,]Z^?O$7[96C1>*M7T'P9X)\6_$RXT67R-4N?"]DDEM:2]3&99'17<=U M3)!R.HH \(_;H^"?COXD?L*?#'P?X:\+ZAK/B339](:[TRV0&6$16$L*&UGDM+^TOXC!WGA'X>^./'GA>QD>.?Q+H&F+)9'9]\Q%W5I@"""8U/(^E 'YO_M3_P#! M-/Q]X%^-DD_PQ\)W_B;P7J$PO;;["H/-(A,'D3N(TU"#.X)O_A=3G:3QR0<<&OJ'PQ\=_!'B[X8 MM\0=/UZV/A.*%YI[^9O+%N$_UBR@\HR\@J>&B+I2^)?\ A6_CX?#X M_/\ \)@VD 60BSCSMA?S?*[[]F,4 ?"OA3]I_P#;8^".B6?@JX^'6HZ\]F/L MUO>:GX?N;R957Y0/.B8*X'&&;)/J:Z_]DS]DWX[?$G]JO3/C[\5[)?#S078O M)EO8UBN;MEA\E$6!?]6JJ%&6QPHZDU^@_C_XXS>&?#/A_7?"W@G7_B78ZR@F MB;PP('\N(HKI(QED0;6##&,]#7EZ_MQS67Q!\(^#]<^#/CWP[JOB>Z^S6(OH M[,Y (WR%4G9@B Y9L8 H ^HJ*:KAB1C!%+F@!:*3-% "T444 %%%% !1110 M4444 9/BSQ+9^#/"VL:_J/F?8-+LY;VX\I=S^7&A=MH[G"GBOC/_ (?$? #T M\5?^"I?_ ([7U#^T+_R07XC_ /8N:A_Z325\\0?LM7USJF@Z9 MJ5P/$-T@FO+..5PHCAP,L"<P^,_"'VW^QI;B6V7[? (9=\9PWR@GCGUKH/^%7>#/\ H4="_P#!;#_\ M35+QSJ,OPI^&VM:KX3\(1ZS-IL#W<>@::R6AN<$ M?LB_M<^&_P!KCP1?ZUI%C+H>JZ;K?"3P1X3NO$=EHN[^UO%:7BI9VI7AP%V$OA_D&"-S9QP,T ? M3=%?.G[3'[<_@#]F;6+'PYJ%OJGBGQI?H)+;PYH$ FN-K'"LY) 4,0<#ECV4 MCFO$W_X*Q6'A+5;*/XC?!3QYX TF[<)'J-_;''/\6R1(]P'4[23CH#0!][T5 MYSX\^-VC>%/@1JWQ4TM1XCT*TT=M9MQ:R[/M<.S>NUB#MR/4<>E?+L7_ 5: M\,:[X8T*7PC\.?%/CGQ;?6AO+SP]X?B-S_9B;V4+-,J'YB &PJ' /)!H ^Z* M*^,OA_\ \%4_A%XH\%^(]6\0PZKX,US02J7'AR_A$EY8V[@@A2 MO4X'-<]8_P#!6#P[I/B[2].\>_"KQK\/-$U20+::UK-KM1E)&)&C*J=G()*% M\>] 'W=17BO[5'[3>G_LP_!Y/B!-H\GB>R>[M[5+>UN5AWB4$JXG.: M\,UW_@J#I-Y>W$7P[^%'C/XHV6GQ(^JZIH%JSV=FY4,R"14;=MY!8A0<<$CF M@#[=KR'1_P!J+P5K?[0VK?!BV_M'_A,M,M/ML^^V MO+V(_$F[).)%XQZU0_ M9A_:[\!?M7>'[R]\)SW-GJ>GE5U#1-301W=J3T) )#(2" RD],'!XKY2^''_ M "F4^(/_ &+W_MM:T ?HU17AO[3G[8OP^_94TNR?Q5<75_K>H9^P:#I48EO+ MGG&[!("IGC@R1BO ]/\ ^"K6D:+J=A_PL3X/^.OAWH%^X2WUO4+-GA.> MC$,B$C')V;SZ T ?=U%<[_PL/PT? A\:#6K-O"@LCJ7]K+(#!]F"[_,W#MCF MOC*Y_P""J]AKUW>3_#_X*^/_ ![XK *CX'?YBI]0* /N^ MBO#/V7OVQ/ ?[6&D:C-X6:]T[6-+*C4-$U6(1W5OG(#?*2K*2",@]N0#Q7N= M !17F?Q^_:+\#?LT^"CXF\1DXZDD =R*^3_^ M'M%C9VT.NZG\#OB!IW@:5AL\1O; Q%">&&0(S]!)0!]^5\D?M#?\%,_A5^SS MX_N/!5Y9Z[XH\0VFT7D&A6\3QVK$9V,\DB9?!!PH.,\D'BO5O^&EM$\5? "\ M^*?PVTZ\^)5K'"'M]&T=&^V3R;U5H?+"LRR+NR5VG@9Z'-?E]^S)^T;XF\'? MM>_&/QS:? WQ7XPU_69I?.T.PMY'OM$#S[F6;$+,O0*C) )4^XZ5\L?\%+OV@-2^ 7[-&H3Z#U $_QX_X*4_!3X":[<:#?:M>^*/$%LQCN-.\-P+1G2 M,,#P5#%AW KC/AQ_P5T^!_C?7X-(U>+Q#X'FF<(EUKUG&+8$]-SQ2.4^K*%' MJ_M._LT>$_P!IGX9ZMX=UW3+1]4:W?^S-6:(?:+&XP2CH^-P7=C>.YLWB\^.:!@Z2(1D,I'!!'((KR?]G/\ :I\$?M16 M.OW?@K^TO*T2Y2TN_P"T;80G>P)&W#-D?*:XG]B7X.?$OX"_L]3>#/B3JFF: MG/8M,=+_ +.N9)S;VK+GR79T7[K;L;<@!L9XKYQ_X(L_\BI\7O\ L.6__H$E M 'Z35Y+^T=^TYX-_9:\*:?XB\:_VC_9]]>"RA_LVV$S^9L9^067 PIYKUJOS MR_X+5?\ )OW@W_L9%_\ 2>6@#K!_P6(^ !/_ #-(]SI*_P#QVO6_@C^WS\$O MC_K<.A^&?%RP:_,<0Z5JUN]I-,?2,N-CG_95B>.E=[\._ACX.N/A[X9>7PGH M$O&_A2/^TQWGVS2=AN;+4K<03;&Z2*NX[ER",@\' MKU&>"_9S^.-Y^T%^P7<^*=5E\_7$T'4-/U&7O)/#$Z%S[LNUC[M7Y3?LY1^. M/V<_"OAO]I7PH9+_ $6PUZ70M=L%R%\DK&VU\?P2!R 3]UU0]Q0!_0-7CWPD M_:H\$_&GXE^-O OAW^TO[<\(2M#J7VNV$<6X2-&?+;<=WS*>PXKN?AE\1]#^ M+G@+1/&'AN[6]T;5[9;F"0=1GJC#LRG*D=B#7P'_ ,$[?^3X?VHO^PA-_P"E MTM 'Z25Y7I'[2_@;7OCUJ7P@TZ^FO?&&FV)O[Q88PUO H*YC:3/^L&]25QQG MUXKS+]KGQO\ 'NYU[2?AU\$/"J)<:S9&:_\ '%\VVVTI"Y3:I(VB3 W?QM@\ M)GFOCS]@SX47OP2_X*/^-_!VI:W)XCU.PT"5KO5) 0;F>06TLC MIH _6,G KY2^*'_!3OX!_"OQ1<^'[OQ+=ZYJ%K(8KDZ'9-T@=#ECUS0!]4_ W] MHWX>_M&^'I=8\ ^(H-:@MV"7-N4:*XMF/021. RYP<'&#@X)KTJOR_\ @SI^ MB^&/^"MGB'3?A,L,7A%]-F_MZVTO'V*&3R09% 7Y0!/Y? X#$@>E?J!0!1UW M7=.\,:/>:MJ]];Z9IEG$T]S>7<@CBAC49+,QX 'J:^1-<_X*T?L[Z-K;Z?'K MVKZI&C[&O['296M_<@MM8CW"G/;-=)_P4)^!'Q(_:-^$VD^#? %U8VUK-J:7 M&LK>71@,L"#Y47"D-\Q#$$C[HKU[X=?L]_#_ .&OPZLO!FE>$](71H;98)X9 M;..3[4=N&>8L#YC, 19RR3V4+%H+>9&B(4= MALDDE0>@R.U?IM0!\H_&/_@I=\'?@9\1]8\$>)1X@_MO2G1+C['IRRQ99%<; M6,@SPP[5Q?\ P^(^ 'IXJ_\ !4O_ ,=K[$U'P#X8UB\DN[_PYI-]=R8+SW-C M%)(W&.6*DGBOS7^*'A/0X/\ @L#X"TF/1M/CTN33(B]BEJ@@8_9K@Y*8VGD# MM0!]!> O^"JGP1^(_C70_"VD#Q)_:FLWD5C:_:-,5(_,D8*NYO,.!D]<5]B5 MP_B'0_AY\-]$O?%&JZ/H&A:=I$37D^I/8Q1BW5.=^X+D$=LF.:P_CW_P % M"_"/[.GQO?P!XIT.]^S+HW]J_P!K6LRNTC$/LMTAVY9V90H.X#YLG !H ^KJ M*^;/V:_VR;C]H#Q+K.D:C\+/%GP]73[$:B+_ ,0PB*WD@+84[F"D$\D8##"M MSQSYCXK_ ."J/A9_&6HZ!\-?ASXN^+":8Q6\U'0+8F!0#@LF%=F7@_,P4''! M(YH ^X:*^*_#7_!4GP%XX\=?#CPKX?\ #VJ3ZGXKU,:3?6NH2+:W.BS>8B?O M8\-O!WD@JP^Z1P<@?1OQX_:!\%?LW^!I?%7CC5/L%@'\J""%/,N+N7&1'$G\ M3?D .20* /1Z*^!5_P""LEI;VT>NZA\"_B#8^!78%?$C6H,6PGAN5$?X"6OI MJ3]I31O$W[/]W\4_AOIM[\2K1(1);:/HR-]LN)-ZJT.P*S+(NXDKM)P/3F@# MN/#?Q/\ "?C'Q-KOA[0]?L=7UC0O+&IVMG*)3:,^[:KDW[0GB?P3\;_BBNG_"/Q/XF'BSQ##_:#:?%(?[ W7$V?M6(FQM\QLYV M_P"K;\/T6_:<_;%^'W[*FEV3^*KBZO\ 6]0S]@T'2HQ+>7/.-V"0%3/&YB,] M!DC% 'N5%?".G_\ !5K2-%U.P_X6)\'_ !U\.] OW"6^MZA9L\)ST8AD0D8Y M.S>?0&OMG1/%.D>(_#=IX@TS4K:]T2[MQ=P:A#(#"\)7<'#=,8YH U:\B^(G M[4/@OX8?&3P9\,M9_M'_ (27Q9M_L[[/;!X.7*#>^X;>5/8U\]^*O^"J7A>3 MQCJ.A?#7X<>+OBQ%IC%;S4M!MB8% )!9,*[,O!^9@H.."1S7SK\0/VD/"?[3 M?[>G[-7B/PL+RU:TN([+4-,U*'RKJQN!PU0 MQ9$9O;5)MF>N-P.,X% 'QE_P^(^ 'IXJ_P#!4O\ \=H_X?$? #T\5?\ @J7_ M ..UY=_P63\(:%X=^&'PWDTG1=.TR277I%D>SM(X2X\D\$J!D5]\^&?ACX.D M\-Z2S>$]#9FM(B6.FPDD[!_LT <#X]_;1^'?PXTSX9W^K_VMY'Q"$1T7R+0. M?G\O;YHWC9_KD]>]>\5^:W_!66YT_P ,^//V<;B8PZ?I=AK4DCL%"1P1)+:D MG Z *.WI7=>)?^"KVB6GVO5?#'PA\=>*O ]HY2;Q7%9F"S(!P74E6&WTWLA] M0* /N^BO-/V??VA?!_[2_P /8/&'@R[EFL&D,$]M=(([BTF !:.102 <$'() M!!!!->2?M$_\%"O GP(\:+X'T[2-8^(?CTXWZ%X$/$OCVQ\&?$+P7XE^$.O:@RI9CQ-;E+>5F.%4NRHR$G@ M%DV_[0KV3]K+]I2T_94^$Y\<7NAS>(8!?0V/V."X$#9DW8;<58<;>F.] 'L] M%?%.F_\ !3G1_%'C+3].\)_"GQKXM\.7%Y#ITGB;3+4-:+/LCU#4;4D#_:*.D;%1 MU.SLT5\.S_P#!4G1=>MM.B^'WPL\7_$S5SI\-]JUKXA9BJCZT M =O3)YEMX9)7SM12QQZ 9KS?]G/XQS?'[X0:%X\D\/3>&(M85Y;>PN+@3/Y0 MQD#'0BO0=4_Y!EW_ -<7_P#030!\T_!C_@HQ\(/CK\3[7P%X=GUF M'7KKSA"-1L1#$[1J690P<\X4XXYQ7U!7\\?PITO4/ASHEM\=M'5S<>#O'D%M M>!">8)%WKGV)1T/_ %T%?T&>']QU"VCNH)%.0T;J&4_D10 M!Y)^TK^UY\/OV4K/1)_'$]^&UB21+6#3;83R$1@%F(++A1N49]37H7PO^(^D M?%WX?:%XRT'[1_8^LVRW=K]JC\N78-/BG9Z>Q M6YU/1[-E@ '\2@([[?=U3->P?LO_ +\76"E[KP[K<8B MN54'#,A!(=0>#C##NHH ^B*S/$_B"U\)>&]5UR_W_8=,M);R?REW/Y<:%VP. MYPIXKRC]IS]KCP%^RCX;M=1\7W-Q*^8?%/_ 4RT3Q-X%\2:#XX^&7C#X8P:_HU[;:1JVMVC?9+F1[=PBERBD;B M0 0&'/) YH ^OOV?OV@/"O[2OP_'C'P?]N_L,_[0^Q:G>BP@_LZW$S^85+<@L,#"GFNY\4?$#P[X'\)R^)O$>L MV>@Z%#$)I+[4)EAC0$9 ))ZGL!R3P,UX+^W7\=/!GP'\ >&=4\:_#JQ^(]C? M:LMI!8W\<+K;RF-F\T"6-QG (X //6OFS_@KY\5M5?X2:7X(A\!ZN- NI+'5 M?^$L2-O[/@D_>@6A8)M\S&#C=T[4 ?H/K7Q$T71?AS>>.7GDN?#UMIC:OYUO M&2\EL(O-W*IP0#BL'X"_';PS^T=\.[;QKX1^V_P!BW$\MNGV^$0R[HVVM ME03QGWKP7]G?]H[4O%?[,GB"[\7?!_7?#FC>$/"\!6+Q!"5@U^!+5MWE>9$% M*,L8_O#$@_'TC]B[XM>%_C5\";#Q3X1\%VGP_P!$EO+F%-%LDB2.-D?#/B-$ M7YCSTH ]VHKXR^)O_!3OP=X=\>7W@WX>>"_$OQ>UVP9DN_\ A&K<@9*QMQE@ M.=K*K8Z X- 'U'17B_[3?[6?@;]E3PY8ZCXL>\O+_4I&BT[1M+B$MW=L,9V@ MD *,C+$CJ ,GBOG0?\%6[+PW69,9ST.'6,$=_ ME9CZ T ?>=%8_A#Q=H_C[POI?B/0+Z+4]%U.W2ZM+N$_++&PR",\CZ'D'@UL M4 %%%% !1110 4444 %%%% !1110 4444 %-?E#]*=37P$.>F*3V _-WQ-SX MDU;O_I+M5LG#)<*V(XXP)8U< 1C"$ @C*XX/6J_B4Y\2:M_U]R] M_P#;--77KU5 \Y0 ,#]VG^%?C\I*-26MO^'9^+N?+.7O6U(+V_N-0,37,K2M M&NQ6;DXW%NOU8G\:UHO'&LP&W9+I1)#M"R^2F]@HV@.V,L,<8;/%4O[?O?\ MGLG_ 'Z3_"C^W[W_ )[)_P!^T_PH]I;:8E4Y7=3?X?YD\WB[59[F&=KD"2&2 M.2()&JJC(,)A0,# Z4]/&>K1I:J)T)MQM1S"A8I@KL9L99<$C:>.:J_V_>_\ M]D_[])_A1_;][_SV3_OTG^%'M/[Q7MG>_._P_P R/4-7NM4 $[($$C2".*-8 MT5B%4X50 .%7\JDCUZ_C4HERX0P?9MO&/+SNQCZG/UH_M^]_Y[)_W[3_ H_ MM^]_Y[)_WZ3_ I*:O?FU)]HN;F4W?\ KS+H\;:NM\EXLL"W*C_6"VCRQSG< M?EY;/.X\YID7C+5X/LQ6Y7S+=@TR?\ ?I/\*KVK_G*]M+_GX_Z^9+>>*M4OF!DN=H4QE5B14"^7 MNV8 QC>V,>M+<^*M1NI [2QH=\8'5N[\[_ *^92EE>>5Y)&W.[%F/J3UHC/[Q? MJ*N'7KT_\M4_[]I_A5)6+3!B M(J/<;(U.?QK&\3:IX&_9\\ :IK5S'I_A7PY:/)>7 MH5C5Y78LVU% W2.QX M!))KO)6*Q.0NXA2<#O7Y]QO\TQ+'3 M?2XE#39FG/\ >887^$4 5?&MGXK\(_L@?M#?$JZL)_#-[\1=4&IVNE'Y9K.P ME\FW0R ?=E>/$M(\#>#-%T'1(8K?2M.LXK>W2$ +L50 1CU MZ_C7FE@-9_:3^&_C+PG\1/AKJ?P\LK^V^Q+%?:A:W;3K(K?O$:!V"F,A3ANY M'O7GWA#Q+^T+\(O"]MX)NOAC%\2KK38Q::;XNLM=M[2"YB48C>YBD^=& VAM MH;.": (/@IX1T1?VDOVD/A[-IMIJ'@N^FTW6)])N(EDMA=7,&9_D(Q\S*K'W M&:[S]J7XFZ=X&^'TW@G2=.36O&?BNTFTG0?#=M&I,S,A0NZ]$AC#!F8\ # K MEO"_P\^(_P !?A)X]\86&DP?$;XV>*KT:C=6=O.EO;I(P6.*!'D*CR8$R<$@ MMAO45YC\#I?B[\,[[4?%?B;]GOQ1XR^)6L@#4_$EQK^E)A 3M@MX_/(AA4' M5>N,GM@ ^IO@QX&O_@Y\"/"OA4XU75-!T:*U8!\">9(^54GH"W )]C7S)\$_ M'.J_#_XSS^(OCYX/UCP]X^\9WG]F:/K5P(KK2+"#)\FP@DC=C"6ZL6 WMWXK MV_QMXA^-5]X=\)>+/!WANPM+U-YUOP%KUU&L\JDX7R[R,LBNN.F"IW>U>?>- M-!^*_P"U1?\ A?P_XB^'/_"L?!NFZQ;:QJMWJ>K6][=W9MWWQPVZ09VAF R[ M,"!V]0#ZWB.2:EJ.--GTZ5)0 4444 )FC-&:,T &:,T9HS0 9HS1FC- !FC- M&:,T >?_ +0I_P"+"_$?_L7-0_\ 2:2ORH_8&_8_^(GQU^"=SXA\+?M">)_A M?IL>K36IT71X[AH6=4C)E_=WD0R0P'W<_*.37ZK_ +0I_P"+"_$?_L7-0_\ M2:2ORI_8%_X*+?#K]E7X)W/@[Q5H7BC4M2EU:>_$VCVUM)"$=(U S).AW?(> MV.G- 'TE_P .U_C1_P!'E>//^_-[_P#+*OM3X/\ @C4_AM\,_#WAG6O$UWXR MU33+407&O7X83WK D^8X9W;//=VZ=:^+?^'UOP5_Z%/Q[_X V7_R77L?@_\ MX*%_#;QK^SSXM^+]O:ZOI&@>'[AK)K76(X8KBZN=BLD40CDD!+EU Y]21@9H M ^%?V_;:]_8C_:(U'Q-\)_$D&A2?$32+E-4T6 _/:ESM>95'"AFRZ-U5P^.* M^\O^"??P'\*?!3]GC0;CP]?VVO7_ (DMX]5U+7KW1D558(Q"0L44 N# MM8X&#FO%_P!K[]NH_M$_LZ>,M!\._ WQL_AR:".67Q1KMH+>VT_;*C++\HD4 MG(P!O'WJPY/%3?L._M[_ !&\=_%OP5JNN^'?$DL\VC>)K2S%Q]G620.K1ER% MR%_=L P90. 0>>P_:R_:]U_]K;X!^+/#?P=^''B>;PJEF;W7_%6MV@M;:*UA M(E:.'YFWNVP=\X!PIZ@ [_P%,\W_ 1XF:1BS#P;?+DGL)90!^0%=9_P27\& MZ9X<_8_T35;2UBCU#7+V[NKRX"C?*4E:) 3W"J@P.V3ZUY_\)-_X);G_C";P)_OWO\ Z52T ?..G^ - M"UG_ (+.ZJMUI\$L-K8C5TB9 5-T+./$A'J&;=GU ->R_P#!7S3K:\_8]O+B M:%))[36K*2"1@"8V+,I(/;(8BO//#1_XW.^(O^Q>_P#;.*O2_P#@KF?^,,]7 M_P"PO8?^C#0!Y;^WC.]U_P $O/AW+*Y>1XM!+,QR2?L]?:7[,/PZT;X5? +P M-X>T2UBMK6+2;>:1HE ,TTD:O)*Q[LS$G)KXI_;J/_&K7X<_]<=!_P#2>E^# MG_!2L? CX2^&?"7QC^'GBVT\2V6EV\>FWNF6D#\H &7%C;_ >_X+#Z9;>&XEL;'QCI#2ZG:6XVHSO#(S,5''+P*_U)/>K_ M ,.#_P ;E/B#_P!B]_[;6M:'['7PR\>_'O\ :CU_]IOXC>'+CPCI[VQLO#6C M7JLLWEE/+5]K ':L>[YB!N:0D# K/^'!_P"-RGQ!_P"Q>_\ ;:UH \2\2_%G MQ1%_P4U^(GBNP^%.H_&;4O#!>QT[1;.=D.GK&$C6X&(9>A+X^4?-)G.:]O\ MBQ^U?\8_C#\./$/@W7/V+O%K?$;4HC;6J7.G1E+&1ACS"(WD+LN<@8 MXR2!Q0!8_9,^!'Q)\$K$PCF08(SY9E MW@D=B:\S^$G[7_QB_8-\"Z7\._BG\"[^?PUHF^"WUW32T*E"Y8GS0CPS'+'D M,AQC/-?6_A7P=^T7;_L:WUKJ/C8R?'*XMGO;6ZDM;0BV;(9;,_N_+8E 5+D' M#.?FP :\#^%O_!5^#[7PG\??!/C/3OB!IJFVNKB+38R+\@D!RCO'M8C& M0 5/4'!Q0!ZS^QK\5?V;/C;\3/%7C;X8Z5-H'Q,U6$S:U::DTL5S+&S*6=8O M-:$KN"DF/G/)QNY^Q'6T_PW\,?&=_\2)(_*B\/RV:&)+@C&&=' M,C*#Z1ACTPM '/\ _!,I&^'/[3W[1/PPTV5SX7TR^:>T@+96(QW#Q#'N490? M78*N?L'G_C8!^U#_ -?4G_I6U>B_\$W?V:O&'PKTSQI\1_B3 UEXZ\=W?VN: MPD'[RUAW-)^\'\+N[DE?X0%!YR!YU^P>?^-@'[4/_7U)_P"E;4 ?HSFOSH_X M+6Z7!MN?\ O@BOT7S7E/[4?P&L/VD_@CXC\"7D MJVLU[$);&[=(OV)M,@^#?[0O@W7+./1,V^DZ[80B4/;@ M_*N&*B6,?PR(Q., KQ72_'#_ (*H6/Q0\/7/@3X >%_$?B3QKKD36<-[)8[! M:JXVL\<:EG=P"<$A57J2<8H ^^=$^(OA7XB:!JESX6\2:3XC@MXWCGDTJ]CN M1$^&^5]C':>#P<'@U\"_\$6C_P 4I\7O^PY;_P#H$E>\_L&?LJW7[+7P O[/ M7BC^,M?+:AJ_EMO$+;"(X P^]L!.2.-S-CC%?GQ^P'^W9X$_9#TWX@:9XOT? MQ%J<^LZI'WOH8 MYP!(J26DCJ& ) .&&<$C/>@#[^^&I_XMUX5_[!5K_P"B5KB?VM=7M=$_9B^* M5Y>.J0)XW,B_\ !-G3+FP_X)U^-)YP5BO'UF:#/=!;A"1_ MP)&_*H_^"47@C1OB5^Q3XQ\+>(;-+_1=6UR\M;JW?^)&@A&1Z$<$'L0#7U?9 M_"C2?@=^RCJ'@;1WKOX+U^Y^T^&=5N#B,22'$9!/ $N-C#M M(ON36Y_P3M/_ !G#^U%_V$)O_2Z6O?O^"@O[)R?M-_"!Y]&B$?CWPX&O=%N$ M^5Y2!E[R7*XE:8W#[RX M_O;LY]Z /UCS7YR?!<_\;@_BU_V!&_\ 15I7Z-YK\Y/@N?\ C<'\6O\ L"-_ MZ*M* /KO]K3X^P_LT_ CQ'X[:T34;RT5(+*SE)"37,C!(PV.=H)W''.%-?"' MP$_X)J7/[17A7_A;/Q%\7W7A'5_&$9U"#2/!EG!80PP2DC;5EGA;<(R3P-PW+D\ D5\N?LS M?\%+?!?PC^&.E?#GXT:=KG@KQGX3METN5)=-DD6=(AMC.U1N1]H (9<<9!YX M ,']GU=9_P""='[56E?!?7$TO7_!7CUU;2_$T5@EO?B1F*1K*Z\N _RE&+ ; MPRD9*U^GF:_,#PYK.L?\%&?VT_!/C_0/#VHZ/\)/AXZR1ZMJ,7EM>2I)YFU< M9&YG"#:"=JKDX)Q7UG^TS^VEHO[,WQ!\!^%-3\-W^M7'BV7RX+BTF1$M_P!Z MD>6#/2@#Z,S7P]^U]^W5?:=XB/P8^!5LWB_XLZFQLY;FQ DATDGAOF^ MZ95&2<_+'@ECD8IW_!5#]JW6/V?OA3IGAKPI)_%IEA&H1'#VEJ@'FLA[ M.Q=5![#<1R!7RK^QW^W'^S9^RAX*2*W\'^.-6\;7\8;6?$+Z?9-)/(>3'&3= MY6('H."<9;GH ?>'[#G['MM^RQX'O;C5[Q=;^(/B%A2JEB M2QY9B3Z ?3.:^4_V:_\ @H_\./VI/B1_PA7A;0?%.G:I]CEO?.U>UMHX-D97 M<,QSNV?F&/E_&OJS- !FOS/^*I_XW,_#_P#[!<7_ *2W%?IAFOS/^*I_XW,_ M#_\ [!<7_I+<4 ?;O[3GA/P!XU^"GB+3?B?JC:/X'V)/J-VEX;;:J.&7YAR? MF"_+@[C@8-?)G@?_ (*3_!'X8>$]+^'_ ,)/ WCGQI8Z+"MI9II.DKLE _B9 MF<2%F.228\DDG%>E?\%1OA+XP^+_ .R_''\#ZCXMT^:33=(N7!>"V:VDB MMXW/:3]UR" MZ9*\%W"X/@[\=O /B>RU#P\[VVEZEI=HDR7<&\E5&]T# M9(5T+ C .,<@&G^V;\.=%\,?\%(/V(=5M3J'E*%\Z2&Y15E;' M5BK@$]]HKD/^"BWC35M4_;T^&.@IX,NOB38>'["'4+?P?;R%?[1E9Y)''"/V MB3/RG(3'>N1\??&/QE\>OV_OV?\ Q=KWA'4/!?AFXU>SC\-Z?JJ[+F6U6Z&^ MX=>Q=C],*,%L9/TM_P %"_@'X^@^)?@3]H/X4Z9)KGB?PAMCO])MXS)+/ CE MU94'+C#R(RK\VU@0.#0 Z[_;G^-^H:=-87/[%?BJXL9HC#);2:C*T;QD8*E3 M88((XQ6)_P $KO!7Q%^'GBKXKV'B7P!KO@'PEJEQ'J>E:=JT+K' Y=P8D=E7 M<0A0$@#(0' JU)_P6&\'3>'&M+3X:^,Y/B&8_+7P\;2,Q"XQ]TR!]Y3/?RMW M^S7LO["47QWU7P5K7BCXX:K MQT[1;.=D.GK&$C6X&(9>A+X^4?-)G.:V/V=?V@+/]B']K#XP^%_B-X9UZ'_A M,/$2C3[RU@38%:YEV2MYCIF)EF5MR%NAX->D_M)^ ?B'^R'^U_-^T7X$\+W? MC/P;KL/D^(M,T]6:6'*JLFX*"54E$D5\$!@0V,C(!>^+'[5_QC^,/PX\0^#= M<_8N\5S:=K%G):L9=0ED\IF4[) #8CYD;##D<@C M^+=%UCPOJME>/IUA%J<#P3+9W,D(?:&P=N9)AGW-=_X__P""L%E\0_"-UX=^ M"O@#QGJWQ&U*(VUJESIT92QD88\PB-Y"[+G(& .,D@<5[IX5^ OQ$^+/[&&J M^ ?C5XD;5O&WB*RE:6X>&%?[. ='\" M?L@_#]M,MHH;C6+(:I?3HH#SS2DDECWP-JCT"BOFK]K+X=:/X4_X*<:[\:?%W[07_!0?X$>-M:\ M):CX.\+76IPVWANSU1-D\]M'*2\[#_:=^H^7@ %L$T ?L1FC-&:,T ?G'_P6 ML/\ Q:SX9_\ 8P2?^B37Z$^%C_Q3&D?]>$M+_ &D(;1<6>D:R)+:W_A78 MMT, ?2-1^%> _L'?'SQ_X!O_ !_XXT'X :W\8]?\0:FQN_$MC=O&UMG]XT&1 M;2\LSACR,_+QP*^C_P#@DS;QW>O?M(03*'BE\1Q(ZGH5+78(K@_ .O>-/^"5 M_P 7?&>E^(?!VL>*O@KXCN_MEGK.C0^8;8@G83DA0X4[&1V7.T,I('(!6_:_ M^*'QD_:U^%P\*WG[(WBS0-3M[J.[L-<\^6ZDM&!^<*GV1"0ZY4C<.QYP*[3] MNVX\27'_ 3 \!GQA:75AXG2;2HM0M[Y"DZ3)'(IW@\ACMR<^M.^)7_!0#Q_ M^U--I/@K]EWPKXGT_4[BZC>^\4ZE8Q)':1@\KUDC5.[,Y!P,!2378?\ !5'3 M=5T?]A/2K'7=6;7=:M]3TV*]U-HDB^U3!'#R;$ 5#O MV.M3N M]8UWXLZS$4OM/TT&_DM0^T_*'*I"Q55&W>#M[ &OK/X"'_BQGP[_ .Q=T_\ M])HZ_,CP3XY3]@C]LWXI>(/C)X*U?5;'Q)=33Z/XLM+(7&Q'F:0-&SD##*P5 M@K;E* 8(H T_VVOVV9/VC_VCZ+\#_&=IX;$EO<-XLU^U%O;V++,NUAM5 MU+-G9@2 _.>M>E?%.9Y_^"->E/(Q=O\ A'-,&2?2YB _05Q/[:/[5OB3]K?] MG[Q)I7PK^'/B6+P#8QKJ6O\ BO7;46L30Q.&$4"[CO.[:QP<@*?EQS71>,M< MM==_X(OV4MI,LRP:-9VLFTYVR1WJ(RGW!% 'U#_P3^^'.C?#C]DSX>Q:5;10 MS:KIL6JWTZ* UQ/,-[,Q[X!"CT"@5\Q?M*:=;_"?_@J;\$?$/AV-+"[\6)%; M:JD VBXWR/;L[@=24*Y/%HX1+J?V0WVG<1@?[ MV"GT8U\%?\$Q-.U[]HCX_+\1_%B/-;_#KPW:^'=/,N2!.$,:GG^(()2?=Q0! M^IO@[PO8>!_">C>'=+B$&G:59Q65O&.,1QH%7]!5[5#_ ,2R[_ZXO_Z":LYJ MMJA_XEEW_P!<7_\ 030!^2_[ OPFB^./[)'[2/@UHUDN=0U#-ID?=N4B,D)' M_ U7\Z^AOV&?VG;?3/V!M5UO7IL:C\-K>ZT^[BE.'(A4M;J?J&2,>ZUQW_!& M _\ %$?%K_L88_\ T6U?-_[2/P_\5_#_ /:L\?? ;PPC0>'/BWK.FZ@BID!8 MVF,C;0.RN9 ?9!0!WY^'=YX?_P""4GQ(\QB+/L M1NFRS<(MU$[,@8]@W*D]MV: /H?]D3X<:)\+?V6)9))&/\ $26ZGL .@KXN_;MT>U^$'[>7P!^('AF) M-.UK7KZ.UU+[,-OVH">.(LX'4M',4)/4*/2G?!#_ (*+W'[,/@+3?AE\>_A[ MXMT?Q)XXL/$D27VF^#]'6;3K.X&Z-72"-U;:>,B2=G^JCTK[<_:8^'>C_%3X#>./#V MMVL-U:SZ5<21F50?)F2-GCD7T96 ((KY#_;-^&'CWX$?M.^'OVG/AQX=G\66 M<-N+/Q)HUFK-*8PAC+[5!.UH\#< =K("1@UB?%K_ (*9)\>/ACKG@GX-?#SQ M=?>,=6L)K:\FU"TCC@TJ%D(FD9DD;)5=V"VT#J3Q@@';_P#!)K3[75?V([^Q MO96@LKG5]2AGE27RF2-HXPQ#_P ) )Y[=:Y+X<_MB_LM?L;0:MX#^%EAXI\; M33WKW%Q+H=H+PS38"[?/E:,NJXP"H8&O'%O?S M/<3VFDJ\M_EOE#[F5]R_='5< $'F@#COVM/V@]6^/OQX^ _B"Y^$_B#X;V]I MK<4-EJ?B",Q3ZDAN8&PJE%PJ'G(9AESTKW__ (+ GYO@1_V,.YC^ LT3B2*3Q#(Z.IR&!\@@B@#0_X+.'_BR?P^_[&9/_ $1) M6W_P5F/_ !A)IO\ V%]-_P#1 M@?"#]KWPO^T9^QK\1O"^DZ5JNDZYX/\ IM=1CU!(Q%(PLY(]T3*Y)&8SG-X-2GEO+CQ787LD2ZBV\J.EH_" ; -YZ$\9-5OVH M_%/QP_:1\;?#_P 6:7^R_P"+O 7BOPK?+.FLQ-+=R3QAU98VQ;1$!64D$D_> M88YKJ_V>/VHO%/\ P3KTF]^$?QQ\"Z_)X>L+N631O$6C6XFA>-V+%5+LJNA) M+ AMR[B"OIV]K^U9\9_VT/C1X5L/@7INO_#SX::=-YFL^)]6L(3]IC)&X8=9 M(\A00B*68ELG ' !T_\ P4 ^!/Q2\2^._A9\:OAGHL7B;7?!JAKCP[.H=B0X ME5UC)&_DLK*IW?=(Z<>=:Q_P4\\(>,]#O_AS^T=\%?$'A>SU*/[/?P()&5AD M'<8W$,L>" +/AA8_)XB\,6%G$\A( M)S(SK&90K(W4':K(,C!Y\?\ C3_P4P^&GQ\^%FM^!O#GPK\6>,?%FL6DEG;: M/J&D12);SNI42'9)(VY"DYKYC_X)S_ SQ)^S]^S'I/A_P 6QFUUV\O) M]4FL2VXV8EVA8CCC< @) Z%B.U?3F: #-&:,T9H ,T9HS1F@ S1FC-&: #-& M:,T9H ,T9HS1F@ S1FC-&: #-!P011FC- 'D]W^S#X$O;N>YEL[HRS.9&(NG M').3W]ZC'[+7@#_GRN__ ,?_&O7,T9KB^I8;_GVON.'ZAA?^?:^X\C_ .&6 MO '_ #XW?_@9)_C1_P ,M> /^?&[_P# R3_&O7,T9I?4<-_S[7W"^H87_GTO MN1Y'_P ,M> /^?&[_P# R3_&C_AEKP!_SXW?_@9)_C7KF:,T?4<-_P ^U]P? M4,+_ ,^E]R/(_P#AEKP!_P ^-W_X&2?XT?\ #+7@#_GQN_\ P,D_QKUS-&:/ MJ.&_Y]K[@^H87_GTON1Y'_PRUX _Y\;O_P #)/\ &C_AEKP!_P ^-W_X&2?X MUZYFC-'U'#?\^U]P?4,+_P ^E]R/(_\ AEKP!_SXW?\ X&2?XT?\,M> /^?& M[_\ R3_ !KUS-8&N_$'PSX8UO1]&U?7;#3=6UB1HM.LKJX5);QUQN6)2-/&&C>%OM_F?9/[6O4M_/V;=^S<1G;O7..FX53U+]H M'X::/X.LO%E]X\\/VOAB]G^RVVKRZC$+6:;:S>6LF=I;"L<9S@&CZCAE_P N MU]P?4,+_ ,^U]QW-K:1V=O'#'D1QJ$4$]@,"IA@5Q'A#XY?#SX@:;J.H>&O& MNA:]9:=&9KR?3[^.9;= "2SE2=H !.3Z59T?XO>"/$%[H-GIGBO2;^ZUZU>] MTJ&WNT=KZ!/ORQ 'YU7N1P*[4DMCO.NS1FD:14'S'% M\3Z3KFHZ8$:]M=/NTG>W#9VEPI.W.TXSZ&F!U&:,U@6'Q \-:KXKU'PQ9Z[8 M77B+3HEGO-+AN%:XMXVQM9T!RH.1@GUJ+QM\2O"?PVTQ=1\5^(]+\.6+$A;C M5+I+=&(ZX+$9QD=* .DS1FN,\8?&KP#\/HM.E\3>,=$T"/40&LVU&^CA^T X MP4W$;AR.1766-_;:G9PW=G/'=6LR"2*:)@R.I&0P(X(/K0!/FC-)YB\\]*R/ M$?C+0O!\-I-KFK6FDQ7=U'96[WDHC$L\AQ'$N>KL> HY- &P<$$'O3$C5.Y/ MU-9>A>,=#\4/J*Z1JMIJ3:;=R6%X+64/]GN$QOB?'W77(R#R,U6\'_$'PS\0 M=/N+[PSKMAK]E;W#VLMQIUPLR1S)]]"5) 89&1[T ;IC4L3DY^M+Y:U@R?$+ MPS#XSC\(OKM@OBF6T-\FCFX7[4UN&VF41YW;<@C..U5?''Q7\&?#.V@N/%OB MG2?#<,^1$^J7B6XDQC.W<1GJ.GK0!TYA4]STQ2E%9<=JX+Q%^T!\-/".@:7K MFM>//#^F:-JC,MC?W.HQ)!K>&?%VC:] MIEH";B\T^]CFBA !)+LI(4<'D^AH ZT1*#G/-*$ [UQ_ACXS^ _&NGZI?^'_ M !AHNM6>EAFOI[&]CE2V"@EC(5)V@ $Y/I6/X-_:7^%'Q$\06^A>&/B+X;U_ M6;@,T-AIVI1332!1N8A5))P 2?I0!Z5FC-&:,T &:*,T4 +1110 4444 %%% M% !1110 4444 %%%% !1110 4444 %%%% !1110!\7_\%;-%U#7OV2)K73+" MYU&Y_MRR;R;2%I7P/,R=J@G%?2OP&@EM?@?\/89HWAFC\/V"/'(I5E86Z @@ M]"*[NB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH HZOH>F^(;,VFJ:? M:ZE:L'[:GA;XSOX1U+PE\*_!,( M&ESZQ%Y'?L06-SIG[)/PKM;RWEM+J+0X5DAG0HZ'G@J M>0:]QHHH ^+/VS?^"@-C\$M7U_X5Z'X2\1ZM\2;ZP1-)FMK>-K-VG0A'4AS( MS*2?E$?)7&>]>B?L!?L\W7[.?[.ND:/K,'D^*=5D?5M8!Y9)Y<8C)[E$"J?< M-7T:44L&*@L.AQR*=0 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% M !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 M%%%% !1110 4444 %%%% !1110 5^5'[25SXZ_:(^,'CCQOX(\#:QXDL/ TD M6D>&-=TZ\BB@L;VSG6XNYRC',I8@1_+_ C'6OU7JCINAZ=HULUOI]A:V-NS MLYAMH5C0LQRQ( R3U/>@#\[/CU\1[GX[?$C]CSQ?X1\,:/XRU#6K'Q#/'X? MUR98[2646< FCE8JX!C*R$9!^9 .,UQ'QL^ WB_X0?#/PA=:MH?AW^W/%GQK MTC4[7P5I[@B MI*HP%#*,C*@XKGO@S\0/#?PQ\9?L?Z]XKUBTT#1H/ .J(]]>OLC5F8A03VR3 MBOU N/#&CW>H/?SZ3937SPFW:YDMT:4Q'JA8C.TY.1TJA>_#CPGJ-O:6]WX7 MT:Z@M$\NWBFT^)UA3.=J KA1GL* (? ?Q#\-?%;P^FM^%=:M->TAI&C6]L)! M)$74_,N?4=_K7P=&FO\ P2_:+_:K@^#/@>'4M=CTSP]'IVD:?$D<<4DULQ>< MIE0VUF9R,C<3SUK]"M&T'3/#ED+/2=.M-+M Q806<"PQY/4[5 &:=#HNGVVI M76HPV%M%J%T%6XNDA599@HPH=@,M@<#)XH _,O\ 8N@\4>#OVM_B%IL?A7Q% M%XMU3PE%<7MYXMDCR-0.Z3[1<^6[%899,*H3) (&*]*_;(\->/\ Q'^QQ\3- M4^,NA^!9-9T:"";0;CPRUS/]F+SQ+*Q:X12K$8'R]B:^Z8]#TZ+4Y=22PMDU M&5!%)=K"HE=!T5GQD@>A-/U/2+'6K&6RU&RM[^SE&)+>ZB62-QG."K @\@&@ M#\W?VB_[%^'GQ1T?Q?=>(/A_J%WJ/@2TM)/#WQ"LKBZ^S1*IQ+9B-&#.Q!!C M)4MS\P!S7U)_P3YT+Q#X:_9!^'5AXG6>/54LY'\JY4K)'"\TC0J0>1B(QCFO M==0\+:+JPMA?:18W@M2# +BV23RL=-F1\OX5IJH08 P/04 ?.'PJ\.?'RP_: M6^(6H^-=:TV\^%%P9/[ LH"IDC^<&(;0 RE4R'W9RQ!%>&_\%$I)=?\ C%\' M?#BZ+XWU.".XGU:>/PMJ0MO/BMT9B8@9%"SQN8W\PXVJ3M.>!S5.Z MT/3KV[BNKBPM;BZA1HXYI859T5AAE5B,@$=0.M 'YE? [QMJOPA_8D\9>)M' MT_Q6/&?Q!UV2QT[W[4U]7:+<18,'M(OLR;;=AT,8QA#[C%2:IXNW%E:^)/[0LO$*7<7V<>&XU-NUOY M&=Y+*6H:9#IMUHVGW.G0@"*TFM4>*,#IM0C Q["@#\[/V@[KP;X@C_9JE^"GA/1M8 MT*7Q;J7]GZ)?6[6-A>S>7F0,'0_(3DAMI7@8J+X(:CX2_P"$N_:/\8_%O0- M^'.D6&F6NA:]X"TQ6"; V1=.JJHD,K,BQNG7=VR"?T=E\-Z3.]B\FEV_%_QM\3M&'A[PMH:>$VTNT\!:0%DNFTV"4/)>WD$: ME3*V40*-QP<')/.)^SIXE\)S_MT:=J_@VX\-^/M,\7V=Y(DNFZ0]C<^$+>%- MT<3(,1KYA;8QV[R1DG'7]#M$\!>&?#5VUUI'AW2=*N60Q--9644+E"02I95! MQD X]A5S3?#>D:-=7-SI^EV5C<7)W3S6UND;RGU8@ M^- &E1110 4444 >? M?\+\\!?]#':_DW^%'_"_/ 7_ $,=K^3?X54_X9P^'G_0NK_X%S__ !='_#.' MP\_Z%U?_ +G_P#BZ\B^8=H?>_\ (\C_ (4NT/O?^1;_ .%^> O^ACM?R;_" MC_A?G@+_ *&.U_)O\*J?\,X?#S_H75_\"Y__ (NC_AG#X>?]"ZO_ (%S_P#Q M=%\P[0^]_P"0?\*7:'WO_(M_\+\\!?\ 0QVOY-_A1_POSP%_T,=K^3?X54_X M9P^'G_0NK_X%S_\ Q='_ SA\//^A=7_ ,"Y_P#XNB^8=H?>_P#(/^%+M#[W M_D6_^%^> O\ H8[7\F_PH_X7YX"_Z&.U_)O\*J?\,X?#S_H75_\ N?_ .+H M_P"& O^ACM?R; M_"C_ (7YX"_Z&.U_)O\ "JG_ SA\//^A=7_ ,"Y_P#XNC_AG#X>?]"ZO_@7 M/_\ %T7S#M#[W_D/_A2[0^]_Y%O_ (7YX"_Z&.U_)O\ "C_A?G@+_H8[7\F_ MPJI_PSA\//\ H75_\"Y__BZ/^& O\ H8[7\F_PJI_PSA\//^A=7_P+G_\ MBZ/^& O\ H8[7 M\F_PH_X7YX"_Z&.U_)O\*J?\,X?#S_H75_\ N?_ .+H_P"& O^ACM?R;_"C_ (7YX"_Z&.U_ M)O\ "JG_ SA\//^A=7_ ,"Y_P#XNC_AG#X>?]"ZO_@7/_\ %T7S#M#[W_D/ M_A2[0^]_Y%O_ (7YX"_Z&.U_)O\ "C_A?G@+_H8[7\F_PJI_PSA\//\ H75_ M\"Y__BZ/^& O\ H8[7\F_PJI_PSA\//^A=7_P+G_\ BZ/^& O\ H8[7\F_PH_X7YX"_Z&.U M_)O\*J?\,X?#S_H75_\ N?_ .+H_P"& O^ACM?R;_"C_ (7YX"_Z&.U_)O\ "JG_ SA\//^ MA=7_ ,"Y_P#XNC_AG#X>?]"ZO_@7/_\ %T7S#M#[W_D/_A2[0^]_Y%O_ (7Y MX"_Z&.U_)O\ "C_A?G@+_H8[7\F_PJI_PSA\//\ H75_\"Y__BZ/^& O\ MH8[7\F_PJI_PSA\//^A=7_P+G_\ BZ/^& O\ H8[7\F_PH_X7YX"_Z&.U_)O\*J?\,X?#S_H7 M5_\ N?_ .+H_P"& O^ACM?R;_"C_ (7YX"_Z&.U_)O\ "JG_ SA\//^A=7_ ,"Y_P#XNC_A MG#X>?]"ZO_@7/_\ %T7S#M#[W_D/_A2[0^]_Y%O_ (7YX"_Z&.U_)O\ "C_A M?G@+_H8[7\F_PJI_PSA\//\ H75_\"Y__BZ/^& O\ H8[7\F_PJI_PSA\/ M/^A=7_P+G_\ BZ/^& O\ H8[7\F_PH_X7YX"_Z&.U_)O\*J?\,X?#S_H75_\ N?_ .+H_P"& M O^ACM?R;_"C_ M (7YX"_Z&.U_)O\ "JG_ SA\//^A=7_ ,"Y_P#XNC_AG#X>?]"ZO_@7/_\ M%T7S#M#[W_D/_A2[0^]_Y%O_ (7YX"_Z&.U_)O\ "C_A?G@+_H8[7\F_PJI_ MPSA\//\ H75_\"Y__BZ/^&?]"ZO_@7/_\ %T?\ M,X?#S_H75_\ N?_ .+HOF':'WO_ "#_ (4NT/O?^1;_ .%^> O^ACM?R;_" MC_A?G@+_ *&.U_)O\*J?\,X?#S_H75_\"Y__ (NC_AG#X>?]"ZO_ (%S_P#Q M=%\P[0^]_P"0?\*7:'WO_(M_\+\\!?\ 0QVOY-_A1_POSP%_T,=K^3?X54_X M9P^'G_0NK_X%S_\ Q='_ SA\//^A=7_ ,"Y_P#XNB^8=H?>_P#(/^%+M#[W M_D6_^%^> O\ H8[7\F_PH_X7YX"_Z&.U_)O\*J?\,X?#S_H75_\ N?_ .+H M_P"&_\ (M_\+\\!?]#':_DW M^%'_ OSP%_T,=K^3?X54_X9P^'G_0NK_P"!<_\ \71_PSA\//\ H75_\"Y_ M_BZ+YAVA][_R%_PI=H?>_P#(M_\ "_/ 7_0QVOY-_A1_POSP%_T,=K^3?X54 M_P"&_\BW_ ,+\\!?]#':_DW^%'_"_/ 7_ $,=K^3?X54_X9P^'G_0NK_X%S__ M !='_#.'P\_Z%U?_ +G_P#BZ+YAVA][_P A?\*7:'WO_(M_\+\\!?\ 0QVO MY-_A1_POSP%_T,=K^3?X54_X9P^'G_0NK_X%S_\ Q='_ SA\//^A=7_ ,"Y M_P#XNB^8=H?>_P#(?_"EVA][_P BW_POSP%_T,=K^3?X4?\ "_/ 7_0QVOY- M_A53_AG#X>?]"ZO_ (%S_P#Q='_#.'P\_P"A=7_P+G_^+HOF':'WO_(7_"EV MA][_ ,BW_P +\\!?]#':_DW^%'_"_/ 7_0QVOY-_A53_ (9P^'G_ $+J_P#@ M7/\ _%T?\,X?#S_H75_\"Y__ (NB^8=H?>_\A_\ "EVA][_R+?\ POSP%_T, M=K^3?X4?\+\\!?\ 0QVOY-_A53_AG#X>?]"ZO_@7/_\ %T?\,X?#S_H75_\ M N?_ .+HOF':'WO_ "%_PI=H?>_\BW_POSP%_P!#':_DW^%'_"_/ 7_0QVOY M-_A53_AG#X>?]"ZO_@7/_P#%T?\ #.'P\_Z%U?\ P+G_ /BZ+YAVA][_ ,A_ M\*7:'WO_ "+?_"_/ 7_0QVOY-_A1_P +\\!?]#':_DW^%5/^&_\A?\*7:'WO\ R+?_ OSP%_T M,=K^3?X4?\+\\!?]#':_DW^%5/\ AG#X>?\ 0NK_ .!<_P#\71_PSA\//^A= M7_P+G_\ BZ+YAVA][_R'_P *7:'WO_(M_P#"_/ 7_0QVOY-_A1_POSP%_P!# M':_DW^%5/^&_\ M(7_"EVA][_R+?_"_/ 7_ $,=K^3?X4?\+\\!?]#':_DW^%5/^&_\ (M_\+\\! M?]#':_DW^%'_ OSP%_T,=K^3?X54_X9P^'G_0NK_P"!<_\ \71_PSA\//\ MH75_\"Y__BZ+YAVA][_R%_PI=H?>_P#(M_\ "_/ 7_0QVOY-_A1_POSP%_T, M=K^3?X54_P"&_\BW_ ,+\\!?]#':_DW^%'_"_/ 7_ $,=K^3?X54_X9P^'G_0 MNK_X%S__ !='_#.'P\_Z%U?_ +G_P#BZ+YAVA][_P A?\*7:'WO_(M_\+\\ M!?\ 0QVOY-_A1_POSP%_T,=K^3?X54_X9P^'G_0NK_X%S_\ Q='_ SA\//^ MA=7_ ,"Y_P#XNB^8=H?>_P#(?_"EVA][_P BW_POSP%_T,=K^3?X4?\ "_/ M7_0QVOY-_A53_AG#X>?]"ZO_ (%S_P#Q='_#.'P\_P"A=7_P+G_^+HOF':'W MO_(7_"EVA][_ ,BW_P +\\!?]#':_DW^%'_"_/ 7_0QVOY-_A53_ (9P^'G_ M $+J_P#@7/\ _%T?\,X?#S_H75_\"Y__ (NB^8=H?>_\A_\ "EVA][_R+?\ MPOSP%_T,=K^3?X4?\+\\!?\ 0QVOY-_A53_AG#X>?]"ZO_@7/_\ %T?\,X?# MS_H75_\ N?_ .+HOF':'WO_ "#_ (4NT/O?^1;_ .%^> O^ACM?R;_"C_A? MG@+_ *&.U_)O\*J?\,X?#S_H75_\"Y__ (NC_AG#X>?]"ZO_ (%S_P#Q=%\P M[0^]_P"0?\*7:'WO_(M_\+\\!?\ 0QVOY-_A1_POSP%_T,=K^3?X54_X9P^' MG_0NK_X%S_\ Q='_ SA\//^A=7_ ,"Y_P#XNB^8=H?>_P#(/^%+M#[W_D6_ M^%^> O\ H8[7\F_PH_X7YX"_Z&.U_)O\*J?\,X?#S_H75_\ N?_ .+H_P"& M O^ACM?R;_"C_ M (7YX"_Z&.U_)O\ "JG_ SA\//^A=7_ ,"Y_P#XNC_AG#X>?]"ZO_@7/_\ M%T7S#M#[W_D/_A2[0^]_Y%O_ (7YX"_Z&.U_)O\ "C_A?G@+_H8[7\F_PJI_ MPSA\//\ H75_\"Y__BZ/^& O\ H8[7\F_PJI_PSA\//^A=7_P+G_\ BZ/^ M& O\ H8[7\F_P MH_X7YX"_Z&.U_)O\*J?\,X?#S_H75_\ N?_ .+H_P"& O^ACM?R;_"C_ (7YX"_Z&.U_)O\ M"JG_ SA\//^A=7_ ,"Y_P#XNC_AG#X>?]"ZO_@7/_\ %T7S#M#[W_D/_A2[ M0^]_Y%O_ (7YX"_Z&.U_)O\ "C_A?G@+_H8[7\F_PJI_PSA\//\ H75_\"Y_ M_BZ/^& O\ H8[7\F_PJI_PSA\//^A=7_P+G_\ BZ/^& O\ H8[7\F_PH_X7YX"_Z&.U_)O\ M*J?\,X?#S_H75_\ N?_ .+H_P"& O^ACM?R;_"C_ (7YX"_Z&.U_)O\ "JG_ SA\//^A=7_ M ,"Y_P#XNC_AG#X>?]"ZO_@7/_\ %T7S#M#[W_D/_A2[0^]_Y%O_ (7YX"_Z M&.U_)O\ "C_A?G@+_H8[7\F_PJI_PSA\//\ H75_\"Y__BZ/^& O\ H8[7 M\F_PJI_PSA\//^A=7_P+G_\ BZ/^& O\ H8[7\F_PH_X7YX"_Z&.U_)O\*J?\,X?#S_H75_\ M N?_ .+H_P"&_PJF?VJA][_R+O\ POKP'_T,=I_X]_A0/CUX#/\ MS,=I_P"/?X53_P"&<_A]_P!"\O\ X%3_ /Q='_#.GP__ .A>7_P*G_\ BZ+Y MAVA][_R#_A0_N?>_\B[_ ,+X\"?]#':_^/?X4[_A>W@7_H8K7\F_PJC_ ,,Z M_#__ *%Y/_ J?_XNE_X9W\ ?]"\O_@5/_P#%T7S#M#[W_D.^8=H?>_\ (N_\ M+T\#?]#%:_DW^%*/CCX'/_,PVOY-_A5+_AGKP"/^9?4?]O4__P 72C]G[P$. MF@+_ .!4W_Q=%\P[0^]_Y#_V_M'[W_D7A\;_ 0>GB"U_)O\*7_A=O@D_P#, M?MOR;_"J0^ '@,?\P%?_ )F_P#BZ/\ A0?@8=-"7_P)F_\ BZ=\?VA][_R& MGCNJC][_ ,B]_P +K\%?]!ZW/X-_A2CXT^##_P QVW_)O\*I#X"^!Q_S E_\ M"9O_ (NG#X$^"!_S U_\"9?_ (JC_;^T?O?^17^V_P!W\2\/C)X-/_,=M_R; M_"C_ (7'X._Z#MO^3?X52'P*\$CIHB_^!$O_ ,53A\#O!8&!HB_^!$O_ ,55 M?[=VC][_ ,AWQ?\ =_$N?\+B\']M$/^@W!^3? MX4O_ N#PA_T&X/R;_"J?_"DO!@_Y@H_\")?_BJ/^%)^#?\ H##_ ,")?_BJ M/]M_N_B'^U_W?Q+G_"X/"'_0#?\ MH.V_Y-_A53_A1_@L?\P5?_ F7_XJC_A1W@K_ * B_P#@3-_\52_VWM'[W_D% M\7_=_$MGXR>#1_S';?\ )O\ "D_X7+X-_P"@[;_DW^%5#\#/!1_Y@B_^!,O_ M ,52?\**\$_] 1?_ )E_P#BJ5\=VC][_P @OB_[OXEW_A"/^@&O_@1+_\ %TH^!/@@?\P-?_ B7_XJB^.[1^]_Y!?&=>7\2]_PN7P; M_P!!VW_[Y;_"C_AM_R;_"E_P"%Q^#O^@[; M_DW^%4A\"O!(_P"8(O\ X$R__%4O_"C/!7_0$7_P(E_^*HOCNT?O?^07Q?\ M=_$N?\+D\&_]!VW_ ";_ H_X7'X-_Z#MO\ DW^%4_\ A1O@K_H"+_X$R_\ MQ5'_ HWP5_T!%_\"9?_ (JG?'=H_>_\@OB_[OXEP_&3P:/^8[;_ )-_A1_P MN7P;_P!!VW_)O\*I'X%>"3_S!%_\"9O_ (JD_P"%$^"?^@(O_@3+_P#%4KX[ MM'[W_D%\7_=_$N-\9_!B]=>M_P F_P *3_A=/@O_ *#UO^3?X54/P)\$'_F! MK_X$2_\ Q5)_PHCP0?\ F!K_ .!,O_Q='^W]H_>_\A7QG]W\2W_PNOP5_P!! MZW_)O\*/^%V>"A_S'[;\F_PJD?@+X&/70E_\"9O_ (NC_A07@7_H K_X$S?_ M !=+_;^T?O?^0KXWM'[V7/\ A=W@G_H8+;\F_P **I?\* \!_P#0!3_P)F_^ M+HHOC^T/O?\ D*^.[1^]_P"1Z-1117JGIA1110 4444 %%%% !1110 4444 M%%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4 M444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !11 M10 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% M !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 M%%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4444 %%%% !1110 4 M444 )BC%+10 F*6BB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** M "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "DQ2T4 )BBE MHH 3-&:** #-&:** #-&:** #-&:** #-&:^&OVD_P#@IS_PSU\:O$7P_P#^ M%;?V_P#V1]F_XF/]N_9O-\VVBG_U?V9]N/-V_>.=N>,X'F7_ ^A_P"J._\ MES__ ''0!^F6:,U^9O\ P^A_ZH[_ .7/_P#<='_#Z'_JCO\ Y<__ -QT ?IE MFC-?F;_P^A_ZH[_Y<_\ ]QT?\/H?^J._^7/_ /<= 'Z99HS7YF_\/H?^J._^ M7/\ _<='_#Z'_JCO_ES_ /W'0!^F6:,U^9O_ ^A_P"J._\ ES__ ''1_P / MH?\ JCO_ )<__P!QT ?IEFC-?F;_ ,/H?^J._P#ES_\ W'1_P^A_ZH[_ .7/ M_P#<= 'Z99HS7YF_\/H?^J._^7/_ /<='_#Z'_JCO_ES_P#W'0!^F6:,U^9O M_#Z'_JCO_ES_ /W'1_P^A_ZH[_Y<_P#]QT ?IEFC-?F;_P /H?\ JCO_ )<_ M_P!QT?\ #Z'_ *H[_P"7/_\ <= 'Z99HS7YF_P##Z'_JCO\ Y<__ -QT?\/H M?^J._P#ES_\ W'0!^F6:,U^9O_#Z'_JCO_ES_P#W'1_P^A_ZH[_Y<_\ ]QT M?IEFC-?F;_P^A_ZH[_Y<_P#]QT?\/H?^J._^7/\ _<= 'Z99HS7YF_\ #Z'_ M *H[_P"7/_\ <='_ ^A_P"J._\ ES__ ''0!^F6:,U^9O\ P^A_ZH[_ .7/ M_P#<==-\+_\ @K;_ ,+(^)?A+PE_PJK^SO[?U>TTK[9_PD7F^1Y\R1>9L^RK MNV[\[,$ ] MSS1FOS-_X?0_]4=_\N?_ .XZ/^'T/_5'?_+G_P#N.@#],LT9K\S?^'T/_5'? M_+G_ /N.C_A]#_U1W_RY_P#[CH _3+-&:_,W_A]#_P!4=_\ +G_^XZ/^'T/_ M %1W_P N?_[CH _3+-&:_,W_ (?0_P#5'?\ RY__ +CH_P"'T/\ U1W_ ,N? M_P"XZ /TRS1FOS-_X?0_]4=_\N?_ .XZ/^'T/_5'?_+G_P#N.@#],LT9K\S? M^'T/_5'?_+G_ /N.C_A]#_U1W_RY_P#[CH _3+-&:_,W_A]#_P!4=_\ +G_^ MXZ/^'T/_ %1W_P N?_[CH _3+-&:_,W_ (?0_P#5'?\ RY__ +CH_P"'T/\ MU1W_ ,N?_P"XZ /TRS1FOS-_X?0_]4=_\N?_ .XZ/^'T/_5'?_+G_P#N.@#] M,LT9K\S?^'T/_5'?_+G_ /N.C_A]#_U1W_RY_P#[CH _3+-&:_,W_A]#_P!4 M=_\ +G_^XZ/^'T/_ %1W_P N?_[CH _3+-&:_,W_ (?0_P#5'?\ RY__ +CH M_P"'T/\ U1W_ ,N?_P"XZ /TRS1FOF;]B_\ ;1_X:]_X3'_BCO\ A$_^$>^Q M_P#,4^V_://\_P#Z8Q[=OD>^=W;'/TS0 9HS110 9HS110 9HS110 9HS110 M 9HS110 9HS110 9HS110 9HS17D'[7'QAUGX"?L]>*_'?A^UL;S5])^R>1# MJ<;O;MYMW#"VY4=&/RR,1AAR!U'% 'K^:,U^0'_#X'XR?]"UX%_\ +S_ .2Z M/^'P/QD_Z%KP+_X 7G_R70!^O^:,U^0'_#X'XR?]"UX%_P# "\_^2Z/^'P/Q MD_Z%KP+_ . %Y_\ )= 'Z_YHS7Y ?\/@?C)_T+7@7_P O/\ Y+H_X? _&3_H M6O O_@!>?_)= 'Z_YHS7Y ?\/@?C)_T+7@7_ , +S_Y+H_X? _&3_H6O O\ MX 7G_P ET ?K_FC-?D!_P^!^,G_0M>!?_ "\_P#DNC_A\#\9/^A:\"_^ %Y_ M\ET ?K_FC-?D!_P^!^,G_0M>!?\ P O/_DNC_A\#\9/^A:\"_P#@!>?_ "70 M!^O^:,U^0'_#X'XR?]"UX%_\ +S_ .2Z/^'P/QD_Z%KP+_X 7G_R70!^O^:, MU^0'_#X'XR?]"UX%_P# "\_^2Z/^'P/QD_Z%KP+_ . %Y_\ )= 'Z_YHS7Y M?\/@?C)_T+7@7_P O/\ Y+K[P_8._:1\3?M0_"'5_%7BJQTJPU"SUV;3(XM' MAECB,26]O("1))(=V9FYSC ''7(!]'YHS110 9HS110 9HS110 9HS110 9H MS110 9HS110 9HS7AG[8'[3O_#*/PTTSQ;_PC7_"4_;=7BTK[']O^Q[-\,TO MF;_+DSCR<;<#[V<\8/R!_P /H?\ JCO_ )<__P!QT ?IEFC-?F;_ ,/H?^J. M_P#ES_\ W'1_P^A_ZH[_ .7/_P#<= 'Z99HS7YF_\/H?^J._^7/_ /<='_#Z M'_JCO_ES_P#W'0!^F6:,U^9O_#Z'_JCO_ES_ /W'1_P^A_ZH[_Y<_P#]QT ? MIEFC-?F;_P /H?\ JCO_ )<__P!QT?\ #Z'_ *H[_P"7/_\ <= 'Z99HS7YF M_P##Z'_JCO\ Y<__ -QT?\/H?^J._P#ES_\ W'0!^F6:,U^9O_#Z'_JCO_ES M_P#W'1_P^A_ZH[_Y<_\ ]QT ?IEFC-?F;_P^A_ZH[_Y<_P#]QT?\/H?^J._^ M7/\ _<= 'Z99HS7YF_\ #Z'_ *H[_P"7/_\ <='_ ^A_P"J._\ ES__ ''0 M!^F6:,U^9O\ P^A_ZH[_ .7/_P#<='_#Z'_JCO\ Y<__ -QT ?IEFC-?F;_P M^A_ZH[_Y<_\ ]QT?\/H?^J._^7/_ /<= 'Z99HS7YF_\/H?^J._^7/\ _<=' M_#Z'_JCO_ES_ /W'0!^F6:,U^9O_ ^A_P"J._\ ES__ ''1_P /H?\ JCO_ M )<__P!QT ?IEFC-?F;_ ,/H?^J._P#ES_\ W'1_P^A_ZH[_ .7/_P#<= 'Z M99HS7YF_\/H?^J._^7/_ /<='_#Z'_JCO_ES_P#W'0!^F6:,U^9O_#Z'_JCO M_ES_ /W'1_P^A_ZH[_Y<_P#]QT ?IEFC-?F;_P /H?\ JCO_ )<__P!QT?\ M#Z'_ *H[_P"7/_\ <= 'Z99HS7YF_P##Z'_JCO\ Y<__ -QT?\/H?^J._P#E MS_\ W'0!^F6:,U^9O_#Z'_JCO_ES_P#W'1_P^A_ZH[_Y<_\ ]QT ?IEFC-?F M;_P^A_ZH[_Y<_P#]QT?\/H?^J._^7/\ _<= 'Z99HS110 9HS110 9HS110 M9HHHH 6BBB@ HHHH **** "BBB@#\,_^"D__ ">K\1?^X=_Z;;6OF6OIK_@I M/_R>K\1?^X=_Z;;6J'_!/50W[7_P]! (\^?@_P#7O+0!\Z45]A?\%&]$L_$/ MC+PM\5-(@6+3_%=G);7:QCY8[ZTD,,JGWP%_[Y->Y_L6>'K'X>?LL^*;.ZMT M/B+QMX;UC7R6'S165N@@A_!FDD84 ?F517K_ ,%_V8_$WQFT/5?$<>I:-X3\ M':4XBO?$GB2[^RV<\-S;QS?\\YMG[?N"Y,(^39YN/X=V/?'->2?#;]G?QS\4OB/?>"-*TH6FM: M;YK:F=2D%O#IR1G$CSN?NJIX[D]@: /-:*^@O&_[&^M^'O FL>+?#/C;P=\1 M]+T, ZNGA34FN)K%2<>8Z,BYC_VAGH3C )KO?VS_ SJ7B[5_P!GW1-$L9-0 MU;4/ NF6]M:VZY>61BP '^- 'R!17U*?^"?WB8ZB_AV+XB?#V;X@(A8^#8]; M/V_<%R81\FSS^.:X#X/?LI^-/C+X@\:>']-CATWQ!X6MFGNM-U$F*1 MW$@C,0.,*03R6( )S0!XS17T5XA_8IUZQ\!Z]XF\.>.O!/CT>'H?/UG3?#. MJ-<7-G&.KX* .HP\47IM MH9I\9\J(*K,[ =@,>_!H \:HKVOXQ_LM:]\'?#&B^+HO$'A[QKX-U6Y-K;Z[ MX:O#<0"89)C<%5*M@'CGH><\5WO_ 4D14_:*M@H"C_A'-,X _Z8T ?*]%>I M? ']GKQ#^T9KNN:-X9GM4U+3-+DU,07+%?M 5E7RT.,!B7'+8'J:],3]@/QA MKFAWEWX.\8>"O'NI:;+'%JFD>'M7\V>QWMMW.S*J%5.=S!L#:<9P: /F&BOH M#QM^QSKGACX::MXUT7QKX.\=Z=HCHFLP>&-2:YET\LE^,/%7Q6UJ)7T/X=Z/-J@\P962]92EM'[DMN(]P* /F"BOJK]N?1+ M7QA+X$^-FCVZ1:9X_P!*22^6$82'4H5"3I[9P/\ OEJ]!TWX+WOQ@_8%^%BP MZUH?A?2],UW4[G4-;\0W@MK6W0R,J@G!9F9C@*H.3Z4 ?"E%>O?&G]F7Q+\& M=/T/67U'1_%GA77&*:;XA\-W1NK2=QUCSM!5Q_=(['!.#CT&R_8*U\7&GZ/K M/Q&\ >&O&VH11R6WA/5-79+[,@!2-PL95';(PN3G(H ^8*]-_9?_ .3EOA+_ M -C=I'_I9%7&^-?!FL?#SQ9JOAK7[-K#6=+N&MKJW8@['4\X(X(/4$<$$&NR M_9?_ .3EOA+_ -C=I'_I9%0!_0S1110 4444 %%%% !1110 4444 %?#/_!8 M'_DVGPU_V-UM_P"D=[7W-7PS_P %@?\ DVGPU_V-UM_Z1WM 'X_T45^E/Q=^ M./QF^$7P5^ =K\+%NQ97OA*&6^^RZ)'?@R!4"Y9HGV\$\<4 ?FM17W1\<-:U MGXJ_L;77C/XQ^'+70?B-:Z]%:>']2?3%T^\U.W(!F#1A5+(H+'=@#*C'/7R+ MXI>"_B-K_P )/@!IUY=Z?K>GZS;W-OX9TS3X"ES%NG5629B &+.1@Y.!0!\Z M45]2C]@'Q#';#XC_#W4_'UNC-)X0M=98WV]5RT0S&$,@ .5S@8/-<=\ M'?V0?%_QI\+>*M9TN^TO21X:OH[+48=8G-N+<-N,DKN1M5(PK%L\\< F@#PN MBO.-"\5>&?B'X3M9UMK_4/"UZT_V"1N%$R,BLH)(PW(Y' M3(I?AK^R7KOC?P+;^-=>\4>&/AUX3NY6@L=1\5WQM_M[KPWD1JK,X!SD\#@X MSB@#PRBO3?C-^SUXI^"6I:1%JCV&M:7K47G:3K>@W'VJQU!,@?NI 202,J0 M#R/6O4M/_8&\4*=-T[Q!X\\!^#_%^J1)+9>%-:U@QZ@^\?(KJJ,J,W0 DY/% M 'S!5JRTN]U(2FTM)[H1+ND,,3/L'J<#@5]'>#OAI\3_ +\(OC]H4EQIV@V M&B&QM_$NEW\/F7,Q\UO*\AP" ?FSG!!&,U]'WD-]\ ?V&/"Z^ OBYX6T&>^ MGU"[OM1M82[:Z0"!;0L\1.]1A#G;R!@XH _-BBOIG]H7X9?%+QO\5OAMX6U2 M:P\4^)M7\-:>-(AT>#R56U96,:2;@!N4!BSGC'.>*EO/V"/$SQZK8:%X]\!^ M*_&&E0O/>>$]&UO7S6R0OO*K!C:2\AVLV%! ))% M 'SC17T]K'[ WBSPGJP/B?QKX(\->%9XXI;#Q7J&K[;#4A(,J+?";W..3\H M!!S@C/DOQS^!GB+]G_QH/#GB)[*Z>:VCO;/4--F\ZUO+=\[)8W(!(.".0.E M'G=%?IG\$]'\-_#SX6_#[X ^(X(8M3^+>D7VIZG-(H\RUFF1?L'T.(^!_>%? M&7P)\+WW@S]K?P3X?U6$PZAIGBRVL[B)AT=+D*WZB@#QFBON/X\_L5:YXZ_: M"\;.GCKP-HGB/6]6N;O2O"VIZOY>H743.3&=BH50N.54G)]J^=/A[^S+XV^( M'Q#U_P 'B"S\/7OAU)9=;O-=N!;6FF1QG#O-)@X&>F <]1QS0!Y/17O/Q$_9 M%UCPA\/K_P ;^'?&7A/XB^&M,E2'4KGPO?M-)8LYPIEC9%(4D@ C/Y5X-0!^ MF?\ P1>_YK%_W!__ &^K],Z_,S_@B]_S6+_N#_\ M]7Z9T %%%% !1110 44 M44 %%%% !1110 4444 %%%% !7S+_P %)_\ DRKXB_\ <._].5K7TU7S+_P4 MG_Y,J^(O_<._].5K0!^&==Q\*/@EXX^.&N2:3X'\.7>OW<2AYC#M2*!3T,DK MD(@/;<1G'%32SXYMY]>UZZM6*27GW-D3L.2@ M#@%>AV"@#RGXE?L0_&+X5^&+CQ%K'A876B6PSLQM+V-E(VRJ",X)!! MZ\8[FND_9,^&MO\ &[]I+1;:[M(++P_;W,FMZI%$"(+>TA/FLGS$D)G:@R3P M>IH XGXH_ ;Q[\%K;0[CQIX=FT*'6X#<6#RS12"9 %)^XS;2 R_*V#STH^#_ M ,!?'?Q\U:_TSP'H)UZ^L8!<7$0NH(-D9;:&S*Z \G& 2:^O?%GQ"/[;?P8^ M-5F%\[7?"&LOXJ\/1XR_]FG]W)$OL$3=@=R*Y#_@G%X=U'Q=;?'/1-(C$VJZ MCX+GM;6,R+&&E=MJC$+:UD61]=N/$EO''9@$?.6CE+#'L*YK_ (*#?$KPU\3?CX+OPUJ4 M&NQZ=I5KIM[K5L!Y5_& M&U^UT^58;F07MM;^6[#(&)9$)X],UZ%_P[@_:+_Z)R__ (.-/_\ DBOG""[G MM@1#-)$#U".1G\J^NOVM[ZYC_9C_ &8W2XE1GT&Z+,KD%OGBZT ?,/Q ^'^O M_"WQ?J/A?Q1IYTO7=/94N;0RQR^62H8#=&S*>&!X)ZUSM.DE>9R\CL[GJS') M-?1'P>^ _@>+X-7OQ<^+.JZQ:>%!J']E:7I'AY8_MNIW(7+_@E\,?B+I/A+4_@KXDOO[5UO6$T6?P;XHN8#J5O(^-LZ>7C? M#SRV#CUX('8^(?@[^S=\-_&+_#OQ)JOQ"U7Q';2BSU+Q3I,5LFFVMSP&"0LI M=XT;ACDG@XH ^:/AW\+O$_Q7U6]TWPKI9U6]LK*74;B(3QQ;+>, R/F1E!QD M< Y/84H^%WB=OAJ?'XTL_P#"(C4/[+.H^?%C[3MW^7Y>[?\ =YSMQ[U]B_LR M_!K4?@'^U3\4/!FHW,=^UEX*U.2WO8EVK

>Q?\HT) MO^R@C_TE% 'RC7[ ?\$?O^3:?$O_ &-US_Z1V5?C_7[ ?\$?O^3:?$O_ &-U MS_Z1V5 'W-1110 4444 %%%% !1110 4444 %%%% 'PS_P %@?\ DVGPU_V- MUM_Z1WM?C_7[ ?\ !8'_ )-I\-?]C=;?^D=[7X_T %%?6?[$<4'PJ\,_$CX[ MZC;QRQ^$M/%AHZ3C*S:C<$*H&>NU3S[/6#^WAX&L-+^*NG^/= C \+?$'3HO M$%DR#Y5ED4>?']0_S$?[= 'S517T=H?[$GB#4_A]X3\OVK7 MU/7KYK9('WE%@QM)>1MK-A 0 #DBJVL?LDZI\.?BKX%T?Q/XE\-'PMXF87.G M^*;6Z>?2[N)2"5#JF[)^5<8ZN.<.V8QZ.8[)?]?$$VX==Q&W/7)K(_9M^'>O\ Q(^$G[4OA>*2QF\0 MW5]9QS74TBV]JKK=2M-*6;A(P%=CZ =.U 'PI17O7Q"_9 U[PA\/K[QMX?\ M%WA/XC>'=,D6+5+CPGJ#7+:>S' ,J,BG83T89]>!S5;X7?LF>(?B#X%'C?6/ M$?AOX>^#9)C;6VL>*KTVZWD@R"L"*K,^"#DX X.,X- 'AU%>L?&;]FKQ9\%I M=#FO)=.\1Z%KPSI&O>';G[797QSC:C@ [N1\I /IFO3M+_8/\5Z1J>BV>J^, M_!&D^-[CR;J#P3>:P$U1U)#!-NW8)".BEN?6@#Y9HK[G_:Q^ VJ?'+]L;XF: M5HE_96>K:/H-OJL=A<[@]ZL5K%OCBV@C?R.#BOEWX&?!+5OCMXRN=!TR\M=* M2SL+C4KS4+_<(+:"%=S,^T$^@''4T >=44^5%25U1Q(H8@.!CO@-^SQ:>!-:@TB#4_"BS7:R:?;W/F,@C"G,J,1PQZ4 ?GA17WA\(O MB8?V]]'\5_#KXDZ1I%QXX@TJ;5/#GBJQL8[6Z2:( F&3RP R-D<8 QGC."/" MOA3^Q_K_ ,5/AC<>/5\3>'?#7AVRU1]-O[K7KIK=+3:BMYC-M(()94"C)+$< M8YH \$HKV?Q1^S+?^'?AKXL\;VOBSP_XBT3P]K4.BO/HTTDT=T\D:N)(G* % M0&P<]P>O6N>\.?!/4_$GP2\7?$R&_M(M+\-WMK8W%G)N\^5IV"J4P-N!GG)% M 'G-%>_^!?V.M=\2^ =+\8>)/&/A'X<:/K)8:0?%FHFVEU#'&]$5&(3_ &CC ML<8(-87Q_P#V7O%'[.6F^$[GQ/=Z=/+XB2ZD@AT^8RA$A=%W;\;65Q(K*5)X M/.#Q0!X[5NQTF^U,2&SL[B[$8R_D1,^T>IP.*]1_92^#4/Q[^/'ACP?>R/#I M=Q*UQ?O&<,+>)2\@![$A=N>V[->O?$W]O?QUX4\7WWA[X0W%C\._ 6C7#VFF MZ;I6G6Y\Y(VV^;*TB,69\9/UYRFTVR6*RU&+_EG,<-_K3QT7N1G 45I6'["/B.WLM*3Q9X]\"^ ? M$.KQ+-8>'?$6K&&^=6^YO5481[N@RW-=MIO[ ?BO6&O-)L?'/@6[\=VD+S MR^"H=8WZDNT9:,@)L\P#JN[CN10!\P45]#?!S3?&L/[.'QU72YM(M?#]LNGI MKMMJ$$AO&(F81B!E.U2&!W;OPK@/B-\$-4^&WP^^'_BV]O[2ZL_&5I->6D%O MN\R!8W"D29 &3GL30!YQ17I_BCX ZYX:^&GP\\8K M*01[6&,$L2, $UZE)^P!XLM[BVT2Y\<>!;;Q_/$LJ^"9-9QJ>"-P3&W9YF.= MF[D=#0!\O45[9J/[)7C6/]H;4O@]I7V/6/$6G[6N+N*0Q6D49A25I7=P"J*L M@!)'7@ Y%==)^POJ^K:-K%QX.^)7@#Q]J^CVSW=[H?A_57DNO+3[[1AHP) / M7([=R!0!\RT5]J?LZ_ 3P?XO_8Z^)>N:GXG\*:;K5U<6<2ZIJ:.9-$19^8Y& M"$H9=HQLSD$9KQ7X5_LK:_\ $OPQ?^++OQ#X=\%>";2Y-F/$7B:]-M;7,P_@ M@ 5FD;Z #WR"* /%:*]<^+O[,OBGX2PZ%J O-)\7^&]>D\G2]?\ #-U]KL[J M7./*#8!63_9(]<9P:](@_8"\0_VC;^';[XC_ ^TOQ]<(K1^#[O6&%\'9=RQ M-B,J)2",+D]1S0!\MT5I^)_#6I>#?$6I:%K-J]CJNG7#VMU;28S'(A(8<<'D M=1690!_3-1110 4444 %%%% !1110 44E% "T4E% "T4E% "T4E% 'X:?\%) M_P#D]7XB_P#<._\ 3;:U1_X)Z?\ )X'P]_Z[S_\ I/+5[_@I/_R>I\1?^X=_ MZ;;6O"/AY\0_$'PI\8:?XI\+:A_9>O:>S-;7?DQS>664J?DD5E/#$<@]: /L M;P+X7NOVF/A7\5OA-:_OO$?AOQD=>T93RP@GN6@N5'LN[>?K7H/@7QA9>(?V MC?C;H>C.#X=\(?#:\\-::JGY?+ME1'8?[TGF&OA'X??'3QS\*_'%_P",/"NO M/I/B*^69+F\2WAD\P2MND!1T9.3SPO';%5? WQ?\7_#?4==OO#NL-87>NV4V MGZC*UO%,;B"4YD4^8K8W$?>7!]#0!]&^)["]\4_\$V_!+^'(I+JTT'Q1>-XA MAM06,+N&,4LH'\.UE&3P-PH^"EA>^&_V"/CCJ7B"*2VT'6KK3[;11<@JMQ=K M)EVB!^]@;UD\<>*;S7EM<_9[=PD,$1/!*Q1JJ ^X7- 'N'[> M-U+)H?P"MVD8PQ^ +%D0GA2W4_CM'Y5]$> -7T_3OBU^QC<:K+&AF\&S6\$T MYX$[1LL7)[[B /?%/Q1\38M!C\2ZG_:2:%I\>E:@Z-\./'P_:VMO#PT[45\:)XE$S@QMYJD7&\SD_W,?/OZ8YS7V7XLN[/ MQMX\_;1T;P9MNO$UYIMF((K+F6Y2%0MVL8'+'.00.I-?'DO[=/QXG\-?V$_Q M)U3["8O(,@CA%T4QC'VD1^=^._->3>#_ ![XB\ >*+?Q'XK&-2)';M&W!QSBON'2-4TW2?VK_V5)-3DBB67P#;06\DN-JSO!*L M?7N6( ]R*^'OBE^UC\6?C3H2:+XQ\:7>JZ0KB0V4<$-K%(PZ&1840.0>?FSS M7)^-OBWXM^(LOAZ3Q!K#WLOA^QBTW3'CAC@:VMXSF-08U4DC^\V6]Z /0-&^ M''CX?M;6WAX:=J*^-$\2B9P8V\U2+C>9R?[F/GW],L;O]H']LN^T M.= D?A"6)IK<\&9(T24@CON# ^X-?(;>#/BQXK^'UIXEMM!U9K*+Q)8OIVJAH(IC3L;X?ZEN7L?N5<\+?#GP5X$_98\(^.OBKJ/C3Q9HF MN:E<+H_A/0;\0:?:.A97DF9]P61MK?< .#WYQ\X?#_XI^*/A=+K,GAC4_P"S M'UC3Y=*OC]GBE\ZVDQOC_>*VW.!\RX([&NJ^%O[4OQ3^"^A3Z+X/\77&EZ1/ M(96L);:"ZA#GJRI,CA"<=5Q0!]2?&2/1I_\ @GAI=]X<\ 77P]T*[\91S6EC M>ZA+>RW*>2R_:"\@4C<00 H"_+QG.:\P_P""DW_)Q=M_V+FF?^B:\D\8?M,_ M$[X@>&]5T'Q+XNN]+=3_M;55MHK07'V>*']U&-J+MC55X'?&3W- 'T/_P $]KJ6RUSX MP3P.T4T?@#4F1U."I&S!%'["UU-:^$/VAGAD:)QX#NB&4X.<_P#US7SQ\/\ MXI^*/A;+K,GAC4_[,?6-/ETJ^/V>*7SK:3&^/]XK;$_"?Q(T77-6O?B/*WB&\M-#NDMIUMXRH MMQ(S?P$;6 ]65G'86S+;Q6Z10)G8BI$BJ ,GMGUH ^ MV?"=_P##']I7]E[Q[\)_AOH6O:/J?AF,^*M)M=>O([J21U.)4A91D KD%?63 M->;>/] U[4O^";GPNO-/M[B?1M/\1ZB^I>2I*Q%G=8G?'0 [AD]V'K7S9\+_ M (K^*_@QXLB\2^#=6;1M:CB>!;D0QS QN,,I2161@1Z@]CVKL_"7[77Q<\!V M&G6/A[QC-I%EI\]SX;?-N7R\.I;D*^57^$"@#V72].U/PW_P3 MLBM=61K._P!?\<07'AF*[81,P5%#S)OP A(8;C@PIY<)GVI'"O<1QH%1 >^U1FO0/#O[&K?0=-^(= M]'IUM%Y,(GMK>>:),8"K-)&T@P.!AN* ,?\ :R^%B?!GX]^*/"L>NW7B..UD MCD2_OGWW++)&KA93W=0V">,XZ#I6=^R__P G+?"7_L;M(_\ 2R*O/]9UJ_\ M$6K7>J:K>SZCJ-W(TUQ=W4ADEE;3P/XIU M#P_;7O@^*6YCLMN)'4( 3E3T!-? %?0GA/\ ;]^/7@?PSI?A_1/'?V+2-,MT MM;2V_L>PD\N)!A5W/ 6. .I)- 'M_A[Q9XI_:*_8X^+.N?&:+^UD\-Q0S^&/ M$^H6:0W*W3,0T$*UCNGTQ+B5( MXVN!=(45F=E7!(QR1G.*^ZW90OYB6>R*WM]_9C% M$J(2.<$C(R:YWQ!\7/%WBCP[X3T+4=8>73/"B/'HL4<,<3689@[8D10['< < ML21CC% 'VM9Z[\-/CE\>?^$+\?\ P?\ $'PT^,-YJ#6L_B#P3J+C;='.Z=HF M^54/+%P'R#G<0_9T_:)\1:U%)!X2N_#RZ;#)."L5S?LY$2IGAF4L.G3<*]<^.7C;P+H M/[/7P(UW5_@Y;_$OPU_PC<5E%JIUN[LHK"Y7 E@98?E#%@3EN25([5\;_%G] MI;XF_'*UM;3QOXNO-:LK5M\5GY<5O K?WC%$J*6Y/S$$\GGFI/A-^T[\4/@= M8W%CX*\7W>CZ?<-YDEDT45S;EN["*9'0$]R "<"@#ZE\1?$/_BC_ -G^/4OA M#9_#'X:CQ?#J>FS3:\][*Z>9^^/E3#S5B.X/N/R],=17C_[9'@;QC>?MH>*K M!+&^GU?6M6271VB5BUQ$^WR&B(Z@# R.FT^E>,_$_P"+_C+XSZ^-:\:^(;SQ M#J*IY<$/"D/AS2OB'J,&E0Q>1"LD4$ MTT*8P%29XVD0 <#:PQVH ^@=-\&^)_A_\$_VL]!\9^(HO%/B>SAT9+[4HKV6 M\WN9"=IEE ]9'+J6D=2X.XDDJP)SSFJ^L_%/Q1X@\ :#X)O]3\ M_P ,:%--<:=8_9XE\B24YD.\*';)[,Q [8H _2K1KRUM_P!LOX8V\DL<.I7O MPFBM=+>0@8NV@?9@^N ^*^"_@S\'_B;XN^.#^%_#%Q>^%_&=HUP;O49IY[,Z M>%5O->:6,%XU/*YQSN [UR7C'XR^,_'VO:'K>M:[-/JVB6D%CIUY;QQVTEM# M#_J@IB5>5S]X_-[UW7BO]M?XW>-O"4_AK6?B#J%SI%Q%Y,\<<,$,LR8P5DFC MC61P1P0S'/?- 'CFK0R6VJWL,MRE[+',Z/1_96H2>7GC=YRC/Y5\F5UGBGXI^*/&OA7PQX;UK5/MFB^& M89+?2;;[/%']F1V#.-RJ&?) Y*MY60?\ ;^__ +5 'TM\8?VG?V?/ M$_QTN/%][X0\;WNNZ-=QPV5_IVKPPVZK:MMB:*,CY4^7=@^I]:V?C1X8TS7_ M -KGX#?&;PQ"R>&OB'J&G7C @9BO(Y8UE1L<;L;<^X:OSV)RB>'-376-)MI+*WE-I=ABPD5WC+XRQ.PDJ<]* /5/C]\/_ M !U??MV:]I<>GZA+XCU#Q*+G3BL;%GA,H:&5#_<5 /FZ *>F*^@/B'XV\4:5 M^U_\<]:\"^$=+^(OA>TTB"T\8:)+2]0T]/B-J*6U])++*5@MQ(ID8LXCD\O?$,DX6,J!V KS'P'\4O%OPP\6 M+XF\+>(+W1M=&[=>P29>0,IZ07#O8PP06D,C Y!=840/@\_-GGFO(J /TS_ ."+W_-8O^X/_P"W MU?IG7YF?\$7O^:Q?]P?_ -OJ_3*@!:*2B@!:*2B@!:*2B@!:*2B@!:*2B@!: M*2B@!:*2B@!:^9?^"D__ "95\1?^X=_Z=H)4D="!7:_#/X/R? OXD_M9>$PA6PA\%WEQI[GH]K)EXB/7"G;]5-? MG=10![+^RY^T+?? #XAP76K_*^8SP64'(..V.A-=! M^V?^S[9_!7X@VNJ^%V%Y\._%4 U30+R([HQ&P#-#N]4W#'?:5[YKYZHH *^N M?VNO^38/V8/^P#=?^AQ5\C44 ?1WPR_;A\2_"WP-I7A>R\ ?#S5[73T9$O=8 MT-Y[J4%BV9'$J[CSCH. *]&\*6LG[7'[*$?@+PW<:7:_$?P[XFNM;B\/27"6 M@O[>Y+LPM_,8+\C2$;2> HR>1GXKHH ^Q/#7PKT']C"_^'WC+XC:E)#\3H?$ ML%P?"^G7L%RMGIBX\R6X"!B)#SM ?GC@X./HOQY<_M4>+/B-=:O\,?BCIVI? M"74[C[59>(H[K31;:=:N01?\HT)O^R@C_P!) M17RC10 5^P'_ 1^_P"3:?$O_8W7/_I'95^/]?K_ /\ !'[_ )-I\2_]C=<_ M^D=E0!]ST4E% "T4E% "T4E% "T4E% "T4E% "T4E% 'PU_P6!_Y-I\-?]C= M;?\ I'>U^0 !) R3VK]?O\ @L#_ ,FT^&O^QNMO_2.]K\B+"^FTR^MKRW*K M/;R++&7174,I!&58$$9'0@@]Z /OOQ]J?PJ_9[_9V^'/P?\ B1X?\0ZUJ6H6 MZ^*]3M]!O8[4QW$VX1K,6&257@#MMS4/BFZ\ ?M-?L8:WHWPYTC6=,OOA7,- M4M;/6[E+FY:SE+&<*Z]4'S'';8/:OBSXF?%#Q/\ &'Q=<^)_%^JMK&N7*)') MZVAN$G@?& MY&25&4@X'.,^] 'O_P"U-=2_\,G?LQV_F-Y']E:A)Y>>-WG*,X]<5J_$AR_[ M*7[*KNV2NJWZY/8"[7BOF/Q7\5?%'C?PMX9\.:UJ8O-&\-120:5:BWBC^S)( MP9QN10S9('WB<=J76_BMXJ\1^"O#7A+4-5,_A_PX\LFE6BP1(;9I6W.1(JAV MR>?F8X[8H ^ZM>@DA_X*]Z:SQLBR7T+(6! 8?V=U'J*Y'X3:'KOB/X/_ +8E MAX=AN+G4I+^)O(M06DDB6[G:50!RJ^$M3U#QG)>ZA MX4D>71[J?3[1Y+=FC\MB6,69,KQ^\W>O7FN<\'_M$_$7X?GQ$WASQ/<:/)X@ MNX[[4I;6&)9)IHY#(C!]FY,,S'"%00<$$<4 >Z_L16%WH/PV^/OB76(9+?P: M/"%QI\\TZE89[MSB&-<\,X)/ Y&X>M/_ &L["]U_]F']G77]$BDN/"%CH4FG MW,EN"T5M?!U$@DQPK,5/7KM->)_%?]J+XI?&_2K;3/&OC"[UG3;=_,2R6**W MA+]F9(4178>K GDU#\)?VE?B9\#+>ZMO!'BV[T6SNFWS69CBN+=FZ;O*E5T# M=.0,\"@#ZR^$,D/PZ_9.^$)\?H;*VOOB=:ZEI<%^-K+9+CS)0IY$>[)ST.X' MO7CG[4/@'QM-^W!X@L8M/OY])&)GB9U,,D9'554#D<#:>F*\3^) MWQ?\9_&;75UCQKXBO/$.H(GEQO=, D2]=J(H"H,]E KO=%_;4^-WA[P='X7L M/B'J<.CQ1>1$C)$\\4>,;4G9#*H X #C H ]\_:0^*=Q\$_^"DR>+)7)CL)- M/2_ /$D#VL:3@^ORLWY"MOXU?#ZU_9&^%WQKU.P98[GXAZRFC>'I$//]E.@N M9F0_W2)/+R/[HKY7TFT\9_M?_%V9]:\3Z.OB:]MP\NIZ[-%I\#)$JH!E$"[@ MH' &3M/4UW7[;OQ6L_%GB/P?X%T37E\2:!X"T6#1UU2*3?%>7011/*C?Q+E5 M4'_9H ^::^O/VU(GD^"7[,FQ&;'A _=&>\5?(=?07A#]OGX\> O"^E^'="\= M?8=&TRW2UM+;^R+"3RHE&%7<\!8X'./&-]KEG"_F)9E8X+<-V;RHE5"1V)&17-K\4 M_%"?#1_A^-3QX1;4/[5.G?9XN;G9L\SS-OF?=XV[L>U 'T3\.K&XUC_@G'\3 MX;&%[J:R\765W<1Q*6:*'RT&\@=%SW]C5GX>>%]4TC_@F[\6]5O;*:UL=3\0 MZ6;.65"HG5)8PS+GJN6QD<9!]*^?OA+\=?'GP+U2ZU#P+XENO#]Q=(([A8E2 M6*8#IOBD5D;&3@E3C)QUK9\<_M2_%/XE:-KND^)_%]UK&G:VUNU[;3P0[6\A MBT03"#R@K$G;'M!SR#0![+^WYI]WK#?![Q'I,,MQX,O/!MA::9-"I:%)4!\R M($(XI[?5H=$U'?!<@B2)#) 8T8'D$(5&# MTZ5V_P '[7XA:1\+/#C_ #^.NDV>F7=J'USP[XHU&SBFTF]_P"6AC2>,[8R MO/6O-/VYOB9IOB>+X:^#;7Q='X]U7PCI<\>L>([>8S0W=[<2*\HCD/ MWPI0#<..<=L4 <_^P'\0--^'7[4GA.\U>=+73K_SM+EGD.%C,\91"3V&\J,^ M]>=_'SX2Z]\&?BKX@\-Z[83VDD-Y*;:61"$N82Y*2QGHRD$> D'(X M-?1/@[]O_P"-O@SP_::-%XHAU>SLE"VC:SI\%Y+;@# VR.I*&_:Y\4MG7+B&;1GCC:07<#1HL8AQ]['W<+W%>)_$_XM^+_C/XF?Q! MXTUZZU[5678LMP0%C3KL1% 5%]E %=_X-_;5^-O@#PM!X=T/X@7]MI%NGE00 MS0P7#P)C 6.26-G0 < *PQVH ^X;)WT_]N3]GO1]1D#^+-(\#+;:R2VZ1)_L MDQ"N?[P'//J*^3/V,[R>?]N_PG/)*[33:W>&1R>6)CFSGZUXSX6^-/C;P;\2 M!X^TSQ!X@O?(CEV2,&#'8ZE#D,W!7'- 'U=X$ 7X#?MB # &HVO'_;]+6! M^T_I]SJ'[)G[-&IVT$D]A%IE]9R7$:ED2;SEPA(Z,=K8'L?2M/PRG_"N_P!C M7XM:WXK\1Z)/K7Q)DL)=,T^TOHI;R5A,TDKR0I_J\;B2,#'3CBO$/A9^U9\5 M_@KH$VB>#?&=WI&D2N9#9-##<1(QZLBRH^PGKE<<\T ?8NG::OPX\*?L31^, M;8Z8D.K74\T5ZNPQ>9,K1%P>G+H>>E?./Q.^'_CM_P!N75=)2PU!_%-UXK-W M9LJ-O>-KC?',I_N!,'=T 'M7 7_QJ\0_%W4_"FC?$[Q7J.H^%['4GGEN1'&U MU;K/(#<2B39N=N,@,6 P !Q7VU91_%K3]1L;*#]IGPS=? ^VFC<:Y@Z0E_JX\,2 ME-0O[<65N&MXP#@ANX8$< 8YXO?L,WOPM\0_%/5S\-/A1X@T]+'1;S[3XLUS M6GG:%6CVK$8441!G/J2>#@<9KY>^,W[3>L3?M6^,?BC\-]\N]EG>0@* MTL"1I$-Z,"&5A&&VL#VR,BJUY^W-\<[[6]/U63X@7:W-B7:&*&SM8[;J:OXL\'Z3^ MPK\&=7U/X4P_%#0=.>\M+YAJ]S9+I=V9229!!UW_ -YNG&/O5\@?"C]H[XC? M _5-5U#P1XEET&?5?^/U8[:"6*;!)!,4B,@(W'!"C&2!Q2_#+]I/XE_!S4=2 MO/!WBR[T5]2D,UW D<4EO,Y.2Q@D5H\\]=O3CI0!])^+_'.M:[^S%H5GX(^" MEE\./">K>++6?2-2F\3-.TFHJ0%:..ZPVQL8+@A!@Y[UTOBSQUX)\??&FV\( M?'/X*:MX8^+<]S;VK^)_ VH,L\LS!52<19V,/NG>#)TXZ8KXY^*WQW\??'#4 M[:_\<>)[S7I[4%;=)0D<4&>NR*,*BDX&2%&<#TKO=*_;M^/&B^'8=$M?B-J ML88O(C>6WMY;A$QC G>,RCCONS0!R7[2_P -Q\(_CIXP\)#6I?$*Z=>;!J-P MVZ:4,JN/,/=QNP?<&O,JLZCJ5WK&H7-]?W,U[>W,C2S7%PY>25V.69F/))/) M)JM0!_3-1244 +1244 +1244 +1244 +1110 4444 %%%% !1110!^;_ .UQ M_P $WOB7\>_VA?%?COP_KGA2STC5OLGD0ZE=W*7"^5:0PMN5+=U'S1L1ACP1 MTZ5X_P#\.?OC)_T,O@7_ ,#[S_Y$K]@** /Q_P#^'/WQD_Z&7P+_ .!]Y_\ M(E'_ Y^^,G_ $,O@7_P/O/_ )$K]@** /Q__P"'/WQD_P"AE\"_^!]Y_P#( ME'_#G[XR?]#+X%_\#[S_ .1*_8"B@#\?_P#AS]\9/^AE\"_^!]Y_\B4?\.?O MC)_T,O@7_P #[S_Y$K]@** /Q_\ ^'/WQD_Z&7P+_P"!]Y_\B4?\.?OC)_T, MO@7_ ,#[S_Y$K]@** /Q_P#^'/WQD_Z&7P+_ .!]Y_\ (E'_ Y^^,G_ $,O M@7_P/O/_ )$K]@** /Q__P"'/WQD_P"AE\"_^!]Y_P#(E'_#G[XR?]#+X%_\ M#[S_ .1*_8"B@#\?_P#AS]\9/^AE\"_^!]Y_\B4?\.?OC)_T,O@7_P #[S_Y M$K]@** /Q_\ ^'/WQD_Z&7P+_P"!]Y_\B4?\.?OC)_T,O@7_ ,#[S_Y$K]@* M* /Q_P#^'/WQD_Z&7P+_ .!]Y_\ (E'_ Y^^,G_ $,O@7_P/O/_ )$K]@** M /Q__P"'/WQD_P"AE\"_^!]Y_P#(E'_#G[XR?]#+X%_\#[S_ .1*_8"B@#\? M_P#AS]\9/^AE\"_^!]Y_\B4?\.?OC)_T,O@7_P #[S_Y$K]@** /Q_\ ^'/W MQD_Z&7P+_P"!]Y_\B4?\.?OC)_T,O@7_ ,#[S_Y$K]@** /Q_P#^'/WQD_Z& M7P+_ .!]Y_\ (E=A\&_^"5WQ8^'GQ>\#^*M1\0^#9M/T/7;'4[F*UO;MI7BA MN$D<(&M0"Q"G ) SC)%?JA10 4444 %%%% !1110 4444 %%%% !7S?^WC^S M?XF_:A^$.D>%?"M]I.GZA9Z[#JXC(!CCD.[,R\8Q@'GIGZ0H MH _'_P#X<_?&3_H9? O_ ('WG_R)1_PY^^,G_0R^!?\ P/O/_D2OV HH _'_ M /X<_?&3_H9? O\ X'WG_P B4?\ #G[XR?\ 0R^!?_ ^\_\ D2OV HH _'__ M (<_?&3_ *&7P+_X'WG_ ,B4?\.?OC)_T,O@7_P/O/\ Y$K]@** /Q__ .'/ MWQD_Z&7P+_X'WG_R)1_PY^^,G_0R^!?_ /O/_D2OV HH _'_P#X<_?&3_H9 M? O_ ('WG_R)1_PY^^,G_0R^!?\ P/O/_D2OV HH _'_ /X<_?&3_H9? O\ MX'WG_P B4?\ #G[XR?\ 0R^!?_ ^\_\ D2OV HH _'__ (<_?&3_ *&7P+_X M'WG_ ,B4?\.?OC)_T,O@7_P/O/\ Y$K]@** /Q__ .'/WQD_Z&7P+_X'WG_R M)1_PY^^,G_0R^!?_ /O/_D2OV HH _'_P#X<_?&3_H9? O_ ('WG_R)1_PY M^^,G_0R^!?\ P/O/_D2OV HH _'_ /X<_?&3_H9? O\ X'WG_P B4?\ #G[X MR?\ 0R^!?_ ^\_\ D2OV HH _'__ (<_?&3_ *&7P+_X'WG_ ,B4?\.?OC)_ MT,O@7_P/O/\ Y$K]@** /Q__ .'/WQD_Z&7P+_X'WG_R)1_PY^^,G_0R^!?_ M /O/_D2OV HH ^/_P#@GU^Q]XR_90_X3W_A+=3T+4?[?^P?9?[%GFEV>1]I MW[_,BCQGSEQC/0YQQG[ HHH **** "BBB@ HHHH **** "BBB@ HHHH **** M "O,OVD_@O\ \-#?!7Q'\/\ ^V/[ _M?[-_Q,?LOVGRO*N8I_P#5[TW9\K;] MX8W9YQ@^FT4 ?F9_PY>_ZK%_Y;'_ -V4?\.7O^JQ?^6Q_P#=E?IG10!^9G_# ME[_JL7_EL?\ W91_PY>_ZK%_Y;'_ -V5^F=% 'YF?\.7O^JQ?^6Q_P#=E'_# ME[_JL7_EL?\ W97Z9T4 ?F9_PY>_ZK%_Y;'_ -V4?\.7O^JQ?^6Q_P#=E?IG M10!^9G_#E[_JL7_EL?\ W91_PY>_ZK%_Y;'_ -V5^F=% 'YF?\.7O^JQ?^6Q M_P#=E'_#E[_JL7_EL?\ W97Z9T4 ?F9_PY>_ZK%_Y;'_ -V4?\.7O^JQ?^6Q M_P#=E?IG10!^9G_#E[_JL7_EL?\ W91_PY>_ZK%_Y;'_ -V5^F=% 'YF?\.7 MO^JQ?^6Q_P#=E?8'['W[,?\ PRA\--3\)?\ "2_\)3]MU>75?MGV#['LWPPQ M>7L\R3./)SNR/O8QQD^YT4 %%%% !1110 4444 %%%% !1110 4444 ?-_[> M/[-_B;]J'X0Z1X5\*WVDZ?J%GKL.IR2ZQ-+'$8DM[B,@&..0[LS+QC& >>F? M@_\ X<_?&3_H9? O_@?>?_(E?L!10!^/_P#PY^^,G_0R^!?_ /O/_D2C_AS M]\9/^AE\"_\ @?>?_(E?L!10!^/_ /PY^^,G_0R^!?\ P/O/_D2C_AS]\9/^ MAE\"_P#@?>?_ ")7[ 44 ?C_ /\ #G[XR?\ 0R^!?_ ^\_\ D2C_ (<_?&3_ M *&7P+_X'WG_ ,B5^P%% 'X__P##G[XR?]#+X%_\#[S_ .1*/^'/WQD_Z&7P M+_X'WG_R)7[ 44 ?C_\ \.?OC)_T,O@7_P #[S_Y$H_X<_?&3_H9? O_ ('W MG_R)7[ 44 ?C_P#\.?OC)_T,O@7_ ,#[S_Y$H_X<_?&3_H9? O\ X'WG_P B M5^P%% 'X_P#_ Y^^,G_ $,O@7_P/O/_ )$H_P"'/WQD_P"AE\"_^!]Y_P#( ME?L!10!^/_\ PY^^,G_0R^!?_ ^\_P#D2C_AS]\9/^AE\"_^!]Y_\B5^P%% M'X__ /#G[XR?]#+X%_\ ^\_^1*/^'/WQD_Z&7P+_P"!]Y_\B5^P%% 'X_\ M_#G[XR?]#+X%_P# ^\_^1*/^'/WQD_Z&7P+_ .!]Y_\ (E?L!10!^/\ _P . M?OC)_P!#+X%_\#[S_P"1*/\ AS]\9/\ H9? O_@?>?\ R)7[ 44 ?C__ ,.? MOC)_T,O@7_P/O/\ Y$H_X<_?&3_H9? O_@?>?_(E?L!10!^/_P#PY^^,G_0R M^!?_ /O/_D2C_AS]\9/^AE\"_\ @?>?_(E?L!10!^/_ /PY^^,G_0R^!?\ MP/O/_D2C_AS]\9/^AE\"_P#@?>?_ ")7[ 44 ?C_ /\ #G[XR?\ 0R^!?_ ^ M\_\ D2C_ (<_?&3_ *&7P+_X'WG_ ,B5^P%% 'X__P##G[XR?]#+X%_\#[S_ M .1*/^'/WQD_Z&7P+_X'WG_R)7[ 44 ?C_\ \.?OC)_T,O@7_P #[S_Y$H_X M<_?&3_H9? O_ ('WG_R)7[ 44 ?C_P#\.?OC)_T,O@7_ ,#[S_Y$H_X<_?&3 M_H9? O\ X'WG_P B5^P%% 'X_P#_ Y^^,G_ $,O@7_P/O/_ )$H_P"'/WQD M_P"AE\"_^!]Y_P#(E?L!10 4444 %%%% !1110 4444 )FC-%% !FC-%% !F MC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% M !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC M-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% M!FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC- M%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% ! MFC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-% M% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !F MC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% M !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC-%% !FC M-%% !FC-%% !FC-%% !FC-%% !FBBB@!:*** "BBB@ HHHH **** "BBB@ H MHJ.XN(K6"2:>1(88U+O)(P554-] \&0K+KFK MVFF*PRBW$H5W_P!U>K?@*7PMXVT+QM:R7&A:K;:G%$=LGD/DH>VY>HS[BM_8 M5?9^UY'R][.WW['+];P_MOJ_M(\_\MU?[MS;HHHK Z@HHHH **** "BBB@ H MHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BB MB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** M "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH M**** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH **** "BBB@ H MKB_B=\6]!^%&G6]SK+S22W+%8+2V4-++C&X@$@ #(R2>],KU+- MKF?1+J0[474T5$<]@'#%1^)%>E3RW&5J/UBG2;AW2/$K9WEN'Q7U*M7C&IV; MMOM\WT6YZ[12 @@$'(/>EKS3VPHHHH **** "BBB@ HHHH **** "BBB@ HH MHH **AO+RWTZUEN;J>.VMHE+R33.$1%'4DG@"O%_$/[7?@?1;]K:V74-8"DA MI[*%1'^!=E)^H&/>N["X'%8UM8:FY6[?YGDX_-L#E<5+&UHPOM=ZOT6Y[=16 M%X*\:Z3\0/#UOK.C3F>SF)7#KM>-AU5AV(_P(R"#6[7+4ISI3=.HK-:-,]&C M6IXBG&K2DI1DKIK9I]0HHHK,U"BBB@ HHHH **** "BBB@ HHHH **** "BB MB@!,T9I:* $S1FEHH 3-&:6B@!,T9I:* $S1FEHH 3->'_M?:_Y MD?)_:5#GVYE]_3\3Y7BKVG]AXOV6_(_NZ_A<^(Z]P^"'[2>I> [FWTG7YI=2 M\.L0@=R7FLQZJ>K(.Z_EZ'P^BOWO&8*ACZ3HXB-T_O7FNS/Y&RS-,7E&(6)P M<^62^YKLUU7];GZA:?J-KJUC!>V4\=U:3H)(IHFW*ZGD$&K&:^-/V7OC8_A/ M5XO"NL3_ /$DOI,6TLAXM9F/3/9&/7T)SQDU]F5^!9ME=7*L2Z,]4]4^Z_S[ MG]=\.Y]0X@P2Q-+22TE'L_\ )[I_JF)FC-+17BGU F:,TM% "9HS2T4 )FC- M+10 F:,TM% "9HS2T4 )FO$/C[^T3!\.4?1-#,5WXC=?G=OFCLP1P6'=^X7M MU/8'>^/WQAC^%7A8"T9)->OPT=G&W/EC^*5AZ+D8'Y)K]!X:R!8U_7,4OW:V7\S_ ,E^+/Q[CCB^65K^SL!+ M]\U[TOY4^B_O/\%KNU:?6=;O_$.HS7^IWDU_>S'+SSN68_B>WMVKT_\ 99U^ MYT;XPZ5;1.PM]126VGC!X8>6SKD>S*/UKR.O7?V5=';5?C-I+O$,?A/PMJVLRIYB6%K)<>7G&\JI(7/N0!^-? .I_&KQQ MJFLR:F_B?4X)V?>([>Y>.)/]E4!V@>V/KFON'XSV3ZA\)_%D,?+_ -FS.!Z[ M5+'^5?G17ZKP;A:%6C6J5(IRNEJKZ6_4_G_Q+Q^+H8G#T*51QARMZ-J[O;IV M6W:Y]0_!_P#:VF-S!I/CAD:)L)'K$:;2I[>:HXQ_M*!CN#R:^IH9X[F%)8G6 M6*10R.ARK \@@]Q7Y<5]$_LR?'A_#M]!X2U^Y+:1<,$LKF4_\>LA/"$_W&/_ M 'R?8G%<0<,PY'B\#&S6KBMFNZ\_+[O.>#N.:OM8Y?FT^9/2,WNGVD^J?1[I M[Z;?8.:,TM%?E!_00F:,TM% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+ M4<\\=M#)-*XCBC4LSLUM7UTT/TO*/\ 5M(UFWEN+^XNK5G"S13REP5)Y(SG!'7(]*^A,U\J6T#7 M-Q%"GWY&"#ZDXKZLK['PFQ^+Q6'Q='$33Q/0I4IT MIP23:=[>5K?F)FC-+17[V?$B9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+1 M0 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9IDDNT$#EASBG]*@5U$Y;/7I0'D M+"[N#NSWQBI>??\ .C>H[U6O=5L]-4-=7,5NIZ&1PN?SII-NR)E*,%S2=D6> M??\ .E7I_C56TU6TOX1+;7$<\9X#QL"*L[P>]#33LQIJ2NGH.J%UY)!J:BD, M@1I W."/2I5<,N<$?6G4CAS1FJOEN0&4;#ZXY_S_GFIOW@SR/J1 MT_QH DS1FHU=RPSC;CTQD_G3BY_NT .S1FD$@/7Y?J:4'- !FC-+10 F:,TM M% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC- M+10 F:,TM% 'Q-^V%?2W/Q7B@=OW5OIT21KV&6=B?S/Z"O#:^B_VU-!>V\8Z M%K 7$5W9-;$C^_&Y)S^$B_E7SI7]#9!.,\KH./:WS6C_ !/XWXOISIY]BU4W MYK_)I-?@T?0'[/W[1UQX0N+?P]XFN7N-!?$<%W(=SV9[ GJ8_;^'MQQ7V1'* MDL:NC!T8!E93D$'H0:_+>OJS]D[XSM=*G@G6;C=(BDZ7-(>2H&3"3[#E?;([ M 5\AQ1D$7"6/PL;-?$EU\U^OW][_ *-P'Q=-5(Y1CY73TA)]'_*WV?V>STV: MM]/9HS2T5^4']!"9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 F:H:[KM MAX9T>[U34[E+2QM4,DLS]%']2>@ Y)(%:%?$O[3?QF;QUX@?0-*N,^'].D(9 MD/RW4XX+^ZKR%_$]QCWQ!P9,='EQU;VZ+V[D^6T45^_87" MT<'25&A&T5_7WG\A8['XG,L1+%8J;E.77]%V2Z(^K?V(KZ62P\76;-F"*6UE M1?1G$H8_DB_E7T[FOGS]C#07L? FKZHZ[?M][L0_WDC7&?\ OIV'X5]"5^$< M1SC/-:[AM=+YI)/\3^L^"J$]4UZ\4O!8PF0HO5VR JCZL0/QKVR9?[)UT+DV,S@B7U,3?Q?3 / ML0,U\$U+;7,UE'\0'U'&0/:Z_&, M3AL1E>*]G45IQ=_\FO(_IK!8W"9[@56HOFIU$TUUUT:?9]_\C\N;NTFL+N:V MN(S%/"[1R1MU5@<$'Z$5%7NG[6?PY/A;QR-?M8=NG:UF1RHX2X'WQ_P+AO.+#6HMSVP/ ME7<*_P#+6!B-P^HX8>ZBO+S[*UFF#<(KWXZQ]>WS_P CWN$L]>0YE&K-_NI^ M[/TZ/_MUZ^EUU/T:HJOI]_;ZK8V][:2K/:W$:RQ2HSM8FFFE;HJ MJ,DU98N&'CL]WV7 M5_Y>9\_GV;T\CR^IC:FZTBN\GLOU?DF> ?$[Q]>?$KQE?ZY=%E25MEO 3D0P MC[B#\.3ZDD]ZY6BBOZ*I4H4*<:5-6C%61_%^(Q%7%5IUZTKRDVV^[85]:_L7 M>#6M-&UKQ-,F#=R"SMR1_ GS.1[%BH_X :^6= T.\\3:W8Z581&:\O)EAB3_ M &B<9/H!U)[ 5^D7@SPM:^"?"NF:'9#_ $>RA6(-C!=NK.?=F))^M?#<88]4 M,(L)%^]4W]%_F[?B?JWAOE,L5F,LPFOK,?04>,/%VF^!O#MYK6K3B&SMER=NR*.[$\ 5\ M _%/XI:M\5?$3ZCJ+F*VCRMI9(V8[=/0>K'C+=_8 ? Y%D=3-ZCE)\M..[[ M^2\_R/USBOBNCP[14()2KR^&/1+^:7EV77[VO5_&G[96NWUZ\?AG3[?3+%3\ MLMXGFSN/4C.U?IS]:]3_ &<_CQ=_%,7^E:U%#'K-G&)UEMU*K-%D*21DX()7 MIP=P]*^(J]R_8[BD?XLSLF=J:9,7QZ;XQ_,BOT'.,BR^AEE1TJ:BXJZ?73SZ MW/Q[ASBO.,7GE&.(K.4:DK./V;/LME;?0^V:***_%3^GPHHHH **** "BBB@ M HHHH *\<\8?M4>#/!_B&XT>1-0U&>V]=57YAZ%KVH>&=5M]2TJ[EL;ZW;='-"V"/\0>X/![U] MQ? ?XZVGQ6TPV=[Y=IXDM4S/ O"S+T\R/VZ9'8GT(IYYPU/+8O$8=N5/KWCZ M]UYBX5XWI9W)83&)0K=+?#+TOL_+7R?0]4N[2*_M)K:=!)!,C1R(>C*1@C\C M7YG^*_#\_A3Q-JFC7((FL;EX"2/O;6(#?0C!_&OTVKY!_;&^'YTSQ'9>++:/ M_1M146UT0/NSHORD_P"\@Q_P UOP=C50Q'HDGN1]T_@?XJ]JK\W/AIX[N_AOXST_7;7TU[2K34K&9;BSNXEFAD7HRL,BOPWB?*O[/Q7M:2_=SU7D^J_5?\ /ZL MX$X@><8#ZO7E>K2LGW<>C_1^EWN7****^,/TP**** "BBB@ HHHH **** "O M)_C'XP*D:#:OC(#W3*?Q5/ZG\/>O0O%/B"+PQH=S?RX)08C0_P ;G[H_SV!K MYKO+N6_NYKF=S)-*Y=V/'38:/-JDJXEO#MCSVC4]?Q.?R%>C5_97AOE$LKR.-6HK3K/G?H]( M_@K_ #/R?/\ %+$XQQCM#3Y]?QT^05SOB/Q[H_AAO+N[@R7&,_9X!O?\>P_$ MBN8^)/Q*.D&32]*D'VWI-..?*_V1_M?R^O3QF21I9&=V+NQ)9F.23ZDUX'%W MB/#*:TL!E24ZL=)2>L8OLDMVNNMD]-7=+MRO('BHJMB6U%[+J_/R1]#>%OB- MI/BN[:UMO.@N0I81W"@%P.N""174U\S^#;A[;Q9H[QG#?:XU_ L ?T)KZ8KZ M3@+B7%<28&I/&)>TIRM=*R::NM.^_P"!Y^=Y?3R^M%4OADKZA1117Z <=.37V,L!_M%*K07N]3\2H9]?+L1@L;) MNI+;R9M_!/Q5<:'XOMM,,C-IU^2C1MTCD R&'UY%?3,7W1QWKY3^%&C2:GXP MLIE4^7;RAM_^UD''Y9KZOC4[>GYUX>:\BQ/N?,_0>$I8B661=>^[M?L2*K#\9>+[/P?HMQJ%W MN(C'R1K]YSV KY^OOCEXJNK\W,4T-E I)6V5-RX_VCW_ KMPV#JXF[@M$>! MF>=8/*I1C7;P8 M 'C%,AA:+A< =2!4FY9HIBR9X(P1Q3@WU&5KB)_8AB2/JI!]Z]9_;;LG36O"UV?]7) M;SQ#ZJRD_P#H8KYGK]PX=P&$J953]V??7P9^/6D?%BU^S,HTW7XDW2V#-D.!U>,_Q#U'4?3D^HU^ M7^DZM>:%J5MJ&GW,EI>V[B2*>(X9&'<5]Y_ KXQ6WQ8\,[IBD.O605+VW7@- MZ2*/[K8Z=CD>A/Q?$7#W]G_[3A?X3W7\O_ /T_@SC+^V?]AQS2KI:/932_\ M;EU2W6JZF?\ M1>"CXN^%EY<01E[W27%]'@J]Z/IU7Z_-GROB9D[C4IYK36C]V7JOA?S6GR7K/LMC5F_P![#W9^ MO?\ [>6OK== HHHKYP^U"BBB@ HHHH **** "BBJVHZC;:1I]S?7DRV]I;1M M-+*YX1%&23^ II.3LB9244Y2=DCR/]IWXI?\(#X);3;&;9K6KAH8BI^:*+I) M)['!VCW.1TKX9KK_ (K?$&Y^)GC>_P!;FW) [>5:PL?]5 N=B_7J3[L:Y"OZ M"R'+%E>#C"2]^6LO7M\MOO/X]XMSUY]F4JL'^ZA[L/3O_P!O/7TLN@5)!!)= M3QPPHTLLC!$11DLQ. /6HZ]S_9/^&S>*_'']OW<6[3-%(D4L.)+@_< _P!W M[WL0OK7IX_&0P&&GB:FT5][Z+YL\'* _M,?'9O!-FWAG0;C9KURF;BXC/-I$1 MQ@]G8=/0<]2#7\^X7#8C-\7[.&LYMMOMW;/[$QV.P?#N7>UJZ4Z:22ZNRLHK MS_X=Z$WQM_:*\SSFNZDZCA#I&+:2^[=^;^5EH?H'\ /B'<_$KX<4:=#,*U.DK14G;R\C^H^&\16Q>3X:OB'>;@KOOY_/<****\<^D"BBB@ H MHHH **** "BBB@ HHHH 3-&:6B@!,T9I:* $S1FEHH 3-F/6O,:_I;" MXB&+H0KT]I),_AW'X.IE^*J82M\4&T_EU^>Z+^@:[>^&-:L]5TV=K>^M)!+% M(O8CU]0>A'<$BOT/^%WQ"L_B;X-LM;M0(Y''EW-N#DPS#[R_3H1Z@@U^<->R M?LQ?%+_A ?&ZZ;>S;-&U@K!*6/RQ2](Y/;D[3[')Z5\OQ/E*S#"NM37[R&J\ MUU7ZKS]3[W@7B!Y1CUAJTOW-5V?92Z2_1^6KV/KOXH^ ;7XE>"M0T.XVI)*N M^VF8?ZF9?N-^?!]B17YU:IIEUHNI76GWL+6]Y:RM#-$W574X(_,5^H-?*/[8 M'PM^SW,'C;3X?W75W^\I+3SAT_\!V]+&[FC-+17P1^N"9HS M2T4 )FC-+10 F:,TM% '-?$7QQ9_#OP?J.NWF&6W3]U$3@RRGA$'U./H,GM7 MYSZYK5YXCUF]U2_E,][=RM-+(>[$Y./0>@["O9OVJ_BH/&7BQ?#^GSB32-'8 MJ[("3I5C-LUG6%:%"I^:*'I(_L2#M'N21]VOP&O5K\09E[N\W9>4?^ M M7\S^O<)0PO!V1^^]*:O)_P TG_F[)>5CY^_:3^+S?$;Q6=-T^;.@:6[)#M/R MSR]&E]QV7VY_B->.T45^[X/"4L#0CAZ*]V*_I_,_DW,LPKYKBZF,Q#O*;OZ= MDO)+1!7U/^Q1X:(7Q'X@D4A3Y=A"V.O\CZ,Z@7<<7FW1'>9_F?GO@G:#Z**^3XNQBP^ ]@G[U1V^ M2U?Z+YGZ#X=9;+&9O]::]VBF_P#MYZ)?F_D=EFC-+17XD?U()FC-+10 F:,T MM% "9HS2T4 )FC-+10!'/"ES!)#(NZ.12C#U!YCZ]I$WA_7-0TNX&)[*X MDMW_ -Y&*G^5?IY7Q#^UIX*/AOXE'58HRMGK40G! X$RX60?^@M_P.OT3@S% M*EBJF&E]M77K'_@-_3;-$U0K;W>X_+&V?DE_X"3@ M^S-[5]Y]:_!,ZR^>2XY.B[1?O1?;R^3_ L?UQPQG-+B?*G'$I.:7)47>ZW] M)+\;KH?F)KVB7GAK6;W2M0B,%[9RM#*A[,#CCU'<'N*H5]5_M@?"WS88/&VG MP_/'MM]151U7I'*?IPA^J^E?*E?LV59A#,\)#$1WV:[-;_YKR/YGX@R>ID>8 M5,'/9:Q?>+V?Z/S3"OJC]C[XI;DG\$ZA-RNZXTTL>W62(?JX_P"!^U?*]7M# MUJ\\.:Q9:I82F"]M)5FBD'9@'EN]4^SZ/\ S\A,ALM)+O%[K]5YI'Z>9HS7-_#GQQ:?$7P=IVNV>%%PF)8@NEK^=:M.=&B[QDDT^Z>PF:,TM%9&XF:,TM M% "9HS2T4 )FC-+7)_$GQ7_PC'A]_)?;?768H,=5_O-^ _4BO-S+,*&58.IC M<2[0@KO_ "7FWHO,Z,/0GB:L:-/=L\U^+'BS^W=;^PP/FRLB5XZ/)_$?PZ#\ M?6N%H)R:*_@O-\TKYSCJN/Q#]Z;OZ+HEY):'[7A<-#"48T:>R_J_S"MGPCX= MD\4:[;V*9$9.^9Q_ @ZG^@]R*QJ]Z^%?A3_A'M"%U.FV]O0)'R.43^%?ZGZ^ MU?2\%\//B+-849K]U#WI^BZ>LGIZ7?0\_-\>L!AG-?$]%Z]_D=C;6\5G;Q00 MH(X8E"(BCA0!@"N3^)/C0>%=)\JW0Z?:37-PX MCAA0N['L *^:_%'B";Q/K=Q?S9 JV/@LCR_Z]B/:5=81U?F^W^?\ P3+=VD=G=BSLKU_87ACELL#D2KS5G6DY?+2*_)OYGY5Q%B%6QO)':"M\]V M)FC-+17ZV?+B9HS2T4 )FC-+10 F:,TM% "9HS2T4 )FC-+10 F:,TM% "9H MS2T4 5EC83%^"/IS2SPK+$T; %6X(/>G@9IQ4F@#Q;QK\%(KZZ>ZM5D4DY+V MY&_'8,#PP'KG-<3!\)XTU338KG49)+>Z)!\J,1/D*2%SDX)P1TKZ==/? KRG MQA$=.$DB#YK"[$R8_NA@W_H+&O2IXVLH\G,>#7R/+L35]O6HIR-KX9>&;'3K M)Y+=$C,;M$D:CA!P2?4D]R:[Z/.W)X)ZBN,\&3K!J5_;*?W;A9D^F,9_E79J M_'O7!.3E)N3NSV:<(TX*,4DET6P^BF[Q1O J#4=130V:0N1VH!:CZ;)]TT!L MFDD(V&@#PC]HNXE=K&,']RC*3]6S_P#$C\Z\Q\#1:3<>*K!=OA\QIXY0YX)+TT/H'XO\ Q#C\.Z&F ME:5.$OKZ/ D@/,,7]X>_84WX#>-]0\16EWIE^YN#9HC1W#'+E3T4GOC'6OGV M'S;R0)#YES,0%55.\^P^G6OI7X&^!I_"NA7%U> )>W[!V3^XH&%'ZUS8RA0P MN%]G>\VSOR7,,?G&9_6K.%%*W+T_X>YZ6IR,_I3EHVTH&*^:/U$B>%FDW!L4 MY$9.F"N>E244 -20..,_B*7-0K;E26#X8]\5*K;A[]^* %S1FEHH 3-&:6B@ M!,T9I:* $S1FEHH 3-&:6B@!,T9I:* /#_VNO"K:[\,5U*&/?/I%RLY('/E- M\C_J4/\ P&OB2OT^UK2+;7]'OM,O$\RTO(7MY5]592#^AK\V_&?A:Z\$^*M3 MT.]'^D64S1%L8#KU5Q[,I!'UK]?X,QJJ8>>#D]8NZ]'_ )/\S^O_268M=/\./'M_P##;Q=9:Y8$L8CMF@SA9HC]Y#]1T]" M>U*-$L=6T^7 MSK*\B6:)_8CH?0CH1V(->:_M(_"[_A8W@62>SAWZUI0:XM=H^:1,,D_>K2:Y9+^62[>CM)?(_+2BO9?VGOA;_P (%XV; M4[*'9HVL,T\84?+%-UDC]AD[A[' Z5XU7[M@L73QV'AB*6TE_P .OD]#^3\S MR^ME6,J8*NO>@[>O9KR:U05]V_LU?%+_ (6%X&2TO9M^M:2%M[C<9"Q&X>Y'##W45X^?Y8L MSP;C%>_'6/KV^?YV/I>#\\ED>9QG+^'/W9+R>S_[=>OI==3]&\T9JOINI6NL M:=:W]E.ES9W42SP31G*R(P!5@?0@@U9K^?VFG9G]?IIJZ$S1FEHI#$S1FEHH M 3-&:6B@!,U\S_M?_%+[%8P^"M/FQ-K2K%:6<>0K'!DD)VH@]V8@>W7H*_.GQ!XDN_&&MWNM7TXN+J^ ME:9Y%.1D]A[ 8 '8 5]]PEE?UK$?6ZB]VGMYR_X&_K8_)/$//7@,"LOHOWZV M[[1Z_P#@6WI%>:5U[]72/ ME#O_ -O/7T2[G'?%CXB6WPQ\%7NM3!9+@#RK2!C_ *V9L[5^G!)]E-?GCK&K MW>OZK=ZE?SM]>/5]EPSE7]GX15:B_>3U?DNB_5^?H?F?'/$#SC,'0HR_< MTM%V;ZR_1>2OU"BBO2/V?OA^WQ!^)6G6\L>_3K(B]O"1P40C"G_>;:OT)]*^ MHQ.(AA:,Z]3:*N?"8'!U4VDOG_ENS[.^#/A5O!?PQ\/Z5)&8[E+ M82SJ1R)9"7<'Z%B/PKM,TM%?S57K2Q%65:>\FV_GJ?W!AGAJ?PP2BO M1*PF:,TM%8'4)FC-+10 F:,TM% "9HS2T4 )FC-+10 F:*6B@ HHHH **** M"BBB@ HHHH \D_:4^&!^(G@-Y[.+S-8TG=.4445^IGX"?>'[-GQ2_X6+X&2VO)M^M M:4%M[G1-#*A]".H]".H/8@ M5^?7P=^(T_PP\=6.KJ6:R8^1>Q+_ ,M(6(W<>HX8>ZBOT/L[R#4+2"ZMI5GM MYT66*5#E74C((/H0:_"N(\M>5XWVM'2$]5Y/JOD]5Y']7\%9Y'/C^:T?FGW/S<^('@J\^'OB[4="O03):R827&!+&>4Y/]EZ])OM'E;B*\Q@#G_GH %_WE3U-?)]26UQ+9W$4\$CPSQ,'CDC;#(P.0 M01T(-=688.&88:>'J=?P?1GIY3663XB%?#JUM_-=4_4_;JBO*/V:/C-%\:_A M?8ZK*Z?VW:8M-3B7C$Z@?.!V5QAAVY([5ZO7\\XBA4PU65&JK2B[,_I?#UZ> M*HQKTG>,E=!1117.= 4444 %>-?M5_&I?@O\+KJYM)@GB'4]UGIBY^97(^>7 M'HBG/^\4'>O8IIH[:&2:5UBBC4N[N<*H'))/85^4'[3WQGD^-?Q1O=1@D8Z% M8YL],C/ \I3S)CU>:1XKU#2)2RRF>-FW/'*2023DG/8UW^A^+;'6@J!_(N3_RQ MD/)^A[UY/2@D'(X-?NZ=MC^<,5@*.*U:M+NOU[GN5?;W[+/PM_X0GP9_;5]# MMU?6567##YHH.J)[$_>/U4'I7Q[^QWX(U/XL_$)+?4$^U>&](5;J^EE&<\_N MX<]]Y!R#_"K<]*_2X 8 [5^:\7YK:*R^D]]9?HOU^X_0^ .&94*TLTQ*O M;2'ZR^6R^96U/4K;1M.NK^]F6WM+:)III7Z(BC))_ 5^=?Q4^(%S\2_&VH:W M/N2&1O+M86/^JA7[B_7N?.JKWI[>4>_S_+U/$\1<_\ K>)654'[E/67G+M_VZOQ M;[!115S1](N]?U:STVQA,]Y=RK##&O\ $S' K]#E)13E)V2/QN,93DHQ5V]C MV7]E3X8'QAXT&O7D6=*T5ED7<.);CJB_\!^\?HOK7VU7+_#3P):?#?P9I^A6 MN',";IY@,>=,>7?\3T] .U=17\]YYF;S3&2JKX%I'T[_/<_L;A7(UD.6PH2 M7[R7O3?]Y]/1+3\>H4445\^?8!1110 4444 %%%% !1110 5YK^T!\.#\2?A MW>6MM&'U6R/VNRP.6=0/P\,32VDON[KY,_BK-*-O+N85/^MA;[Z_7N/<"O+SW+%FF#E3BO?CK'U[?/8][A//7 MD.91K2?[N7NS]'U_[=>OI==3]$]6TJUUS2[O3KZ%;BSNHFAFB;HRL,$5^=/Q M.\!77PV\::AH=SN=(FWV\Q'^NA;E'_+@^A!':OT7TS4K;6=.M;^RF6XM+F)9 MH94Z.C#(/Y&O&?VK/AHGB[P+)K]K$6U70XVG/EJ6:6WZR+@78SV%5VA/1^3Z/\ 1_\ /W?CG(EG67+%8=7JTM5;[4>J\^Z]++<^)*S M-9\1V6B)^_ES+CB).6/X=OQKD-<^(,UQNBTY3!'T\YOOGZ#M7(22-*Y=V+N> M2S')-?MKEV/YYPN42E[U=V7;J?6/['7[1S^'_B4/#&JLEMH&O.(H-QX@N^!& MQ/\ M_DO7H_GM]W<_H+@O,8QI?V9+3E MUCZ=5\M_O['LU%%%?FI^I!1110 4444 0WEY!I]I/=7,R6]M C2RRR-M5$49 M+$GH 3FOS.\9?MUW?B#XJZO=3:>+SP;YWDZ?'&-EQ%"O ?GABYRY4XQNQG MKV[_ (**?'K_ (1#P;!\/-(N-NKZ]'YFH-&WS0V0.-A]#(P(_P!U6!^\*_-B MOG\XP&%S;#RP6+AS0>ZVUZ:KL?N7 _#T'AY9ABHW<](^2ZOYO;R79GZ/>"_B M!H'Q!T[[9H>HQWB #S(ONRQ'T=#R/Y'MFNBK\S=$UW4?#>HQ7^EWLUA>1'*S M0.58>W'4>QX-?3_P?_:JFUS4+#0?$]B\M_=2I;V]]81%C+(QVJ'B'.22!E.Y M^Z*_FCB#PWQF!O7RMNK3_E^VOTE\K/R/K<9D]2BG.B^:/XK_ #/L/X8^%/\ MA)=?629-UC:8DER.&/\ "OXG] :^@*P?!7AE/"N@068 ,Y_>3N/XG/7\!T'T MJUXEUZ'PUHMS?S8(C7Y$_ON?NK^?]:_;^$A6S\G$ER0?Q5/Z_E7DU3W]]- MJ5[/=7#F2>9R[L>Y-05_*/$F>5>(;Z?UV/1=!T>+0-'M-/A^Y M @7=C[QZEOQ.3^-:%%%?W?1HT\/2C1I*T8I)+LEHD?BTYRJ2H4445L0 M%%%% !1110 4444 %%-D;8C'N!4$AH DHJ)6$: ,23UY.>M1F8RL4SM'3CK_G% $B'+'& M"OK4M0K&L8)'7WJ&\U."QC+S3)&/]HXII-NR)E*,5>3+$N>/K7 >.X(5N)Q( MRI'G1^8W>:084?XUQMZTU\YGN'>=N[R=O8#L* M[J.%DWS2/G\7FM.'NT5=ECPIXBBLI]*GF+[U@\B8!3QC@?R'YUVQ^(&FJN56 M9SZ".O.DB>0GY";XN_NI)>AUL_P 2(@Q\JRD8 M#N[ 5%'\2AD>;8D+ZJX-X! MF\B3'W9?EK82^@GY26-_]UP:\=$#'J-P_P!H9_G4T=HI/";?]WY?Y5A/!P^R MSOI9U67QPN>PJ_/RBJNJZFFFV;RN-Q(VH@ZNQZ 5YY8:IJ6DG,-T9$7_ )93 M?,OY]:@UKQJ;L>?/&RW$8"6]LO\ RT<]U/OT!['E!Z:GM8?,Z6(7*UR MLKZM<3:I=?8$D)GG/FW6XZ>6XJ&)ATW7==5_74\+.\II M9U@*F"J_:6C[26S^_?RNC\O**[+XM_#RX^&/CB^T:3<]J#YUI,W_ "U@8G:? MJ.5/NIKC:_HRC6AB*<:U-WC)71_%N*PU7!UYX>NK3@VFO-%K3-2N=&U*UO[* M9K>[MI5FAE7JCJ<@_F*_13X6>/[;XE^"=/UN#:DLB^7Q%? MG#7M/[+OQ2_X07QJ-)O9MFCZPRPN6/RQ3](W]@<[3]03]VOD^)\K^OX3VM-> M_3U7FNJ_5?\ !/T+@3/_ .R,Q6'K/]U5LGY2^R_T?D[]#ZS^*WP^MOB9X(O] M$FVI.Z^;:S,/]5,OW&^G4'V)K\Z]3L+C1K^ZLKV)K:ZM9&BFC?@HRG!!^A%? MJ'7PU_P4$^$]Y8R6?CO2R_\ 9MRRVNJP1C"I+C$<>_K%_@WV/F[7/'MK8[HK(" MZGZ;\_(OX]_PK@]2U:[U>;S;J9I#V7^%?H*IT5^MMM[GY-AL'1PJ]Q:]^I]] M?L _&[^V]"N/AYJMQF^TU6N-,9SS);D_/%[E&.1_LMZ+7V)7XO>!O&6I?#WQ M=I7B/2)?*U#3IUGC)Z-CAD;U5@2I'H37Z^_#GQYIOQ-\$Z1XFTE]UGJ$(D"$ MY:)^CQM_M*P*GW%?C7%66?5,1]:IKW*F_E+K]^_WG[SPGFOUO#?5*C]^GMYQ MZ?=M]QTE%%%?#'WH4444 %%%>2_M.?&>/X*?"^]U.&1?[F1'D^4G9'/B,13PM&5>J[1BKL^1OV\OC=_PF?C6/P3 MI=QOT?09";MD/RS7F,,/I&"5_P!XO[5\T:-XCO=$<>1)NBSS"_*G_#\*SYYY M+J>2::1I9I&+O(YRS,3DDGN2:CK^AL!@X8##0P]/:/XOJ_F?S;F>*EFF(G7K MJ_-T[+HOD>J:'XRLM8"QLWV:Y/\ RS<\$^Q[UZ'\._!%Y\1/&&G:%9Y5KF3] M[+C(BB'+N?H,_4X'>OFBOTJ_8>^$]YX-^'">)=;+MJVN()+=)1\UO:=4&>N7 M^^?;9TP:Y,YS199@Y5?M/2/K_P #<\_)^%(YKF$(0=J:UGZ+HGY[?CT/H70M M$L_#>C66E:?$(+*SB6&)!V4#'/J>Y/[ ]C7K%]>P:;97%W=2K!;01M++*YPJ(HR2?8 5^=_Q>^(D M_P 3O'-]K#EEM,^39PM_RS@4G:/J>6/NQK\MX;RQYGC?;5M80U?F^B^>[\O4 M_8.-L\CD66?5\.[5*BY8V^S'J_*RT7F_(XNBBBOW0_E$*^\OV;_A=_PKGP)' M->1;-:U7;0HHHH **** "BBB@ HHHH **** "BBB@!,T9I:* $S1FEHH 3-& M:6B@!,T9I:* $S7'_%GX>V_Q-\$7^BR[4N&'FVDS#_53KG:?H>0?9C78T5M1 MK3P]2-6F[2B[HYL3AJ6,HSP]97C)-->3/R\U"PN-*O[FRNX6M[JWD:*6)Q@H MZG!!^A%5Z^E/VP_ADFE7L7C>S18[2X(AU'' 20#"2'T# ;2?4#NU?'.N?$&* M#=%IRB:0<>BU^>U[?W&HS&6YF::0]V/\O2M?P'XUU+X=>,-)\2: M1)Y5_ITZS1YZ..C(W^RRDJ?8FN7.,!'-,)*@]]UY-;?Y/R9];PU+^P,9'%7; MOI+MRO?3\5YH_9R6-)XGCD021N"K(PR&!Z@BORD_:D^"S_!7XH7EC;1,- U# M-YIDAZ",GYHL^J-\OKC:3UK]//AYXZTWXE>"](\2Z2^^RU& 2JI.6C;H\;?[ M2L"I]Q7 ?M2_!9/C5\+KNRMHE;7].S>:8_E?DF0YA+*< M=R5M(R]V2[/O\G^%S]VX@RZ.;X'GHZRC[T7W7;YK\;'Y144^6)X)7CD1HY$) M5D88*D=013*_2]G,?AW5MMGJ0)^5 3\DW_ &.3_LE M_6OU15U=0RD,I&01T(K\0Z_2G]AOXTM\1OAPWAS4IS)KGAQ4@W.?FFM3Q$WN M5P4/T4GEJ_->+LLYHK'TUJM)?H_T^X_4.#LTY9/+ZKT>L?U7Z_>?2F:,TM%? MEA^L"9HS2UE>*O$MAX-\-ZGKNJ2^1I^G6[W,[]]JC) 'ZOXGU,D3WTQ9(9RS3&2K?96D?3_ (.X5+:6LU_=0VUM$\]Q,ZQQQ1KEG8G M4#N23BHJ^M/V!_@C_P )5XMF\>:K;[M+T5_+L%<<2W>,[O<1J0?]YE(^Z:[, MPQL,OPT\14Z?B^B./+L#4S'%0PU/KN^RZL^M_P!F[X.0_!3X7Z?HSHAUBX_T MO4YEYW7# 94'NJ#"CZ$]S73_ !3^(NG?"GP%K'B?4B##8PEHXLX,TIXCC'NS M$#VY/05UE?G3^WA\;O\ A-O&\?@O2[C?HV@2'[24/RS7F,-_W[!*?4O[5^+9 M;A*N>9A>J[W?-)^7_!V7_ /W#,\72R'+K4E9I:IJ$^-5O96FE20XRQ[+[ < =@!5NO#0<'(X-=-H?CN[T[;%=9N[<<9)^=? MH>_XU^]PM"*@E9(_EC&Y7.I*5:E*[>KOW?G_ )_>>F5]1_L?_"[% MW6^FJP[]))1^J#_@?M7SG\)=!_X6]XLT[1=*FR9WS.^.8(AR[D>P!QZG [U^ MDVB:-:>'='L],L(1!96D2PQ1CLH&!]3[]Z^$XMS7ZOAU@Z3]Z>_E'_@[>ES[ MGP^X=EBL:\QQ,;0I/W4^L_\ [5:^K1=S1FEHK\;/Z4$S1FEHH 3-&:6B@!,T M9I:* $S1FEHH 3-&:6B@!,T9I:* .7^)7@6T^(_@S4="NL*9TW03$9\F4#MM]2"COTCE/Z(?\ @'O7Z#PCFGU:N\%5?NSV\I?\'\['X[XB9!]=PBS. M@O?I?%YP_P#M7KZ-]CY;HJM?ZC;:9 9KF98D']X\GV [UPNN?$">YW1:>IMX M^GFM]\_3TK]C;2/YWPV"K8I^XM._0^Z_V0?C!;S^9X U&\3[;&K7.FH[?,T? M62,?3EA[%NPKZB(# @C(/!!%?BUX6\6:GX.\4:=XATRY:+5+"X6YBE))RP/1 MO4'D$=P2*_7KX5_$73OBOX"TCQ/IA AOH@9(O#Z_6O]I'X.0_&SX8:AHR(@UB MW_TO3)FXVSJ#A2>RN,J?J#V%?DU=VDUA=36US$\%Q"[1R12+M9&!P5([$$8K M[?AW,_[1PBC-^_#1^?9_/\T?&<2Y5_9N,IQCD>2QXDQZH<-ZX##O7DE%?18BA3Q5*5&JKQDK,^;PV( MJ86M&O2=I1=T?MU!/'"I M/!.J3[]8T",&U9S\TUGG"C_MF2%_W2GO7U57\\X_!U,!B9X>IO%_>NC^9_1^ M7XVGF&&AB:>TE]SZKY,3-&:6BN ] 3-8'C_QQI?PV\&:QXGUF;R=-TRW:>4C MJV.%1?5F8A0.Y(KH*_.G_@HY\>O[=\06WPTT>XS8:6RW6K-&>)+DC,<7N$4Y M(_O,.Z5G.7)&Y]%D&4SSK'PPJ^'>3[16_P!^R\V?)OQ/^(>J?%;Q[K/BK6'W M7NI3F4H#E8DZ)&O^RJA5'L*Y>BBO+;OJ?UE2IPHPC2IJT8JR79+8*^U/^"^_U.X$*L1E8UZO(W^RJAF/L#7[4_#SP)I?PR\$Z/X7T:+RM.TRW6"/( M^9SU9V_VF8EC[L:Z:,.9\SZ'YKQSG?U#!_4:+_>5=_*/7[]O2YT.:^>/B%\5 MM'\=^(;S1]%U6WOH]%G>WNHH9 66=3M?<.O!RH/3[V*UOVP/CNOP+^$MW^>X/6OFN*\JJY[EL\OHUO9N5FW:Z=M;/R;MMVZ['QG!O#DL="685'9+2'F M^K^6WK?L?IC17S%\,/VNE?R=/\:0;&X4:K:IP?>2,=/JO_?-?2.E:O9:[817 MVG7<-[9RC-IV3VDM8OT?Z.S\C[+$82MA96JKY M]#HO"OA^7Q/KEM819"N=TC@?<0?>/^>Y%?2EG:PV%K#;0((X8D"(@[ # KB_ MA/X3_L+1/MTZ8O;T!^1RD?\ "/QZG\/2NZK^HO#OAS^QQ^.Y]C_K>(]G!^Y#3U?5_I_P .)FC-+17ZP?,"9HS2T4 )FC-+10 F M:,TM% "9HS2T4 1S+6\%>%[K4(H'N)O]7"J*6&\]"V!P!U M/TQ757DIAAW9"C^(DXP,+F/;W;'\/;I7( M_#>YEL_%,+1,5+1,W7D[?F!_3]:^EK8;#XK#>VI1Y;'YEE^89AE>;+ 8FO[6 M,GOZGUN%RH_/\:G6H;63[1;Q2J>&0'Z9%3YPO6OE%L?KG="B)0 ,<"F M&-(QNZ;1^5,N+E+:)I)'"(HW,Q/ %<-K?C&;4BUM8@Q0GK(>&8>J^WO6E.E* MJ[(X\3BJ>&C>3U[$OB'QI,]P]KI[* O#3=?R_P :Y=HY+J0/,[SMZN2<5?LM M,,A'4UO66B =%KUXNG15EN?(SCB,;/F;LNQS]OI)<9[>E:$.C>JYS73P:8%7 MH*G6R ZXK&5>[N=]/+HQ6QS:Z3C&$Q1_9(/\%=,+1?:C[(H[9K)UO,Z5@X=C ME6T8$D;:C.B'LG%=<+8>E.^Q@C-/V_F']GTWT.271L#[M*-)(_AKK/LH':FF MT'I2]JP67QBKM'&WFGL\$B*_E@@\^E+<>D:HN1GUKTN>Q_V:S9 M]/P>E;1JLY:V#Y7='/Z%>S^&'=T7SXG(\U">1C^Z?Z5Z)I.J0:M$)H'#J1R. MA'L17#7=IMSD<>E9EIJ-QHMXUS:M@G[\1/#C_&E.BJJO'IKRVFG9GUD)QJ14HNZ8ZBBBD6%%%% "4UD M RP^]CC-/IK_ '&R,\=/6@!0P8 CO1FHX1MW+C %2T )FC-+10 F:,TM% "9 MHS2T4 )FC-+10 F:,TM% "9HS2T4 >/?M,_"[_A8/@=[ZRAWZUI :> */FEC MQ^\C]^!D>ZX[U\*U^I=?G[^UMX/M_@[XR-]!;O\ V1K1>XM$C7"I)D>9'GH, M$@@>C #I7ZEP?FMKY?5?G']5^J^9^#^(O#LJLHYKA8W;M&:7_DLOT?R/-2P4 M$D@ =2:Y77/'UM8[HK'%U./X\_(OX]_PKC];\4WVML5D?RH.T,? _'UK'K]. MU>M^,/"FG>.?"^J:!JT/VC3M1@:WF3O@CJ#V8'!![$ U^4_[.OQAG^"GQ M/T[7-SMI4I^RZE O/F6[$;B!W92 X]UQW-?K397MOJ5E;W=K,EQ:W$:RQ31G M*NC#*L#W!!!K\,XARYY9C?:T=(2UCY/JOD]5Y']-<.9E'-,#[*MK.'NR\UT? MS6C\[GXY?%#X>:C\*_'>K^&-4!-Q8S%4EVX6:,\I(OLRD'VSCJ*Y6OT4_;R^ M"/\ PFG@J/QMI=OOUC08R+H(/FFL\Y8_]LR2W^Z7]J_.NOU3)LQ69X2-;[2T MEZ_\'<_)L[RV65XR5'[+UCZ/_+8*^M?V!_C=_P (KXLF\!ZK<;=+UI_,L&<\ M17>,;?82* /]Y5 ^\:^2JFM+N:PNH;FVE>"XA=9(Y8VVLC Y# ]B",UV9A@H M9AAIX>IU_!]&<>78ZIEV*AB:?3==UU1^V^:,UYI^SK\6H_C-\*=)U]V0:F@- MIJ,:?P7* !CCL&!5P.P<5Z97\\UZ,\/5E1J*THNS/Z/H5H8FE&M3=XR5U\Q, MT9I:*P-QKR+&C.[!449+-P /6ORJ_:M^-;?&CXH75Q9S%_#VE[K/3%!^5T!^ M>;ZNPS_NA!VK[!_;H^,C_#WX:+X@KR3]F#X+Q_!3X766G7$:C7;[%YJ<@Y/F ML.(\^B#"^F=Q[UW'Q'\>Z;\,?!&K^)M5?;9Z?"9"@.&E?HD:^[,0H^M?AF>Y MA+-L=R4=8KW8KOY_-_A8_>\@RZ.3X#GK:2E[TGV\ODOQN?-/[=GQ^?PA8V/@ M;195;4+T"ZU,]=EOGY(CZ%R,GOA1V:OE#0_&5EK&V-S]FN3_ ,LY#P3['O7$ M>./&6I?$'Q=JOB/5Y?-U#49VGE(Z+G[JKZ*H 4#L *PJ_7,HP$V.^T':",C);NM=.99C3R["SQ$^FR[OHOZZ'R>6\-XK,,PIX./PR>L METBMW]VW=V1]'?"KX?VWPS\$V&B0;7G1?,NIE'^MF;[[?3L/8"NNS2T5_.U: MK.O4E5J.\I.[/[ PV'I82C##T5:,4DEY(3-&:6BL3I$S1FEHH 3-&:6B@!,T M9I:* $S1FEHH 3-&:6B@!,T4M% !129HS0 M%)FC- "T4F:,T +129HS0 M% M)FC- &-XS\(Z;X]\*ZIX>U>'S].U&!H)E[@'HP]&!P0>Q -?D'\3?A]J7PM\ M=:OX8U1?]*L)B@E PLT9Y21?9E(/XX[5^RN:^4OV]/@E_P )AX-B\<:7!NU? M0HRMXJ#YIK/.2?SG MB*[ Y3V$BC_OI5 Y8U^@M?B/97D^G7D%W:S/;W,$BRQ2QG#(ZG*L#V((!K]: M/V<_C%!\:_AAIVMED75H1]EU*!>-EPH&2!V5@0X]FQV-?D_%N6>RJ+'4EI+2 M7KT?S_/U/U_@_-?:TG@*KUCK'TZKY?EZ'QI^W;\$?^$$\=IXQTNWV:)X@D)G M"#Y8+S&7'TD&7'N']!7RY7[)_%'X=:7\5_ NJ^&-6&+:]CPDRC+P2#E)%]U8 M ^_(/!-?D;\0/ NJ_#7QAJ?AO6H?)O[&4QL1]V1>JNI[JPP0?0U]'PQFJQN& M^KU'[\/QCT?RV?R[GS/%64O XGZS27[NI^$NJ^>Z^?8YZO4/V:_B>_PF^,.A M:R\WE:;-*++4,G"FWD(#$_[IVO\ 5!7E]%?75Z,,12E1J;233^9\=AZ\\-6C M6IO6+37R/V]!R*6O-?V;_&3>//@;X.U>5R]PUBMM.['EI(2878^Y,9/XUZ3F MOYOKTI4*LZ4MXMK[G8_IFA6CB*4*T=I)/[U<6OCW_@HA\4'TCPMHW@>SFVS: MLWVV^53SY$;?NU/LT@)_[95]@YK\I/VN?&3>-/V@?%!_!VI?$'Q=I7AS2(O-U#49U@B!Z+GJS>BJ 6)[ &OU]^''@+3? MACX(TCPSI28L]/A$>\C#2OU>1O=F)8_6OF_]A3]G]O!V@'Q]KEOLUG5H=FGP MR#FWM3SO]FDP#[+C^\17UG)(D2,[LJ(H)9F. !ZFOQKBC-?KF(6&I/W(?C+_ M (&WWG[9PIE+P6'>*K*TY_A'I]^[^1Y)^U!\:(_@I\+[W4+>11KM_FSTR,\G MS6',F/1!EO3.T=Z_*&::2XF>65VEED8L[N'],W6>F)GAD!^:7'J[#/KM"@]*\;K[WA[+/[.PB M:_VEC&H/]W#1>?=_/\K!117LW[*?P4;XT?%"UM[R$OX>TO;>:FQ'RN@/R0_5 MV&/]T.>U>_B<13PE&5>J[1BKGSV%PU3%UH4*2O*3LCZ[_87^"/\ PK_P WBS M4[?9KOB%%>,./F@L^L:^Q?[Y]MG<5].TU%6-%1 %11@*HP /2ES7\\XW%U,= MB)XBIO)_V_N:_-VOWW)O\ P=S^><[RO^R<7*C%>X]8^G;Y;!7U M-^PA\;O^$'\5)8G:.5 M&#*Z'#*1R"#V-=^.P=/'X:>'J;27W/H_D<& QM3+\3#$T]XO[UU7S1^W=?GM M^WQ\$?\ A%?%D/CS2K?;I>M/Y=^J#B*[QG=["103_O*Q/WA7U7^R]\:8_C5\ M+K._N)5.O6&+/4X^A,H'$F/1QAO3.X=J[KXC>!-,^)O@G5O#.K)NLM0A,9<# M+1/U21?]I6 8>XK\4P&)JY%F/[Q;/EDO+^M4?N>8X6CG^6_NG\2YHOL_ZT9^ M,M%=%\0O FJ_#/QCJ?AO68?*O["4QL1]V1>JR*>ZLI!'UKG:_=X3C4BIP=T] M4?S_ #A*E)PFK-:-'9_!WXCW7PF^)&A^)[7Z_1[?<_S/TG@O'.-6I@I/ M22YEZK?[U^1]!T4F:,U^4GZX<5\:/B7:_"#X7^(?%MT%D_LZV+0PL>)9V(6) M/H790?09/:OQ1UG5[SQ!J]]JFH3M=7][.]S<3O\ >DD=BS,?SM(8[:UMXUAAAB&U8T4850.P &*^2/^"AOQ[_X0;P)'X#TBYV:WXBC) MO&C;YH+'.&'L9""G^Z)/:O2TI0/Y=D\5Q7G&F]1_^ Q7^2^]^;/C+]J_XYR_ M'?XM7^J6\KGP_89LM)B.0/)4G,F/[TC9;UP5'\->-445YK;D[L_J'"86E@J$ M,-15HQ5E_7YA7T]^P+X%\1>-_BUOM+VXM/"VEJ+K5T7F*?.1%"5.1N8@\]0J MO@@XKYGLK.?4;R"TM87N+F>18HH8UW,[L<*H'"E![IJZ?R9\;QEG$;1ZUTI:3-&:]@_F06BDS1F@!:*3-&: %HI,T9H 6BDS1F@ M!:*3-&: *FL6WVW3+FWSM,J%,^F>/ZU\9:WH=QX:U6XTR_B:*:%BH:1<"1>S M#M@BOM*XP2F>1R?QK!\0>$=)\4*D>I6J7!3[K$?,._7KU[5ZF!QKP;>ETSY; M/T M$JR*8A QQ+M/.X#H"?1ATQ7K-A\&M"TYUDAC9".@")Q_P+;Q71GP=8+;;8%> MVD'_ "V0Y8_4GK7;BD>*+/5P(][0W ^]#)P?P/?\*X_Q!X4='\RXB96 M3[E_; C:?<=5^O2L"[FO( MO=A+I7&8KZ/Y74>X'7ZK7CJ'M&K'W=:M[*#J2 MZ'4^*-:;5;HVD#9M8SAR#]]O\*@T[2Q(1E3UK.T,F:>-%VRQL<*5KO-.LM@K MNDU1BHQ/EJ=.6,JNK4V#3]+6,*< UJI;A1C I8DVK4O2O-G.[U/IZ5%05K#! M'BAE&.GY5%>W\-C"9)W"*/7J:X/Q!XRO;L-%9#[+$?X_XC^/:B$92V%5JQI* M[.NU77M.T5"][=QP@X8O M(S.QYR_)_.N9U'2_:O1I892=I'S6+S2K%?NU8Z+4_P!J2YMMQM_#J$?]-;G_ M 6L*3]LJ]M#^_\ "J.G_3*[Y_5:XS5-(SN.W-<=K.D9W?+7L4LOHRW1\5B> M(,=2;Y9(][T3]M[PA,R1ZSINHZ0YX,AC$T8_%>?TKV#P;\4/"OQ!@6?0-_=QBN(^SWNA:B+JPN);*YC;M2G;$P4D?K[)$&X'6JLMIN[5\)_!S]MW7/"DT.F^.HI-;TK(0: MC O^DPCU8=)!Z]#]:^W/"?B[1_'6B6^KZ'?Q:C83C#S:%Z,M>W4BO; $-P,UQNL6IB+''>O1YTSG(KE="/6O%[J- MHW;';G\O\FO0OAY>&;16A8\V[F,?[O4?SK3&4U93B<^2XAQD\,WIT.NI,TP' M1@BJ,EF. !7#:O\9?"VA7!AN=1:20'E;>%Y<# M_@*FKA3E4=H*YSUJ]+#QYJLE%>;L>@4,1M.>F*YGPQXWT7QG$7TG48[HIR\> M"CK_ +RMAA73=JF490=I*S-*=2%6/-!W1$,)(, -[5-36'R]L^]*#D ]/:I M-!:*3-&: %HI,T9H 6BDS1F@!:*3-&: %HI,T9H 6BDS1F@!:\Y^/_PCM?C3 M\,]3\/2!$OP/M&GW#_\ +&Y4'8<]@'J1JTW:47=&%>C# M$4I4:JO&2LS\2]3TVZT;4;JPOH'M;VUE:">"08:-U)#*1Z@@BJU?8O[?_P $ M?[%URW^(FDP8LM19;?5%C'$=P!\DOL'48)_O*.[5\=5_0N78Z&8X:&(AUW79 M]4?SCF6 GEN*GAI]-GW71_UU"OT#_8$^-W_"2>&9_ &JW&[4M(0S:.-2^&WC/2?$NDR;+[3IQ*H)PLB]&1O]EE)4^Q- M89OETZ;!&PT*]S=Z7*2QYCSZH-M-^(O@[2?$FDR>98:C LR GYD/1D;_:5@5/N#7$?M(_!"T^.?P[N-+ MCBURSS<:7=/QLFQ]PG^XX^4_@>=HK\ER+,I93C'"MI"6DEV\_E^5S]?S_+(Y MQ@E.CK..L7WOT^:_&Q^3%%7-8T>]\/ZK=Z9J5M)97]I*T,]O,N'C=3@@CZU3 MK]R34E=;'X*TXNSW/JK_ ()]?$IO#?Q-O?"=S,5L=?@+0HQX%S$"RX],IY@] MR%K]%*_&+X>^*9?!'COP_P"((20^FWT-T?>5:D:5.526R3?W'YF M?M3?$MOBC\:]?U&.8RZ;9R?V=8\Y7R8B5W+[,V]_^!UY+2]:2OZ1P]"&&HPH MPVBDON/YEQ->>*K3KU-Y-O[PKZI_8/\ @A_PFOC9_&NJ6^_1M!D'V4./EFO, M97ZB,$-_O%/>O ?AA\-]8^+'C73_ WHD)>ZNG_>2D92WB'WY7/95'YG ') MK];OASX!TGX8>#-+\-:-%Y=C8Q; S??E<\O(WJS,23]?2OD.)\U6#P_U6D_? MG^$>OW[+YGV7"N4/&XCZU57[N'XRZ+Y;OY'2U^>O[?'QN_X2OQ;#X#TJXW:5 MHC^9?,AXEN\8V^XC4D?[S,#]T5];_M(_&.'X*?"_4-91T.L7'^B:9"W.ZX8' M#$=U0 L?]W'<5^3-W=37UU-Y).:^?X2RSVM1XZJ MM(Z1]>K^7Y^A]'QAFOLJ:P%)ZRUEZ=%\_P O4BHHHK]7/R$ZOX6_#O4?BKX\ MTCPQI@(GOI@KRXRL,0Y>1O95!/OP.IK]>_"'A73O _AC3- TF$6^G:= MO"G M? '4GN2::W\3L!\\.?1P,?[P0]J_*V6)X)7CD1HY$)5 MD88*D=01V-?N_#^9_P!I81.;]^.DOT?S_.Y^ <195_9F,?(OW<]8_JOE^5AE M?0?[%'Q=/PU^+MMIEY/Y>B>(MMC'@L5/!8B&(I[Q=_P#-?-:'[8ZK MJUCH=A-?:C>06%E"-TEQ5$T7),6"-SKGD$XV\D9!.=;P'\+OB)^U;9:?XG\4>)C!X:DSY+,XP_$3X)>$/@_\ L_>.Y-$TU6U Z-<1/J=V1)B@#VK^=,'/&T<="-']W)2M=[[V>A^FX[$9GQ!A9^QI*CA[7YIZRDEK[L>G MK\TS\R:***_I8_)3ZO\ V?/CO\0? ?PRLM(\+>%TU[38YIG:=[&XG\N1G)*; MHV Z;3CK\WTKTC_AJGXR_P#1.X?_ 4WO_Q=>'_LP_%;XD>%])U7P_X#T_\ MM8-/]OGMUM#<,F55"V >!\JC/TKW#_A<7[1O_0G3?^"5_P#&OYLXBC*CFV(B MY2^*^W?7]3Z_"X^LJ,8QQ-=)*UHTU**MT3OJ'_#5/QE_Z)W#_P""F]_^+KX@ M\97S:IXOUR]=M[W%]/,S'N6D8Y_6OL[Q%\>?C[H.AWM_JOAUM*T^&,F:]ETI MHUA!XW;B<#DC\:^&W^^W.>>M?:\!)REB)MM_"M5;N>;F>+G7Y: M6WIWOU]!M=W\+=&VW?1O[>TW0[FW>YLY8V-NV\L5\YEZ*?+(P>"3SD9! MX2OLC_@F^R3>(O'5G*BRPSV-N7C<95@'<8([_>/YU][Q#4K4LKK3H2Y966O: M[2?X'-E>$>/Q<,,ISM>S2;6G75'U)\'_ -H?PG\7+>.WLIQIFM!?GTFZ M8"3@<^6>DB_3G'4"N!_;F^+I^'OPJ.A6,_E:QXD+6JE#AH[8 >:+'<5MW8<@QDG"]:^&_C;XQ\4>*/ M%XLO%E_)?:IH49TIC*ZN4*.Q92R\,P8D%N2<=37Y%POA9XS,8PKQO&'O-]-- MK_/[S[_,\YS3 86>"Q]+WY*T:D?ADNOI*W^=DCSZBBBOWX_+"2""2YFCAAC: M6:1@B1H,LS$X '4FOU?_9B^#$?P4^%]EIL\:_VY>XO-3E')\YAQ'GT087TR M&/\ %7R3^P?\#6\8^,6\\QD$>HC!#?[Q3T-?HA7Y3Q; MFGM)K 4GI'67KT7RW]?0_7.#\J]G!YA56LM(^G5_/;T]1:*2BOS@_3!:*2B@ M!:*2B@!:*2B@!:*2B@!:*2B@!:*2B@!:*2B@!:*2B@!'19$9'4,K#!4C((K\ MJ_VKO@HWP7^*%S!9PE/#VJ;KS36 ^5%)^>'ZHQQ_NE#WK]5:\F_:;^#$?QK^ M%]]ID,:?VY9YO-,E/!$RC_5D^CC*GMD@]J^FX?S/^S<6G-^Y+27Z/Y?E<^6X MBRO^T\&U!?O(:Q_5?/\ .Q^3=%27%O+:3R031O#-&Q1XW4JRL#@@@]"#4=?N MY^ ;'L_[)_QD?X/?%>QFN9O+T'52MCJ2L<*J,?DE/^XQSG^Z7'>OU6ZU^(5? M:7@[]LOQ3=_#3PSX9\.Z*^H>+([86-DVVWO%>NZZ;GI_[B3?O2MU:Z:?TS'KZJ_8@^-.A_":W\9+XBGFAL+M[0PF&(R$2 39X'J,<_[ M-?*M>M_LX^)_!GA[Q/J:>/-&FUO0Y[31EN)J8/%0K4IQC)7UE?E5TUK;6Q]X?\-G?#'_H(WW_@#)1_ MPV=\,?\ H(WW_@#)7B7_ L?]FW_ *$#6/\ OD__ "31_P +'_9M_P"A UC_ M +Y/_P DU_.GUBI_/'\3[?\ UCS#_H-PW_D_^1\U?ML_$RP^*OQMDU?299)M M+BTZWM;9Y4*,5&YF^4\CYW>O!*[WX[ZKHNL_%?7[OPYIS:3H32(+*S(OVB?#.BZO:1W^E:DEW;W-O+G#K]EE9> M1R"&52".00"*^OO'7[+_ (O^$FL-XI^%>J7I4#[LR?[)&>G M#=:N#G#WU&Z_$_#_ !8S[.BJF%Y5*:C\=[M7MLTDMN^KZ6^LO%/B M6P\&^&M4U[59A;Z=IMM)=7$GHB*6./4\<#N<5^*?Q;^)>I?%[XAZUXLU4D7& MH3ETAW96"(<1Q+[*H ]\$]37TM^TS^UKK?C[X,Q^#-0TX:5K%Q?(NHS0DJEQ M#%EBNP\H?,$9(R1\O;.!\=5=2JJJ7+L?8>%]'#8S+7G5'7VK:C=6:479[_WD MT_0***Z'X?>!M4^)?C31_#&BP^=J.IW"P1@_=0=6=O154%B?136&Y^S5*D:4 M'4F[)*[?9(^J?^"=7P$_X2WQ?/\ $35[?=I.A2>5IRR#B:\(R7'J(U(/^\RD M?=-?I-7+_#+X>Z9\*O >C>%='3;8Z; (@Y&&E?J\C?[3,68^YKIZ]2G#DC8_ MD_B#-Y9UCYXE_"M(KM%;??N_-BT4E%:'S8M%)10 M%)10 M%)10 M%)10 M% M)10 UXQ)UZ]C3(LA3DYY/)[U+4<,8C##'?/YT */QI13L4AZTK"V&2,JH2Q M49SGTKRB]CCU#4[B6!%CC9RJA1\N,]<>_M7>>,-0_L_1IBI(DD/EH?4G_P"M MFN*TF+YAZ5Z6&C:+F?-YG5E=L5;8\6!FNUN(/EZ5B7\ P>*[Z&Y\_C=%H>=ZGI M^">,=:XS5]/'S5Z;JT'RGBN(UJ#Y6XKZ3#*Y^:9I*USS#6K 8-<%JFG@N]>I M:U"/FKAK^#<[8&M=)\(_C%XA^"OB%+[2Y3/I\ MC@W>G2-^[F7O@= WO4%_:Y!XK#NK+&3MZQEN85L)452E*S M/U!^''Q)T?XI>%[?6]'N!)#(,2PL<20/W1QV(_E5[5^0:_._X"_%:_\ A#XN MBNHW:;2+@B.]M6.0R?W@/[P_45^@L6J6NNZ5:ZA92K/:W,8ECD7^(&O@\3A7 MA*OD]C^A&;X52?QK:^?4)*Z9^C1FI)/N9_Q MO\9S6D;65M)L+.(E*GG.,LWX<8SQDYKPZSL[G4KCR;:VFNYWR=L*,['U)/7\ M37=_%."\>"PGEL%M+>-RFU67JP'4+P*Q_AOXHA\'^++?4+O?Y&QXY-J[C@C@ MX^HK['+DJ6%=2G&\S\9XDF\3G4,-B9\E.QU_PK\!>*M&\6:?JDE@]E:+\DWF MN 2A7D8&?8_5:^C P]:\-U3]I&"($:=I$LJ@X,ES)LS^ R:]DTR\&H65I<@8 M$T2R8^H!_K7SV-]O*7M*\;-GWW#[R^A1>%P-5S4=V_,O.<*3^-"#"C)S0>,4 MM>8CZP6BDHI@+1244 +1244 +1244 +1244 +1244 +1244 8GC?P=IOQ \) M:KX=U>+SM/U&!H)0.JYZ,OHRD!@>Q K\@OB/X"U+X8^-]7\,ZJF+S3YC'O P MLJ=4D7V92&'UK]F*^4OV[?@._C?PK'XXT:V\S6=$B*WL<8^:>S&26]S&26_W M2WH!7VW"^:?4\3]7JOW)_A+I]^WW=CX;BO*OKN&^LTE[]/\ &/5?+=?/N?G? M1117[.?B!]K?\$[OBPT-[J_P^OI28Y@VHZ=N/1Q@31CZC:X'^RY[U]%?%/\ M:?\ !?PP\ZU:[_MO6DR/[.T]@Q1O21_NI[CEO]FORQ\.ZM/HFLVUW;W4EFZD MHT\3,K*C H_*\_=8C'<$BOTG^$_['?A'PC%;:CKCKXLU(@2+YRXLU[C;'SO^ MK$@^@K\0XQPE7#XY5:,;1J*]_-:/3[G\S])R3,LWQ6%6 P$(WAO.3TBGLN7= MO>VZ/B_]H?Q%JWQ3OAX_U#P[%HEO=2+90W%O$RI<%0Q +G_6.%&"P'0 <<"O M%J^\_P#@I R6W@[P/:1(LKX,K[_A.-195#VDW)W>_1 M7M9>6A\AG.#G@<;.C5J.I+1N35KMJ[T6P5]W:;HG[1NM:=:ZAHFJRMHUW$L] MB5O;8 P, T?7G[I'6OA&OKGX'>"_C%\2/AW8:CX4\:7%GH]K_H"6S:O/#Y)C M &T(H( P1C'8UX''="4\-1JI-\K:T\UU^XG+>:2W MM?[2EN4!B*99E? '^L&#[FOS+)*,ZF9X>*C-^_%[]$TW\DM_(];%4ZM"C**2[RFN773WE;5=UU/G"BBBOZ'M6A87LQ MC$JMLE=&27 W1 ,IP0<=#G)*U]D_![]I+PK\7(XK6*;^R->(^;2[MQN8]_*; M@2#Z8/J!7.?L0.MU^S5X>A=0Z)+>1LK#((-Q(<$?\"KC?VF?V:_"VA^%M9\= MZ%-_PC5SIL1NYK2$8@F((P$ _P!6Y) &/ESC@=:_G#-J>)EFE90;FW-JS];) M+\C]7PF&S+*,'3QV G[2DXJ4JC_%GSM^V_\6&^(GQ?N-(M92VD M>&]UA$ ?E:?/[]_KN 3Z1CUKYXJ6ZN9;RYEN)G,DTKF1W8Y+,3DD_C45?T%@ ML-'!X:GAXKX5;Y]?O9^:XW%3QV(GB:F\G?\ R7R6@5ZY^S#\&)/C7\4;+3IX MV.A6.+S4Y!P/*4\1Y]7.%]<;CVKRBUMIKVYBM[>)Y[B9Q''%&I9G8G ZDG MC%?JO^RW\$5^"/PTM[*ZC3_A(=1(N]3D4YPY'RQ ^B X],EB.M>+Q!FBRW"/ MD?[R>B_5_+\['N\.Y4\SQBYU^[AK+S[+Y_E<]?@ACMH8X88UBBC4(B(,*J@8 M ["GTE%?A)^_"T4E% "T4E% "T4E% "T4E% "T4E% "T4E% "T4E% "T4E% M "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "U\%_MR?LV2:1 MJ%S\1_#=KNT^Y;=K%K$O^HE)Q]H '\+'[WHQS_$>:CNK:"^MI;:XBCGMY MD,JV:[KM_D>1FF6TLUPSH5-'NGV??_ M #/Q&HKZU_::_8JU'PC>7?B7P#:2ZGH$C&2;2807N++N=@ZR1_3YE[Y )KY+ M92K$$$$<$'M7[O@BQR1H0!_P(.?QKU+]JZ?[/^SOXX;IFQ"?]]2(/ZUY MA_P3S\(WFA_"75=8NXGA36-0+VP<8WQ1H%WCV+[Q_P !KT+]L5RG[-GC4@\^ M3;C\[F(5^0XSDEQ!:&WM(_?=7_&Y^S8)SCP[>>_LY?=9V_"Q^4]%%%?MQ^$' MT9^P1XA.C?M!6EGNPNK:?!IL[=U^(, M_P#71&C_ /9Z_6?-?CO&%-1QT)KK%?@W_P _:>"ZCGE\X/[,G^*7_!/GG]O M#Q =$_9ZU"V#%6U6^MK($>S^NKZ1?6+.46Z@> L.H#*1G]:_%WQ!H-]X6UR_T?4[=K74+& M=[>>%QRKJ<$?IUKX_@IP_?K[7N_=J?9\<*=L._L^]]^AGUWGP7^$&L?&OQQ: M>'])4QQG][>7K+E+6 'YG;U/8#N2!QR19^#GP&\5_&W6TM-"LFCL$<+=:K<* M5MK<=\M_$V.BCD^PR1^G7P7^#&@?!#PC'HNBQ^9,^'O-0D4"6[EQ]YO0#D!> M@'J22?HL\SVGEM-TJ3O5>R[>;_1?H?-9#P_5S.HJM56I+=]_)?J^GJ=%X'\% MZ7\//">F>'=%@%OINGPB*-?XF[LS'NS$EB>Y)K=I,T9K\2G.523G)W;W/W6$ M(TXJ$%9+1"T4F:,U!8M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129 MHS0 M%)FC- "T4F:,T +129HS0!\#_MV?L\/H>K2?$;P_:$Z;>N!J\,2\03D MX$^!_"YX;T;G^/CXZK]M-3TVTUG3KFPOK>.[LKF-H9H)E#)(C##*0>H(-?FA M^U%^RKJ/P8U6;6=$BFU#P7>OZUPSGD:T(X'$O MWEI%]UV]5T[KS/Q_BC(949RQ^&C[CUDET??T?7L_+;YZK['_ .";WB!(O%_B M[0WCC:2>QCO8I"HWH(Y C@'K@^:F1_LBOCBOI_\ X)YVDTWQROIHU/DPZ+.9 M6[ &6( ?G_*OH^(*<:F65E+HK_-.Z/F.'IN&:4''O;[TT?H_7XGZ[/\ :M;U M";.?,N)'S]6)K]K99!%$[]=H)K\168NQ8\DG)KX_@I:XA_X?_;C[3CEZ8=?X MO_;1*[;X)W-C;?%OPC_:EM#=Z9-J<%O=07"AHVB=PC;@>H ;/X5Q-36=T]C> M07,9Q)#(LBGW!R/Y5^DXBC'$49T9JZDFOO/R^E-4ZD9M7LTS]?/^%#?#K_H2 MM$_\ T_PK+\4?"+X:^&/#.KZS/X*T3R=.LYKM\V:8VQH7/;T%>EVMREW;13Q MG,48'$XFE1]C'WI)?"NKMV/QLO+R:_N9+B=S)*YRS&H:**\P_MJE2IT81I4H MJ,8JR25DDMDET2/9_P!C2X^S?M-^ GSC-XZ?]]0R+_6OV)K\9?V4YC!^T;\/ M6'?5HE_/(_K7[,YKNP_PL_ O$6/_ H49?W/_;F?DK^WIXF3Q#^TMXB@B2-( M-,CM[)3&H&]A$KNS8ZG<[+D\X4>E?/5>K_M76<]A^T=\0H[E2DC:M+* ?[CX M=#^*LIKRBN2?Q,_9\EHPH99AZ=/90C^*3;^;U"OTT_8&_9I?X;^&3XZ\1V9B M\3:S#ML[>96/C[Q_8-;Z="RSZ7H MMRF&N6'*S3*>D8X*J?O=3\N-WZ&YKJHT[>\S\IXUXGA5B\KP4KK[:?43'FD]A,XGXA71,MG;#H29"/R _F M:S])3&*=XY5^%12QSZ"O/EJSZ&F[*YQ'Q"\0 W,6EQMM'#RX_05DZ<. 1P.P M]JX\:R=;UFZO&;/FR$C)Z 'C^==7IDHVKSVKOC3Y8GS]3$>UJ.5SH(!QFK., M+5&WG4+R:F>Y7;P:F,&)U%:[8VX8!36!J#@ \U>N[T!3S7-ZG?C!^;%>C0A* MYX./Q$5'1F3J\R_, :XG6I/O<]JW]4OA@\UQNKW.XN<\5])AH-'Y=FE>+O8Y M?5W#9 /6N4NH,DUTM\P9JR)XQUKW8Z'P%5\T]3F+VUSGBL:[M.O%=;=6_&<< M&JLOAS4;BV-Q#IUU+!@GS(X69?S K*K*$=).U]/F=N'I59OW(MWVZ_DM?57[*OQ%)@F\'WTI(VF>PR>G]^/^H^C>U?--OITD]UY2KM;G.X'@ M8ZFN[\.M;^'M+TKQ3HUV]S-9WXCD<\*N%#)CV8!A7S>8RI:4YO66Q^F\/_6: M-\7"#]FM'TUZJWIJ?9VI1DD\<$5@2)ACD$]N#6Y8ZG#K^BV>HP',=S"LH]LC MD?GFLJZ7$G%>%2;MR_>?H&+C=\R]?ET+7A?PS-?0%[+3K0NCE&N)SU/!Z1GH)0WYC_ZU=NG2O(KMQJ- M(^XP#]IAH-]CA?$7PQMM3TN2WAW2%U*NDTA(D![9ZJ?0BO#=:^#WB+3+ADM[ M22[CR<#!5Q]2,JP]\BOJZH]A]/>JP^,JX;X&E!X';V MKC/:%HI,T9H 6BDS1F@!:*3-&: %HI,T9H 6BDS1F@!:*3-&: %HI,T9H 6D M95=2K ,I&"",@BC-&: /S5_; _9EE^$NOR>)?#]JS^#M0ER5C&1I\S'_ %9] M$)^Z?^ GD GYLK]L=9T>Q\0Z5=Z9J=K%?:?=QF&>VG4,DB$8((K\_?V@/V&- M<\(WESK'@&";7]!8ESIJG?>6O^RHZRKZ8^;U!QN/ZWD/$=.M!87&RM-:*3V? MJ^_Y^I^/<0\-5*,Y8K QO!ZN*W7HNWY>A\H5^PGP*U636_@OX&O9N9I=&M-Y M/=A$H)_$C-?E#X?^&GBGQ/XE@T#3]!OY=5EE$7V=K=U,9SR7R/E ZDG ZU^ MO'P_\+)X&\"^'_#R.L@TNP@LS(O1RB!2WXD$_C7/QE6I2I4::=Y7;^5CHX)H MU8U:U1IJ-DOG<^1O^"ED^VS^'L/]^2_?\A;C_P!FKX:K[:_X*6-FY^'@]$U# M^=O7Q+7T?#*ME5'_ +>_]*9\UQ0[YO6_[=_])05]]_\ !-S76N/!'C#1RGFQE3_ .B*^!*^S/\ @FQJ!B\3>.+'/$UI;3?]\.X_]J4N)J?/E=7R ML_Q7Z#X7J>SS:EYW7_DK_4^\J_.[_@HMKC7OQ;T/2P263=^B)7 MZ(9K\P/VYM0-[^T?K\).1:6]I"/Q@1__ &>OS[A*GSYES?RQ;_)?J?HO&%3D MRSE_FDE^;_0\!HHHK]I/P\_33]@F?SOV>K)/^>6H72?^/!O_ &:E_;TU633O MV>K^!/NWU_:VS_[H9'C.2@]V0N![D5^(59TZ/$#G4=HJI?\3]WI0J5N'5"FKR=. MR^[8_)ZBM^P\ >)]4U@Z3:>'=5N=3#%#9QV5K]8Q^:X7+J7M*TM>B6[] M/\]C\AR_*,7F57V=&&G5O9>O^6Y!^Q#^S%);R6OQ'\56C1N!OT6QF7!&1_Q\ ML#_XYG_>_NFOMRD "@ 8 ' HS7X9F.858>J+129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T + M129HS0 M%)FB@ HI:* $HI:* $HI:* $HI:* $HI:* $HI:* $HI:* $KB_$ M/P4\ ^*]3_M'5_!VBZA?DY:XFLHR[G_:./F_'-=K16M.K4I/FIR:?D[&52E3 MK+EJ137FKD-K:PV-M%;6T,=O;Q*$CBB4*B*!@ < =J\<_;*/\ QC5XT_ZY MVW_I5#7M->+?ME?\FU>-/^N=M_Z50UW99KCZ'^./_I2.#-%;+ZZ7\DO_ $EG MY54445_11_-9Z!^SZQ7XY^ "/^@[9C_R,M?K[7Y _L__ /)<_A__ -AVR_\ M1R5^O]?DW&?^\TO\+_,_8."/]UK?XE^1\6?\%*6/]C^ E[&>\/\ X[#7PI7W M5_P4J_Y!/@'_ *[WO_H,-?"M?8<,?\BJE_V]_P"E,^+XJ_Y&]7_MW_TE!7U5 M_P $YC_Q>?7?^Q?E_P#2FWKY5KZJ_P""NO/O\ D65_ M0X^'_P#D:4/4_1.N/\3_ >\#^--574]=\)Z3JNH &YNK1'=@.@8X^8#T.: M[&BOP2G4G2?-3DT_)V/Z#J4J=5*]2DOO#^H7?A*25MSVT,8N+8>NQ&(9< M^@; [ 5Z9\ /V=-!^ &D7L.G7$VJ:G?E3=:C<(JLX7.U%4?=49)QDDD\GICU MBBO5K9MCL10^K5:K<.S_ %>[^;/(HY1@,/7^LTJ24^Z_1;+Y(@O3BSG./^6; M?RK\2*_;>^_X\KC_ *YM_*OQ(K[K@K;$?]N_^W'P7'.^&_[?_P#;0HHHK]-/ MRP_9[X?3-<> O#4K$LSZ9;,2>Y,2FO)/VZYFA_96\;E25+"R7/L;V '],UZO M\-?^2=>%?^P5:_\ HE:\D_;R_P"35O&G^]8_^EL%?S+B=)3^9_7O#FN88*_\ M]/\ ]*1^1U%%%>(?V&>H?LNG'[1/P[_[#5M_Z&*_9^OQ@_9>_P"3B/AW_P!A MJV_]#%?M!7=A_A9^!>(W^_4/\'ZL^O")8+BY M@@6:.Y1>%+H2IW@8&X-T !!P,0_!C]@[X>?"?4(-6OEG\7ZW"0T4^J(H@A<= M&2$<9]V+8P",5])T5OR1OS6/@UG^9QPJP4:[5-*UEV[7WMY7L)12T59X E%+ M10 E%+10 E%+10 E%+10 E%+10 E%+10 E%+10 R4,ZE5;8?7VI(8C$N,YIP M^\U.H *B?K^-2U$_)_&@F6QYYXWMC%X@60\B6,$'Z4FE @"K_P 0!FZL3W.X M9JEIO"BO8IMNBCXNK%1QD_4Z>U4LE87Q1U;^Q? &M78R&\C8N/5N/ZUOV7*X MKSG]I6\-A\);YE.-UQ I^GF+_A7'%)U$CV:LO9X>)(DMWF:55A52QD+?* !DG/T%>=:%\0[CQ]<:NVF1?9- M*L'V)?RKN-VP/S!%Z!1D')ZUV_N:'+S2^+;KZL\B%+&9BING'W8?$W9)+?YM MV=EJSN-2U0-D;N?K7):WK,%K;23SSK!!&"SRRMM50.I)/2O+_$?B'QA8QZCJ M%GJZ7QL[EH9=/FME!*<$,I'^R1^M>>^,/%&M?%K6-+\,QVG]G1A97O8I'&)9 M51ML?.."VW@^M-+UO2M6M[6ZDU..TM+IT2&XE5MKECA>@Z$]ZZG7 M?AOJNG::FH0"+4K @DW%HV]5QZ]Q7GM[IXUVQL?#\I&D:C<11[(YH_EMW4K@ M8'HQQ7JO@[Q5J'@G3KF>-_/-C=?9KRT?F.6,Y[=CD=?>KJ9EC*<%42O=I6_# M\[?>>(N&,IJ5XX:S3E=IWU2T=WTLES7\T>?^#M2CD\;3Z1?0PK$$3$A/)656 M0-^#5K:1K^K>&DM+^ROIXH[.Y,$S+(6C9<]QT(QFNT\1Z7X1\?:5=7WAF6UT M_6I)%DELKQQ$X&TAE1NF"2#^';->2^$Q)X;\-ZOH'B!A9G'[B0,)-S))\AR" MVWV MEZ'\0!J4$D%KX=\<0%X!(A"0W?\ =(['->87/@NZ\ 6FH^&Y@[+=VJ7R"0<" M5&)*@^P8@>U<7XN\;3^(+^WF#&#R(TC5D^5F**%#D^O'6K]K\5/$MQ9K:3ZH M]S" 543(CL >N&8$_K4T\OKJC%U'[SO\O,TK9_@ZU65*$?<75;-]?^'/IO\ M9PU\ZQX%ET]WRUC.47/9&Y'ZYKNKM,')'7FO"_V7=7<>(]4LV.?M%KYF,XRR ML!T^C9_"O=]1^1VSS3E'DK69Z-"I[; 0EVT.C^''^MOQVPA_]"KO$Z5POPWC M+B^D'W2RH#] ?\:[J/[M>'BK>UD?H&4IQPD4QU%%%(/^176]%^:,>'/^1K0]7^3/ MT"K\L/VTR3^TSXSSZV?_ *1P5^J%?E=^VE_R(>X)12 MT4 )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 %%% M% !1110 4444 %%%% !1110 4444 %%%% !1110 5XM^V5_R;5XT_P"N=M_Z M50U[37BW[97_ ";5XT_ZYVW_ *50UZ66?[]0_P ??\BROZ M''P__P C2A_B/T4HHHK\ /Z("BBB@ HHHH **** "BBB@ HHHH **** "BBB M@ HHHH **** "BBB@ HHHH **** "BBB@ HHHH @OO\ CRN/^N;?RK\2*_;> M^_X\KC_KFW\J_$BOU#@K;$?]N_\ MQ^5<<[X;_M__P!M"BBBOTT_+#]FOAK_ M ,DZ\*_]@JU_]$K7DG[>7_)JWC3_ 'K'_P!+8*];^&O_ "3KPK_V"K7_ -$K M7DG[>7_)JWC3_>L?_2V"OYEQ/Q5/F?U[PY_R,,%_CI_^E(_(ZBBBO$/[#/4/ MV7O^3B/AW_V&K;_T,5^T%?B_^R]_R<1\._\ L-6W_H8K]H*[L/\ "S\"\1O] M^H?X/U84445U'Y(%%%% !1110 4444 %%%% !1110 4444 %%%% !3)'V+[G M@4^H;@C;CKWQ1Z"95FU"+3H))KB5(HU^](YP/UK-C\>:),3LU"(A3AGYV#ZM MC%?,'Q(\57OBSQ'=MJ$A%K;2M#%:9PB '&2.Y..I]*YRW)L9TF@+VLHP4EC! M1@/8CJ/TKZ2ED[J4U*4[-]#\TQ7&E.A7E"G1;C%V;;_0^W(;N.YB66*1)(FY M#HP(/N"*5G R?QSVKY]^&GQ"NY89K:XOH[6Z3!9Y,;9%_O $_>]:Z.ZUY-08 M[KB^UAO[L0(C_H/YUXE2A*G)PEH?>8/&T<;0C7HNZD=-X\U"TEGL_+N(Y)$9 M@RHP8@?A6+:ZVL(0^2QCS@OG&*S7@OKB E;&UL(.I+-E_H","HTMS='[TCOG M 7<<9KOHV]GR]CY_'1E2Q7.]F>FV,Y(Z8^M>;_M10-MSQ0V\UJDCN$5)KJ-&8GL 2#787]AK/A>>*#5+&:TEDP M$#]'/HK=#7@=K:7FKRQZ1$H74'F6&)93@"8.-H/_ (8KZ:\"_$A]*\)VEKX MEB&I:$#+:7,4HS):S(>JGZ'->]B<54PU11Y;J7^3_P C\TR_+L+F%%1=1QDN M:[_P\N_;XM_(PM!\603>+#I=RO$7E,?FSO5\C(^A&*Y7QGI]I)XQ@@U"T6XM MKB":UERI^1E(=&R.G0C\J[7Q+\.].%C>Z_X;NAK*/Y?D/$Q,J1$Y:-E'3:<$ M&O,?!&N2V8U/3]4DF0AIX"\X.XY^=#SU["B*=:GRS3;_ ,FG^3.B526#Q+J8 M).GLD[VNYIQNI=DTF_4\M^)*ZQX&TJ;2X=6DBL]9>2UBM7)9\=1MZXR.,_6N MW\":Q9^'OAR\OA[41>RBW/FVLV/,A=457!3.2&VY!K.ATM_%?B2TU_6+$6AT MY7CLX&?<7!/WV'8\G%6=0\':-=7S7:026ET>#)9RF(MQCG'!XK@PN38RE6EB M*+NG=%(K.909CMSO.%*@#N2#@#KP:\NT+X;/K2ZIK-_>W,6H7UX;FSE&5 M>.,?<)7MQ7;PZ;8V%I#;K&98H=OEK.Q?;M^Z>>X]:6YO^IS[U[L\FAB9^TQN MJ6R\WN[=U=V/RZGQ]C,FH>RR63A5;CS3[QC9)):_$N7F3OL9L'_"4MJ-E=7^ MH65[) 2?M6&61@1CG]*Z_7O&4VK7%S*0L N&#RI&3M8@=?SYKD+K4R03N]L5 MCW.K$9YKNP^!H8;2#;]3YG->),RSN4IUU&',K-07+=7;Z/NWM8W[K5P.GX'T MK,NM4,IS7/W&I;N-QJ);AI,#=D5VSF?/TL/I8UVNB2>>*T-+DW2+6+;1F0BN MGT*R:25 .?6N2A[?^SC(8O']H1QO@F4_P#?!/\ 05]):B^6[?3\ M:\%^!.DM;^)(;EAQ'#(?S7']:]X2U;4KV&!"=TKA1CL.YKY^O93YC]%R]-X> M-/NSOO =E]ET"&3&&F)DQ['I^@%=*GW:KV<*P6\<2X 0 #%61TKY>M_V[_P"D MH*^N_P#@F_\ \E&\5_\ 8*7_ -'+7R)7UW_P3?\ ^2C>*_\ L%+_ .CEK7B' M_D5UO1?FC'AS_D:T/5_DS] Z_*[]M+_DYCQG];3_ -(X*_5&ORN_;2_Y.8\9 M_6T_](X*_/N#O]_G_@?_ *5$_1N-?^1?3_QK_P!)D>)4445^Q'XL?I-_P3Z_ MY(++_P!ABX_] BKZ8KYG_P""?7_)!9?^PQ M+_ME?\FU>-/^N=M_Z50U[37BW[97_)M7C3_KG;?^E4->EEG^_4/\_P#H,-?"M?8<,?\ (JI?]O?^E,^+ MXJ_Y&]7_ +=_])05]5?\$YO^2T:[_P!B_-_Z4V]?*M?57_!.;_DM&N_]B_-_ MZ4V]=>??\BROZ''P_P#\C2A_B/T3HI:*_ #^B!**6B@!**6B@!**6B@!**6B M@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B@!**6B M@""^_P"/*X_ZYM_*OQ(K]M[[_CRN/^N;?RK\2*_4."ML1_V[_P"W'Y5QSOAO M^W__ &T****_33\L/V:^&O\ R3KPK_V"K7_T2M>1_MY?\FK>-/\ >L?_ $M@ MKUSX:_\ ).O"O_8*M?\ T2M>2?MY?\FK>-/]ZQ_]+8*_F7$_%4^9_7O#G_(P MP7^.G_Z4C\CJ***\0_L,]0_9>_Y.(^'?_8:MO_0Q7[/U^,'[+W_)Q'P[_P"P MU;?^ABOV@KNP_P +/P+Q&_WZA_@_5B44M%=1^2"44M% "44M% "44M% "44M M% "44M% "44M% "44M% "56I&X\<^E>1?''7M UJZTUM(NX9YK6;9T*_P"]D# KZ?+Z=)I5ZE35=#\JXDQ.(4IY?A\+>,OM);FY\.H@WBD, M\ ECCB#GDC5[FY6'CF.UC Q_P)LG\L5Q?PH^%D^AK]LU& M-5F9@YC/7(Y ^@))]Z]A@7]T >2.YZUYN8UXUZ[E#9'UW#>!J9?E\*-56?8S M;3PQIUN5D\CSI!_RTF8NWYFN5\5:4NFZ@EU$-L$IPP'0,/\ &O0 ,# K-UC3 M4U+3IK* M0;)4;:RGL:Z&SF!')Q[UVU8\VJ/$PE6^DO0_/W]H7P/)\./B_J!BWPV=W(+^ MTD /5CG ]PP-8?B/X@MXAGN8[6#[!I\]PUT;<-D&0X!;VSZ5]D_M0_"@_$KP M$]W8P[M:TC-Q"J_>D0#]Y'GN<9(]P*_/Y)3$=KC:R\,,8(/H1ZCO7TF!G3Q4 M8\^KB?EO$%"OE]6I3I:1J]5^*.JL=7FLU(@GDA!SD1N1G/TJ;^T&E9F9BS-U M8GDURZ7FW'-68KW/>OH4U>]M3\Z=*4H\K>AT!O]-:[&. MM-SN[L(T+:%ZXO"2>:S[J[)7UJ&:YR.M49Y=V>:SYM3IA1ML,N;PX(S61/*2 MW)JQ.^:H2$YSWK-MOLX"<&J<"EY!Q74:+I+SN,*:PD['5"!9T MK3RY7"GFO2/!OATR3JQ7@57\.^%W9D^0_E7K_A/PSY$:DKSD9XKCG43/;P^' MYK7.T^&NDIIT;S$;IJF!3QTK!TSQ1;WSB&3_1+D](I3PW^Z>C?A6RKG!R00/2O"::>I]TK;DU M%0B=2<"123VSS4H/ H&+2,<*310QPI/M0 R-<9/7-/I$&$4=.*=0 E%+10 E M%+10 E%+10 E%+10 E%+10 E%+10 E%+10 E%+10 E%I]3@<9R.>IB*5)-SDE8]?!91C\PG"&&HRESNR=G;M MOM9=7T/I:BOS)_8J_;:O/"?BZ^\._$C6Y+G0M;N9+N/5[Z3/V*Z 6-?=5E^TW\)]1O(+2U^(?AVXN9Y%BBACOXV9W8X50,\DD@5SX?'4<1 M#G3MY,]C.>%LRR;%/#SIN:M=2BFTU^ENJ?Y'S/\ \%+/^/SX>_\ 7.__ )V] M?$U?;/\ P4L_X_/A[_USO_YV]?$U?T/PU_R*J/\ V]_Z4S^4>*/^1O6_[=_] M)05]=_\ !-__ )*-XK_[!2_^CEKY$KZ[_P"";_\ R4;Q7_V"E_\ 1RUKQ!_R M*ZWHOS1CPY_R-:'J_P F?H%7Y7_MI?\ )S'C/ZVG_I'!7ZHU^5W[:7_)S'C/ MZVG_ *1P5^?<'?[_ #_P/_TJ)^C<:_\ (OI_XU_Z3(\2HHHK]B/Q8_2;_@GU M_P D%E_[#%Q_Z!%7TO7R1^QEX_\ #WPU_9HGUGQ/JL&C:6NN31&ZN<[ [)'M M!P#UQ7=>,_VX_A!X7\+:GJEEXNL=>O;:$O!IEBS&6YDZ*@RN!DD9)Z#)[5_. MV?5Z5+,J_/)+WGU/Z?X8RS'8[+,,\-1E--)746U?UV/?<\X[T5^2'P:_;E\5 M^$_CUJ/C+Q1=RZCHGB&98]6T^,DI!"#B-H%)X,0/ _B&X$Y.X?H6O[8WP690 M1\1-'P>>6&5>CHP#*PSZ@@U9KT]SX=IQ=F)12T4"$HI M:* $HI:* $HI:* $HI:* $HI:* $HI:* $HI:* $HI:* "BBB@ HHHH **** M "BBB@ HHHH **** "BBB@ HHHH *\6_;*_Y-J\:?]<[;_TJAKVFO%OVRO\ MDVKQI_USMO\ TJAKTLL_WZA_CC^:/,S3_<,1_@E_Z2S\K-P_NC]:-P_NC]:; M17]%G\U'H'P!(/QR\ < ?\3ZRY'_ %W2OU^K\@/V?_\ DN?P_P#^P[9?^CDK M]?Z_)N,_]YI?X7^9^P<$_P"[5O\ $OR/BO\ X*4\:7X!/7]]>\?\!AKX7W#^ MZ/UK[H_X*5?\@GP#_P!=[W_T&&OA6OL.&/\ D54O^WO_ $IGQ?%/_(WJ_P#; MO_I*';A_='ZU]4_\$YSGXT:[P!_Q3\W3_KYMZ^5*^JO^"7_ ":MXT_WK'_TM@KUOX:_\DZ\ M*_\ 8*M?_1*UY)^WE_R:MXT_WK'_ -+8*_F7$_%4^9_7O#G_ ",,%_CI_P#I M2/R.HHHKQ#^PST_]F#/_ T/\.\ $_VW;=3C^,5^T-?B_P#LO?\ )Q'P[_[# M5M_Z&*_:"N[#_"S\"\1O]^H?X/U84445U'Y(%%%% !1110 4444 %%%% !11 M10 4444 %%%% #)3MC8XSQT%,CPQ;(SR>M/+?O O/(S[4^@!IC4C!4$4;%]! M3J* &A .PI0 .G%+10 4P@4^FD8I._0#BO%FBM!<&_MUR&_UJK_.JFFWGF*O MS5WLB!XRI ((Q@UQ>M^'Y-/D:ZLU+P]7A'4'U'M7H4:JDE"9\]BL(Z4W6I[= M33MY_E]<5\=_M7_L]R:/>W'C/P[:E].GOJ2SU?C#?* M5[5K)J$=Q"TF>7B\/A\SP[HUM^GD^Y^3YE9 M<>G6@7)4]<5]=?'C]DN"\DGU_P %1B.1LR7&CJ<*QZEHO3_=KY5O/#-U8W#P MSPO%*AVLDB[6'U%?54,5"M%-;GX_C\JK8&;C.-UW[HJ"[^M'VKCO4HT=QU6I M1I#8^XWX5V=U^0]:]7\*>#&8(2 MGZ5O>&/ G[Q/W>!7K&A>%5MT4"//%WA<'U9B>'_ F(54E.@]*[_1=% MVLF$ZX"J!]XU=LM&"^6#&7<_=C7J:])\(>$C:LMY>*1*.8XO[GU]Z\C$5XTD MWU/K\ORZ6)FDHV1+8^"+$Z8BW"%;K&3/&<.">WT]JP?$/A>>*,+=P?VE:1_Z MN>(8EA]QCD?@:]*0#''/O2,!D"OG.>4I79^G4:,:=-070\<@^G ;ZC!K"\8_$X:;9Q6=E<3W,A&?LSN56(?[1^\?9+)VN?$>J2R=3,V2.N%X%>OEU"&)J_O-4CY3B?, MZV68+FH:2>ER1_%FL23><+[RGSD>5&JX_3->H?";XPWT^J0:)KDWG).-MM=D MX(8?PM]>QJI\._@U8^*O"+:CJ$TL=UE^-=.C MN%2XT^*43-?0G"[5.<%>Q)Q7I8B> J0E32LT?&Y?3XAPU6CB7[U.;5U>]EZ' MT7@A0<\U-U%1*,J#2#+. ?7UKY-G[&B>BBBD,**** "BBB@ HHHH **** "B MBB@ HHHH **** "BBB@#X[_X*?\ A*/6/@5I6MC:MSH^KQX+$ F*5&1E'ON$ M9^BFORSKZV_X*(_$;QWXK^)PT;7-"U'PYX2TJ1DTF&Y3$5ZW1KG>,JY/0 $[ M5XX);/R37Y]F=2-7$R<5:VA_8/ V"JX'(Z4*TU+FO)6=TD];76[ZOS=N@5[1 M^QIX3C\9_M-^ ;&;;Y,%_P#;VWD8/V=&G4>^6C Q[UXO6EX:U/5=%\0Z;?Z' M-<6^LVUPDMG+:9\U90P*%<*_\ L%+_ .CEK?B#_D5UO1?FCAX=_P"1K0]?T9^@=?E=^VE_R,_K:?^D<%?GW!W^_S_P/_P!*B?HW&O\ R+Z?^-?^ MDR/$J***_8C\6/K_ ,!>%;?Q9_P3L^(UI,T<7D7%UJ"22$+AX!#,O)[GR]OO MG%?G=7T!XU\4?$$_L[6/A^PT:^A^'O\ :DUU?ZK;H6BN+CY-L4K+G8J85@&Q MN9L\[17S_7\A\9554SJNDMFUZZG^F_@Y@JF$X4H3G--5+2233MHEJUU=M5TZ MZW2*V/!N@KXI\7Z'HK3);+J-_!9F:1@JQB214W$G@ 9SDUCTJJ68!02Q. !U M-?%+1ZG[=-.46HNS[]C^@FTM8K&UAMH$$4$*+'&B]%4# _ 5-7SS^Q%XO\ MB)XF^#]M;_$/0=0TZYT_9#8:IJ V2ZA;X^5F1COW* !O8 ."I!)W&OH:OTZC M456FII6N?PGF.#GE^+J86+?ME?\FU>-/^N=M_ MZ50UZ66?[]0_QQ_-'F9I_N&(_P $O_26?E51117]%G\U'?\ [/\ _P ER^'_ M /V';+_T7_ ":MXT_WK'_TM@KUSX:_\DZ\*_\ 8*M?_1*UY)^WE_R:MXT_ MWK'_ -+8*_F7$_%4^9_7O#G_ ",,%_CI_P#I2/R.HHHKQ#^PSU#]E[_DXCX= M_P#8:MO_ $,5^S]?C!^R]_R<1\._^PU;?^ABOV@KNP_PL_ O$;_?J'^#]6)1 M2T5U'Y()12T4 )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 1Y)EQC@"I*A MCRTA;%34 %%%% !1110 4444 (>E,8;E(QFGGI3<@4GL(YG7/"45Z6G@(@G] MA\K?45QE^;O1IO)G79*1D9/##U%>HWUU%9VDTTKA(XU+,3Z"O)]?U.>]\V4< MWVH-Y<"'_EG'TW>Q"_J:[J->2TEJCQL5ET*KYZ;LRQ:Z^W /_P!:N<\:_#7P MS\0T:6_M%BO","[@&Q_QQUKKM'\&_P!J!UCDD1(0%,C<[I/3\!C/O3KKP;JE MHA&K2O>+LSYVO@L3&/+4CSH^:O$/[,VHZ?N?39H=2@!X48CD_ M$'C\JXR[^%6HZ>Y%UIT\!]6B;'YXKZX>"\MUKC9 H]3N/Z5ZYJ>@:G867VBX140,%^]DC/ K*M[=VO[^VEE(: MV*,NW^)&7=_B/PKGEBT]F>K1R.H]HV,;3O"]CIJ '=(W7/%=5I'A2\U,*(X? MLL!_Y:.,''J!WKO],T'3K2-9+>W1=RA@Q&36E'$SLIP G5N,9->;5QK?P'T> M&R*,?XWX&1H/A:WTS]YM#S'&9"/T'H*WC$I7&"*DHKSIR1]/2I0HQ4(*R M((4,3.6X':I">33F 8$'H>*A&V#=GY5]3WJ#89>VB7D#Q2#QKY;^+/ M@B]\*ZU->M$[6-P=QF"Y4-[GWKZJ!!&1TJO=6<=VCQS1K+$XP4<94_4&NS"X MF6%J*<3Q+DI4X6/.R+*,1E,90K5G.+V787M3$/S'CC%/I$(()!SSZUYA] M6+12T4 )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 )12T4 9?B3P MQI'C'1Y]*UW2[36--G&)+2]A66-OJK C/OVK\./BA\/KKPA\8/$_@^RM)KB> MQU:XLK6WA0O)*HD(CVJ,DY7:1]:_=NN:TKX;>%M$\6:KXHLM!L;?Q%JC*UWJ M@A!N)<(J ;SR!M4<# /4C))KRL?@?KG+9VM^1^@<)\52X:=?F@YQFE:-[+F3 MW?;2][*^Q^(/CKX2>-/AB+1O%?AC4] 2[0/!)?6S(CY&-;K2;677M6O[@VVHRPJTT=LA$6Q&(RH+I(3CKGGH*^N];T M+3?$NEW&FZOI]KJFG7"[)K2\A66*0>C*P(-5O"?A/2/ WAZST+0;"+3-(LU* MV]I#G9&"Q8@9)[L3^-<^%RN.&K^T4KJWSN>OGO'E7/,K^I2I>SFY*[3T<5?3 MNM;::K0^,?\ @I9_Q^?#W_KG?_SMZ^)J^V?^"EG_ !^?#W_KG?\ \[>OB:OZ M4X:_Y%5'_M[_ -*9_%/%'_(WK?\ ;O\ Z2@KZ[_X)O\ _)1O%?\ V"E_]'+7 MR)7UW_P3?_Y*-XK_ .P4O_HY:UX@_P"176]%^:,>'/\ D:T/5_DS] J_*_\ M;2_Y.8\9_6T_](X*_5&ORN_;2_Y.8\9_6T_](X*_/N#O]_G_ ('_ .E1/T;C M7_D7T_\ &O\ TF1XE1117[$?BQ^D?[ $,=Q\ +F*6-98GU:Y5T< JP*1@@@] M17P=^W1\,K7X<_M):U8:/IT5AIFJ0V^H65E:1!$42)L<(JC !E23 [U]Z?\ M$^O^2"R_]ABX_P#0(J]\NO _AZ^\5V_B:YT6QN/$%M;BU@U*:!7GABW%MJ,1 ME1EF/&.M?S7Q3A/KF.K0O9J;U/Z_\.>(GPWAZ6(<7.,J=N6]KO1I_*V]GHV? MB;XD_9[^)/@_PE;^)M9\%:QIVAS@L+N:V($8]9%^]$#V+A<]LU];?\$M?ACI MVKW?C#QGJ>FVUY+8R6]EIT]Q"KF"3#/*R$CY6P8ADP>'M'LM%M[VY:\N(;&%8DDF955G*K@9(1+_ +97_)M7C3_KG;?^E4->EEG^_4/\:7^%_F?L'!'^[5O\2_(^+/^"E7_ ""? /\ MUWO?_08:^%:^ZO\ @I5_R"O /_7>]_\ 08:^%:^PX8_Y%5+_ +>_]*9\7Q5_ MR-ZO_;O_ *2@KZJ_X)S?\EHUW_L7YO\ TIMZ^5:^JO\ @G-_R6C7?^Q?F_\ M2FWKKS[_ )%E?T./A_\ Y&E#_$?HI129HS7X ?T0+129HS0 M%)FC- "T4F: M,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%) MFC- "T4F:,T +129HS0 M%)FC- $-]_QY7'_ %S;^5?B17[;WQ_T*X_ZYM_* MOQ(K]0X*VQ'_ &[_ .W'Y5QSOAO^W_\ VT****_33\L/V:^&O_).O"O_ &"K M7_T2M>2?MY?\FK>-/]ZQ_P#2V"O6_AJ?^+=>%?\ L%6O_HE:\C_;R_Y-6\:? M[UC_ .EL%?S+B?BJ?,_KWAS_ )&&"_QT_P#TI'Y'T445XA_89ZA^R]_R<1\. M_P#L-6W_ *&*_:"OQ?\ V7O^3B/AW_V&K;_T,5^S^:[L/\+/P+Q&_P!^H?X/ MU8M%)FC-=1^2"T4F:,T +129HS0 M%)FC- "T4F:,T +129HS0 M%)FC- "T MA. 2>U&:;("R$ X)[XH 9'N\S)& :FJ&+.[GIZ>E34 %%%% !1110 444T-0 M AD7GFHWE'(ZUSGCCQO9>"M)^U7;#>_R11GJS?3J:\+U3XW:M?3NR0LD9Y"O M(R<9]%P/U)]Z[*&$JXG6FKH\;'9O@LN:CB)I2['L?C'5EO+D66Y5M;<>=3>LQ[(#@$9.,Y^E>U>"[..0RWHP1&S01+UV@'YC]2?TQ2JTJF&]RHK M'1A,90QT?:T)