10-Q

UNITED STATES

SECURITIES AND EXCHANGE COMMISSION

Washington, D.C. 20549

FORM 10-Q

☒ QUARTERLY REPORT PURSUANT TO SECTION 13 OR 15(d) OF THE SECURITIES EXCHANGE ACT OF 1934

For the quarterly period ended September 30, 2017

OR

☐ TRANSITION REPORT PURSUANT TO SECTION 13 OR 15(d) OF THE SECURITIES EXCHANGE ACT OF 1934

For the transition period from ______to ______

Commission File Number 001-38139

Byline Bancorp, Inc.

(Exact Name of Registrant as Specified in Its Charter)

Delaware	36-3012593
(State or Other Jurisdiction of Incorporation or Organization)	(IRS Employer Identification Number)

180 North LaSalle Street, Suite 300

Chicago, Illinois 60601

(Address of Principal Executive Offices)

(773) 244-7000

(Registrant’s telephone number, including area code)

Indicate by check mark whether the registrant (1) has filed all reports required to be filed by Section 13 or 15(d) of the Securities Exchange Act of 1934 during the preceding 12 months (or for such shorter period that the registrant was required to file such reports), and (2) has been subject to such filing requirements for the past 90 days. Yes ☒No ☐

Indicate by check mark whether the registrant has submitted electronically and posted on its corporate Website, if any, every Interactive Data File required to be submitted and posted pursuant to Rule 405 of Regulation S-T (§232.405 of this chapter) during the preceding 12 months (or for such shorter period that the registrant was required to submit and post such files).  Yes ☒ No ☐

Indicate by check mark whether the registrant is a large accelerated filer, an accelerated filer, a non-accelerated filer, a smaller reporting company, or an emerging growth company. See the definitions of “large accelerated filer”, “accelerated filer”, “smaller reporting company”, and “emerging growth company” in Rule 12b-2 of the Securities Exchange Act of 1934.

Large accelerated filer	☐		Accelerated filer	☐
Non-accelerated filer	☒	(Do not check if a smaller reporting company)	Smaller reporting company	☐
Emerging growth company	☒

If an emerging growth company, indicate by check mark if the registrant has elected not to use the extended transition period for complying with any new or revised financial accounting standards provided pursuant to Section 13(a) of the Exchange Act. ☐

Indicate by check mark whether the registrant is a shell company (as defined in Rule 12b-2 of the Exchange Act). Yes ☐No ☒Indicate the number of shares outstanding of each of the issuer’s classes of common stock, as of the latest practicable date.

Common Stock, $0.01 par value, 29,312,600 shares outstanding as of November 14, 2017

BYLINE BANCORP, INC.

FORM 10-Q

September 30, 2017

INDEX

		Page
PART I.	FINANCIAL INFORMATION	3
Item 1.	Financial Statements. The Interim Condensed Consolidated Financial Statements of Byline Bancorp, Inc. filed as part of the report are as follows:	3
	Consolidated Statements of Financial Condition at September 30, 2017 (unaudited) and December 31, 2016	3
	Consolidated Statements of Operations for the Three and Nine Months Ended September 30, 2017 and 2016 (unaudited)	4
	Consolidated Statements of Comprehensive Income (Loss) and Accumulated Other Comprehensive Income (Loss) for the Nine Months Ended September 30, 2017 and 2016 (unaudited)	5
	Consolidated Statements of Changes in Stockholders’ Equity for the Nine Months Ended September 30, 2017 and 2016 (unaudited)	6
	Consolidated Statements of Cash Flows for the Nine Months Ended September 30, 2017 and 2016 (unaudited)	7
	Notes to Unaudited Interim Condensed Consolidated Financial Statements	9
Item 2.	Management’s Discussion and Analysis of Financial Condition and Results of Operations	46
Item 3.	Quantitative and Qualitative Disclosures about Market Risk	85
Item 4.	Controls and Procedures	87
PART II.	OTHER INFORMATION
Item 1.	Legal Proceedings	87
Item 1A.	Risk Factors	87
Item 2.	Unregistered Sales of Equity Securities and Use of Proceeds	87
Item 3.	Defaults Upon Senior Securities	88
Item 4.	Mine Safety Disclosures	88
Item 5.	Other Information	88
Item 6.	Exhibits	88

2

PART I – FINANCIAL INFORMATION

Item 1. Financial Statements

BYLINE BANCORP, INC. AND SUBSIDIARIES

CONSOLIDATED STATEMENTS OF FINANCIAL CONDITION

	(Unaudited)
(dollars in thousands, except share and per share data)	September 30, 2017			December 31, 2016
ASSETS
Cash and due from banks	$	16,193		$	17,735
Interest bearing deposits with other banks		46,043			28,798
Cash and cash equivalents		62,236			46,533
Securities available-for-sale, at fair value		584,684			608,560
Securities held-to-maturity, at amortized cost (fair value    September 30, 2017—$122,266, December 31, 2016—$138,082)		121,453			138,846
Restricted stock, at cost		10,628			14,993
Loans held for sale		2,087			23,976
Loans and leases:
Loans and leases		2,216,499			2,148,011
Allowance for loan and lease losses		(15,980	)		(10,923	)
Net loans and leases		2,200,519			2,137,088
Servicing assets, at fair value		21,669			21,091
Accrued interest receivable		7,183			6,866
Premises and equipment, net		96,334			102,074
Assets held for sale		12,938			14,748
Other real estate owned, net		13,859			16,570
Goodwill		51,975			51,975
Other intangible assets, net		17,522			19,826
Bank-owned life insurance		5,680			6,557
Deferred tax assets, net		60,350			67,760
Due from counterparty		21,084			—
Other assets		15,241			18,367
Total assets	$	3,305,442		$	3,295,830
LIABILITIES AND STOCKHOLDERS’ EQUITY
LIABILITIES
Non-interest bearing demand deposits	$	753,662		$	724,457
Interest bearing deposits:
NOW, savings accounts, and money market accounts		1,040,774			989,421
Time deposits		726,493			776,516
Total deposits		2,520,929			2,490,394
Accrued interest payable		1,184			2,427
Line of credit		—			20,650
Federal Home Loan Bank advances		234,559			313,715
Securities sold under agreements to repurchase		30,807			17,249
Junior subordinated debentures issued to capital trusts, net		27,482			26,926
Accrued expenses and other liabilities		30,948			41,811
Total liabilities		2,845,909			2,913,172
STOCKHOLDERS’ EQUITY
Preferred stock		10,438			25,441
Common stock, voting $0.01 par value at September 30, 2017 and no par value at December 31, 2016; 150,000,000 shares authorized at September 30, 2017 and December 31, 2016; 29,305,400 shares issued and outstanding at September 30, 2017 and 24,616,706 issued and outstanding at December 31, 2016		292			—
Additional paid-in capital		391,040			313,552
Retained earnings		62,311			50,933
Accumulated other comprehensive loss, net of tax		(4,548	)		(7,268	)
Total stockholders’ equity		459,533			382,658
Total liabilities and stockholders’ equity	$	3,305,442		$	3,295,830

See accompanying Notes to Unaudited Interim Condensed Consolidated Financial Statements.

3

BYLINE BANCORP, INC. AND SUBSIDIARIES

CONSOLIDATED STATEMENTS OF OPERATIONS

(UNAUDITED)

	Three Months Ended						Nine Months Ended
	September 30,						September 30,
(dollars in thousands, except share and per share data)	2017			2016			2017		2016
INTEREST AND DIVIDEND INCOME
Interest and fees on loans and leases	$	30,933		$	19,081		$	88,510	$	56,334
Interest on taxable securities		3,720			3,312			11,213		10,492
Interest on tax-exempt securities		174			152			458		509
Other interest and dividend income		217			112			666		254
Total interest and dividend income		35,044			22,657			100,847		67,589
INTEREST EXPENSE
Deposits		2,112			1,063			5,518		3,281
Federal Home Loan Bank advances		850			200			2,282		371
Subordinated debentures and other borrowings		670			529			2,286		1,571
Total interest expense		3,632			1,792			10,086		5,223
Net interest income		31,412			20,865			90,761		62,366
PROVISION FOR LOAN AND LEASE LOSSES		3,900			1,683			9,306		5,348
Net interest income after provision for loan and lease losses		27,512			19,182			81,455		57,018
NON-INTEREST INCOME
Fees and service charges on deposits		1,418			1,465			3,985		4,227
Servicing fees		959			—			2,954		—
ATM and interchange fees		1,495			1,470			4,342		4,392
Net gains on sales of securities available-for-sale		—			802			8		3,231
Net gains (losses) on sales of loans		7,499			(60	)		24,026		(39	)
Fees on mortgage loan sales, net		—			46			2		101
Other non-interest income		547			1,053			2,102		3,350
Total non-interest income		11,918			4,776			37,419		15,262
NON-INTEREST EXPENSE
Salaries and employee benefits		16,323			11,266			50,151		34,206
Occupancy expense, net		3,301			3,358			10,525		10,511
Equipment expense		630			516			1,809		1,519
Loan and lease related expenses		891			443			2,569		1,090
Legal, audit and other professional fees		1,608			1,065			4,369		3,785
Data processing		2,399			1,990			7,255		5,760
Net loss recognized on other real estate owned and other related expenses		565			292			136		1,386
Regulatory assessments		326			502			894		1,930
Other intangible assets amortization expense		769			747			2,307		2,242
Advertising and promotions		196			156			803		454
Telecommunications		351			370			1,165		1,284
Other non-interest expense		3,706			1,679			7,182		5,521
Total non-interest expense		31,065			22,384			89,165		69,688
INCOME BEFORE PROVISION FOR INCOME TAXES		8,365			1,574			29,709		2,592
PROVISION (BENEFIT) FOR INCOME TAXES		(1,390	)		9			7,248		(222	)
NET INCOME		9,755			1,565			22,461		2,814
Dividends on preferred shares		195			—			11,081		—
INCOME AVAILABLE TO COMMON STOCKHOLDERS	$	9,560		$	1,565		$	11,380	$	2,814
EARNINGS PER COMMON SHARE
Basic	$	0.33		$	0.08		$	0.43	$	0.15
Diluted	$	0.32		$	0.08		$	0.43	$	0.15
Weighted average common shares outstanding for basic earnings per common share		29,246,900			19,497,811			26,194,025		18,838,354
Diluted weighted average common shares outstanding for diluted earnings per common share		29,752,331			19,763,434			26,697,841		19,103,977

See accompanying Notes to Unaudited Interim Condensed Consolidated Financial Statements.

4

BYLINE BANCORP, INC. AND SUBSIDIARIES

CONSOLIDATED STATEMENTS OF COMPREHENSIVE INCOME (LOSS) AND ACCUMULATED OTHER COMPREHENSIVE INCOME (LOSS)

(UNAUDITED)

	Three Months Ended						Nine Months Ended
	September 30,						September 30,
(dollars in thousands)	2017			2016			2017			2016
Net income	$	9,755		$	1,565		$	22,461		$	2,814
Securities available-for-sale
Unrealized holding gains (losses) arising during the period		1,473			(953	)		4,920			12,465
Reclassification adjustments for net gains included in net income		—			(802	)		(8	)		(3,231	)
Tax effect		303			—			(1,587	)		—
Net of tax		1,776			(1,755	)		3,325			9,234
Cash flow hedges
Unrealized holding gains (losses) arising during the period		17			398			(1,408	)		207
Reclassification adjustments for losses included in net income		159			4			426			4
Tax effect		(88	)		—			377			—
Net of tax		88			402			(605	)		211
Total other comprehensive income (loss)		1,864			(1,353	)		2,720			9,445
Comprehensive income	$	11,619		$	212		$	25,181		$	12,259

	Gains (Losses) on Cash Flow Hedges			Unrealized Gains (Losses) on Available-for -Sale Securities			Total Accumulated Other Comprehensive Income (Loss)
Balance, January 1, 2016	$	—		$	(5,707	)	$	(5,707	)
Other comprehensive gain, net of tax		211			9,234			9,445
Balance, September 30, 2016	$	211		$	3,527		$	3,738
Balance, January 1, 2017	$	2,233		$	(9,501	)	$	(7,268	)
Other comprehensive gain (loss), net of tax		(605	)		3,325			2,720
Balance, September 30, 2017	$	1,628		$	(6,176	)	$	(4,548	)

See accompanying Notes to Unaudited Interim Condensed Consolidated Financial Statements.

5

BYLINE BANCORP, INC. AND SUBSIDIARIES

CONSOLIDATED STATEMENTS OF CHANGES IN STOCKHOLDERS’ EQUITY

Nine Months Ended September 30, 2017 and 2016

(Dollars in thousands, except share data) (Unaudited)

												Additional			Retained Earnings			Accumulated Other			Total
	Preferred Stock						Common Stock					Paid-In			(Accumulated			Comprehensive			Stockholders’
	Shares			Amount			Shares			Amount		Capital			Deficit)			Income (Loss)			Equity
Balance, January 1, 2016		15,003		$	15,003			17,332,775		$	—	$	194,774		$	(15,796	)	$	(5,707	)	$	188,274
Net income		—			—			—			—		—			2,814			—			2,814
Other comprehensive income, net of tax		—			—			—			—		—			—			9,445			9,445
Issuance of common stock, net of issuance cost		—			—			3,078,075			—		50,018			—			—			50,018
Share-based compensation expense		—			—			—			—		553			—			—			553
Balance, September 30, 2016		15,003		$	15,003			20,410,850		$	—	$	245,345		$	(12,982	)	$	3,738		$	251,104
Balance, January 1, 2017		25,441		$	25,441			24,616,706		$	—	$	313,552		$	50,933		$	(7,268	)	$	382,658
Net income		—			—			—			—		—			22,461			—			22,461
Other comprehensive income, net of tax		—			—			—			—		—			—			2,720			2,720
Issuance of common stock in connection with merger		—			—			—			246		(246	)		—			—			—
Repurchase of preferred stock		(15,003	)		(15,003	)		—			—		—			—			—			(15,003	)
Issuance of common stock,    net of issuance cost		—			—			4,630,194			46		76,783			—			—			76,829
Issuance of common stock in connection with restricted stock awards		—			—			58,900			—		—			—			—			—
Forfeiture of restricted stock awards		—			—			(400	)		—		—			—			—			—
Cash dividends declared on preferred stock		—			—			—			—		—			(11,081	)		—			(11,081	)
Cash paid in lieu of fractional shares		—			—			—			—		—			(2	)		—			(2	)
Share-based compensation expense		—			—			—			—		951			—			—			951
Balance, September 30, 2017		10,438		$	10,438			29,305,400		$	292	$	391,040		$	62,311		$	(4,548	)	$	459,533

See accompanying Notes to Unaudited Interim Condensed Consolidated Financial Statements.

6

BYLINE BANCORP, INC. AND SUBSIDIARIES

CONSOLIDATED STATEMENTS OF CASH FLOWS

Nine Months Ended September 30, 2017 and 2016

(Dollars in thousands) (Unaudited)

	Nine Months Ended
	September 30,
	2017			2016
CASH FLOWS FROM OPERATING ACTIVITIES
Net income	$	22,461		$	2,814
Adjustments to reconcile net income to net cash from operating activities:
Provision for loan and lease losses		9,306			5,348
Impairment loss on assets held for sale		951			408
Depreciation and amortization of premises and equipment		3,919			3,814
Net amortization of securities		3,544			5,673
Net gains on sales of securities available-for-sale		(8	)		(3,231	)
Net gains on sales of assets held for sale		(167	)		(967	)
Net (gains) losses on sales of loans		(24,026	)		39
Originations of mortgage loans held for sale		—			(4,045	)
Proceeds from mortgage loans sold		151			4,512
Originations of government guaranteed loans		(202,176	)		—
Proceeds from government guaranteed loans sold		228,852			—
Accretion of premiums and discounts on acquired loans, net		(24,746	)		(24,479	)
Net change in servicing assets		(578	)		—
Net valuation adjustments on other real estate owned		367			904
Net gains on sales of other real estate owned		(1,538	)		(1,134	)
Amortization of intangible assets		2,307			2,242
Amortization of time deposit premium		(759	)		(66	)
Amortization of Federal Home Loan Bank advances premium		(156	)		—
Accretion of junior subordinated debentures discount		556			660
Share-based compensation expense		951			553
Deferred tax provision		6,196			—
Increase in cash surrender value of bank owned life insurance		(209	)		(184	)
Gain on death benefit of bank owned life insurance		(313	)		—
Changes in assets and liabilities:
Accrued interest receivable		(345	)		(659	)
Other assets		530			(436	)
Accrued interest payable		(1,243	)		(588	)
Accrued expenses and other liabilities		(11,382	)		(3,497	)
Net cash provided by (used in) operating activities		12,445			(12,319	)
CASH FLOWS FROM INVESTING ACTIVITIES
Purchases of securities available-for-sale		(34,814	)		(526,084	)
Proceeds from maturities and calls of securities available-for-sale		7,672			84,272
Proceeds from paydowns of securities available-for-sale		53,171			81,522
Proceeds from sales of securities available-for-sale		8			507,362
Purchases of securities held-to-maturity		—			(59,436	)
Proceeds from maturities and calls of securities held-to-maturity		655			—
Proceeds from paydowns of securities held-to-maturity		15,597			21,881
Purchases of Federal Home Loan Bank stock		(9,855	)		(4,642	)
Federal Home Loan Bank stock repurchases		14,220			1,000
Proceeds from other loans sold		9,984			—
Net change in loans and leases		(63,502	)		(357,862	)
Purchases of premises and equipment		(2,253	)		(4,515	)
Proceeds from sales of premises and equipment		—			88
Proceeds from sales of assets held for sale		4,398			2,126
Proceeds from sales of other real estate owned		9,583			13,945
Proceeds from bank owned life insurance death benefit		1,399			-
Net cash provided by (used in) investing activities		6,263			(240,343	)

See accompanying Notes to Unaudited Interim Condensed Consolidated Financial Statements

7

BYLINE BANCORP, INC. AND SUBSIDIARIES

CONSOLIDATED STATEMENTS OF CASH FLOWS (Continued)

Nine Months Ended September 30, 2017 and 2016

(Dollars in thousands) (Unaudited)

	Nine Months Ended
	September 30,
	2017			2016
CASH FLOWS FROM FINANCING ACTIVITIES
Net increase in deposits	$	31,294		$	62,285
Proceeds from Federal Home Loan Bank advances		1,993,000			4,967,000
Repayments of Federal Home Loan Bank advances		(2,072,000	)		(4,822,000	)
Repayments of line of credit		(20,650	)		—
Net increase in securities sold under agreements to repurchase		13,558			1,435
Dividends paid on preferred stock		(11,081	)		—
Cash paid in lieu of fractional shares		(2	)		—
Proceeds from issuance of common stock		76,829			50,018
Proceeds from issuance of preferred stock		1,050			—
Repurchase of preferred stock		(15,003	)		—
Net cash provided by (used in) financing activities		(3,005	)		258,738
NET INCREASE IN CASH AND CASH EQUIVALENTS		15,703			6,076
CASH AND CASH EQUIVALENTS, beginning of period		46,533			44,884
CASH AND CASH EQUIVALENTS, end of period	$	62,236		$	50,960
SUPPLEMENTAL DISCLOSURES OF CASH FLOW INFORMATION:
Cash paid during the period for interest	$	11,689		$	5,217
Cash payments (refunds) during the period for taxes	$	2,121		$	(250	)
SUPPLEMENTAL DISCLOSURES OF NON-CASH INVESTING AND FINANCING ACTIVITIES:
Change in fair value of available-for-sale securities, net of tax	$	3,325		$	9,234
Change in fair value of cash flow hedges, net of tax	$	(605	)	$	211
Delayed payments of mortgage-backed securities	$	389		$	447
Transfers of loans to loans held for sale	$	10,061		$	1,477
Transfers of loans to other real estate owned	$	5,701		$	3,721
Internally financed sale of other real estate owned	$	—		$	1,447
Transfers of land and premises to assets held for sale	$	3,372		$	10,486
Transfers of premises and equipment to other assets	$	702		$	—
Due from counterparty	$	21,084		$	—

See accompanying Notes to Unaudited Interim Condensed Consolidated Financial Statements

8

BYLINE BANCORP, INC. AND SUBSIDIARIES

NOTES TO CONSOLIDATED FINANCIAL STATEMENTS

(Table dollars in thousands, except share and per share data) (Unaudited)

Note 1—Basis of Presentation

These unaudited interim condensed consolidated financial statements include the accounts of BylineBancorp, Inc., a Delaware corporation(the“Company,”“we,” “us,”“our”),a bank holding companywhose principalactivityistheownershipand managementof its Illinois state chartered subsidiarybank, BylineBank (the “Bank”), based in Chicago, Illinois.

These unaudited interim condensed consolidated financial statements have been prepared in accordance with accounting principles generally accepted in the United States of America (“GAAP”) for interim financial information and in accordance with the instructions to Form 10-Q and Article 10 of Regulation S-X as promulgated by the Securities and Exchange Commission (“SEC”).  In preparing these financial statements, the Company has evaluated events and transactions subsequent to September 30, 2017 for potential recognition or disclosure. In the opinion of management, all adjustments (consisting of normal recurring accruals) considered necessary for a fair presentation of the financial position and results of operations for the periods presented have been included.  Certain information in footnote disclosures normally included in financial statements prepared in accordance with GAAP has been condensed or omitted pursuant to the rules and regulations of the SEC and the accounting standards for interim financial statements. These financial statements should be read in conjunction with the consolidated financial statements and notes thereto included in the Company’s Consolidated Financial Statements for the years ended December 31, 2016 and 2015.

In accordance with the Financial Accounting Standards Board (“FASB”) Accounting Standards Codification (“ASC”) Topic 855, “Subsequent Events,” the Company’s management has evaluated subsequent events for potential recognition or disclosure through the date of the issuance of these consolidated financial statements. No subsequent events were identified that would have required a change to the consolidated financial statements or disclosure in the notes to the consolidated financial statements.

Certain prior period amounts have been reclassified to conform to current period presentation. These reclassifications did not result in any changes to previously reported net income or stockholders’ equity.

Note 2—Recently Issued Accounting Pronouncements

The following reflect recent accounting pronouncements that have been adopted or are pending adoption by the Company. As the Company qualifies as an emerging growth company and has elected the extended transition period for complying with new or revised accounting pronouncements, it is not subject to new or revised accounting standards applicable to public companies during the extended transition period. The accounting pronouncements pending adoption below reflect effective dates for the Company as an emerging growth company with the extended transition period.

Revenue from Contracts with Customers In May 2014, FASB issued Accounting Standards Update (“ASU”) No. 2014-09, deferred by ASU No. 2015-14 and clarifying standards, Revenue from Contracts with Customers, which creates Topic 606 and supersedes Topic 605, Revenue Recognition. The core principle of Topic 606 is that an entity recognizes revenue to depict the transfer of promised goods or services to customers in an amount that reflects the consideration to which the entity expects to be entitled in exchange for those goods or services. In general, the new guidance requires companies to use more judgment and make more estimates than under current guidance, including identifying performance obligations in the contract, estimating the amount of variable consideration to include in the transaction price and allocating the transaction price to each separate performance obligation. Under the terms of ASU No. 2015-14 the standard is effective for interim and annual periods beginning after December 15, 2017. Early application is permitted only as of annual reporting periods beginning after December 15, 2016, including interim reporting periods within that reporting period. For financial reporting purposes, the standard allows for either full retrospective adoption, meaning the standard is applied to all of the periods presented, or modified retrospective adoption, meaning the standard is applied only to the most current period presented in the financial statements with the cumulative effect of initially applying the standard recognized at the date of initial application. The Company is currently evaluating the provisions of ASU No. 2014-09 to determine the potential impact the standard will have on the Company’s Consolidated Financial Statements. As a financial institution, the Company’s largest component of revenue, interest income, is excluded from the scope of this ASU. The Company is currently evaluating which, if any, of its sources of non-interest income will be impacted by this ASU. Assuming the Company remains an emerging growth company, the Company expects to adopt this new guidance on January 1, 2019, with

9

BYLINE BANCORP, INC. AND SUBSIDIARIES

NOTES TO CONSOLIDATED FINANCIAL STATEMENTS

(Table dollars in thousands, except share and per share data) (Unaudited)

a cumulative effect adjustment to opening retained earnings, if such adjustment is deemed to be significant. In April 2016, FASB issued ASU No. 2016-10, Identifying Performance Obligations and Licensing. The amendments in this ASU do not change the core principle of the guidance in Topic 606. Rather, the amendments in this ASU clarify the following two aspects of Topic 606: (1) identifying performance obligations and (2) licensing implementation guidance, while retaining the related principles for those areas. The amendments in this ASU affect the guidance in ASU 2014-09, discussed above, which is not yet effective. The effective date and transition requirements for the amendments in this ASU are the same as the effective date and transition requirements in Topic 606, Revenues from Contracts with Customers. The Company is evaluating the provisions of this ASU in conjunction with ASU No. 2014-09 to determine the potential impact Topic 606 and its amendments will have on the Company’s Consolidated Financial Statements.

In May 2016, FASB issued ASU No. 2016-12, Narrow-Scope Improvements and Practical Expedients, amending ASC Topic 606, Revenue from Contracts with Customers. The amendments in this ASU do not change the core principle of the guidance in Topic 606. Rather, the amendments in this ASU affect only several narrow aspects of Topic 606. The amendments in this ASU affect the guidance in ASU 2014-09, discussed above, which is not yet effective. The effective date and transition requirements for the amendments in this ASU are the same as the effective date and transition requirements in Topic 606. The Company is evaluating the provisions of this ASU in conjunction with ASU No. 2014-09 to determine the potential impact Topic 606 and its amendments will have on the Company’s Consolidated Financial Statements.

Recognition and Measurement of Financial Assets and Financial Liabilities In January 2016, FASB issued ASU No. 2016-01, Recognition and Measurement of Financial Assets and Financial Liabilities. The amendments in this ASU require equity securities to be measured at fair value with changes in the fair value recognized through net income. The amendments allow equity investments that do not have readily determinable fair values to be remeasured at fair value under certain circumstances and require enhanced disclosures about those investments. The amendments simplify the impairment assessment of equity investments without readily determinable fair values. The amendments also eliminate the requirement to disclose the method(s) and significant assumptions used to estimate the fair value that is required to be disclosed for financial instruments measured at amortized cost on the balance sheet. The amendments in this ASU require separate presentation in other comprehensive income of the portion of the total change in the fair value of a liability resulting from a change in the instrument-specific credit risk when the entity has elected to measure the liability at fair value in accordance with the fair value option for financial instruments. This amendment excludes from net income gains or losses that the entity may not realize because those financial liabilities are not usually transferred or settled at their fair values before maturity. The amendments in this ASU require separate presentation of financial assets and financial liabilities by measurement category and form of financial asset (that is, securities or loans and receivables) on the balance sheet or in the accompanying notes to the financial statements. The amendments in this ASU are effective for fiscal years beginning after December 15, 2017, including interim periods within those fiscal years. The Company is currently evaluating the provisions of ASU No. 2016-01 to determine the potential impact the new standard will have on the Company’s Consolidated Financial Statements. Assuming the Company remains an emerging growth company, the new authoritative guidance will be effective for reporting periods beginning January 1, 2019 and is not expected to have a significant impact on the Company’s Consolidated Financial Statements.

Leases (Topic 842) In February 2016, FASB issued ASU No. 2016-02, Leases. The amendments in this ASU require lessees to recognize the following for all leases (with the exception of short-term) at the commencement date; a lease liability, which is a lessee’s obligation to make lease payments arising from a lease, measured on a discounted basis; and a right-of-use asset, which is an asset that represents the lessee’s right to use, or control the use of, a specified asset for the lease term. The amendments in this ASU leave lessor accounting largely unchanged, although certain targeted improvements were made to align lessor accounting with the lessee accounting model. This ASU simplifies the accounting for sale and leaseback transactions primarily because lessees must recognize lease assets and lease liabilities. Lessees will no longer be provided with a source of off-balance sheet financing. The amendments in this ASU are effective for fiscal years beginning after December 15, 2018, including interim periods within those fiscal years. Early application is permitted upon issuance. Lessees (for capital and operating leases) and lessors (for sales-type, direct financing, and operating leases) must apply a modified retrospective transition approach for leases existing at, or entered into after, the beginning of the earliest comparative period presented in the financial statements. The modified retrospective approach would not require any transition accounting for leases that expired before the earliest comparative period presented. Lessees and lessors may not apply a full retrospective transition approach. The Company is evaluating the new guidance and its impact on the Company’s Consolidated Statements of Operations and Consolidated Statements of Financial Condition. Assuming the Company remains an emerging growth company, the new authoritative guidance will be effective for reporting periods after January 1, 2020.

10

BYLINE BANCORP, INC. AND SUBSIDIARIES

NOTES TO CONSOLIDATED FINANCIAL STATEMENTS

(Table dollars in thousands, except share and per share data) (Unaudited)

The Company expects an increase in assets and liabilities as a result of recognizing additional lease contracts where the Company is lessee.

Derivatives and Hedging (Topic 815) In March 2016, FASB issued ASU No. 2016-05, Effect of Derivative Contract Novations on Existing Hedge Accounting Relationships. The amendments in this ASU clarify that a change in the counterparty to a derivative instrument that has been designated as the hedging instrument under Topic 815 (Derivatives and Hedging) does not, in and of itself, require dedesignation of that hedging relationship provided that all other hedge accounting criteria continue to be met. The amendments in this ASU are effective for financial statements issued for fiscal years beginning after December 15, 2016, and interim periods within those fiscal years. An entity has an option to apply the amendments in this ASU on either a prospective basis or a modified retrospective basis. Early adoption is permitted, including adoption in an interim period. This ASU became effective for the Company on January 1, 2017 and did not have a material impact on the Company’s Consolidated Financial Statements.

In March 2016, FASB issued ASU No. 2016-06, Contingent Put and Call Options in Debt Instruments. The amendments in this ASU clarify the requirements for assessing whether contingent call (put) options that can accelerate the payment of principal on debt instruments are clearly and closely related to their debt hosts. To determine how to account for debt instruments with embedded features, including contingent put and call options, an entity is required to assess whether the embedded derivatives must be bifurcated from the host contract and accounted for separately. Part of this assessment consists of evaluating whether the embedded derivative features are clearly and closely related to the debt host. Under existing guidance, for contingently exercisable options to be considered clearly and closely related to a debt host, they must be indexed only to interest rates or credit risk. ASU 2016-06 addresses inconsistent interpretations of whether an event that triggers an entity’s ability to exercise the embedded contingent option must be indexed to interest rates or credit risk for that  option to qualify as clearly and closely related. Diversity in practice has developed because the existing four-step decision sequence in ASC 815 focuses only on whether the payoff was indexed to something other than an interest rate or credit risk. As a result, entities have been uncertain whether they should (1) determine whether the embedded features are clearly and closely related to the debt host solely on the basis of the four-step decision sequence or (2) first apply the four-step decision sequence and then also evaluate whether the event triggering the exercisability of the contingent put or call option is indexed only to an interest rate or credit risk. This ASU clarifies that in assessing whether an embedded contingent put or call option is clearly and closely related to the debt host, an entity is required to perform only the four-step decision sequence in ASC 815 as amended by this ASU. The entity does not have to separately assess whether the event that triggers its ability to exercise the contingent option is itself indexed only to interest rates or credit risk. The amendments in this ASU are effective for financial statements issued for fiscal years beginning after December 15, 2016, and interim periods within those fiscal years. This ASU became effective for the Company on January 1, 2017 and did not have a material impact on the Company’s Consolidated Financial Statements.

In August 2017, FASB issued ASU No. 2017-12, Targeted Improvements to Accounting for Hedging Activities. The amendments in this ASU better align an entity’s risk management activities and financial reporting for hedging relationships through changes to both the designation and measurement guidance for qualifying hedging relationships and the presentation of hedge results. The new authoritative guidance will be effective for reporting periods after January 1, 2019 with early adoption permitted. The Company is evaluating the new guidance and its impact on the Company’s Consolidated Statements of Operations and Consolidated Statements of Financial Condition.

Compensation—Stock Compensation (Topic 718) In March 2016, FASB issued ASU No. 2016-09, Improvements to Employee Share-Based Payment Accounting. FASB issued this ASU as part of its Simplification Initiative. The areas for simplification in this ASU involve several aspects of the accounting for share-based payment transactions, including the income tax consequences, classification of awards as either equity or liabilities, and classification on the statement of cash flows. Amendments in this ASU relate to the timing of when excess tax benefits are recognized, minimum statutory withholding requirements, forfeitures, and intrinsic value should be applied using a modified retrospective transition method by means of a cumulative-effect adjustment to equity as of the beginning of the period in which the guidance is adopted. Amendments related to the presentation of employee taxes paid on the statement of cash flows when an employer withholds shares to meet the minimum statutory withholding requirement should be applied retrospectively. Amendments in this ASU require recognition of excess tax benefits and tax deficiencies in the income statement and the practical expedient for estimating expected term should be applied prospectively.

An entity may elect to apply the amendments in this ASU related to the presentation of excess tax benefits on the statement of cash flows using either a prospective transition method or a retrospective transition method. The amendments in

11

BYLINE BANCORP, INC. AND SUBSIDIARIES

NOTES TO CONSOLIDATED FINANCIAL STATEMENTS

(Table dollars in thousands, except share and per share data) (Unaudited)

this ASU are effective for annual periods beginning after December 15, 2016, and interim periods within those annual periods. This ASU became effective for the Company on January 1, 2017 and did not have a material impact on the Company’s Consolidated Financial Statements.

In May 2017, the FASB issued ASU 2017-09, Scope of Modification Accounting. The new standard provides guidance about which changes to the terms or conditions of a share-based payment award require an entity to apply modification accounting in Topic 718. This pronouncement is effective for annual reporting periods beginning after December 15, 2017 but early adoption is permitted. The Company is currently evaluating the impact of adopting this guidance.

Financial Instruments—Credit Losses (Topic 326) In June 2016, FASB issued ASU No. 2016-13, Measurement of Credit Losses on Financial Instruments. Current GAAP requires an “incurred loss” methodology for recognizing credit losses that delays recognition until it is probable a loss has been incurred. The main objective of this ASU is to provide financial statement users with more decision-useful information about the expected credit losses on financial instruments and other commitments to extend credit held by a reporting entity at each reporting date. The amendments in this ASU replace the incurred loss impairment methodology in current GAAP with a methodology that reflects expected credit losses and requires consideration of a broader range of reasonable and supportable information to inform credit loss estimates. The amendments in this ASU require a financial asset (or group of financial assets) measured at amortized cost basis to be presented at the net amount expected to be collected. The allowance for credit losses is a valuation account that is deducted from the amortized cost basis of the financial asset(s) to present the net carrying value at the amount expected to be collected on the financial asset. The measurement of expected credit losses will be based on relevant information about past events, including historical experience, current conditions, and reasonable and supportable forecasts that affect the collectability of the reported amount. The amendments in this ASU broaden the information that an entity must consider in developing its expected credit loss estimate for assets measured either collectively or individually. The use of forecasted information incorporates more timely information in the estimate of expected credit loss, which will be more decision useful to users of the financial statements. The amendments in this ASU will be effective for fiscal years beginning after December 15, 2019, including interim periods  within those fiscal years. Assuming the Company remains an emerging growth company, the new authoritative guidance will be effective for reporting periods after January 1, 2021. The Company is still evaluating the effects this ASU will have on the Company’s Consolidated Financial Statements. While the Company has not quantified the impact of this ASU, it does expect changing from the current incurred loss model to an expected loss model will result in an earlier recognition of losses.

Statement of Cash Flows (Topic 230) In August 2016, FASB issued ASU No. 2016-15, Classification of Certain Cash Receipts and Cash Payments. There is diversity in practice in how certain cash receipts and cash payments are presented and classified in the statement of cash flows under Topic 230 and other Topics. This ASU addresses eight specific cash flow issues with the objective of reducing the existing diversity in practice. Those eight issues are (1) debt prepayment or debt extinguishment costs, (2) settlement of zero-coupon debt instruments or other debt instruments with coupon interest rates that are insignificant in relation to the effective interest rate of the borrowing, (3) contingent consideration payments made after a business combination, (4) proceeds from the settlement of insurance claims, (5) proceeds from the settlement of corporate-owned life insurance policies, including bank-owned life insurance policies, (6) distributions received from equity method investees, (7) beneficial interests in securitization transactions, and (8) separately identifiable cash flows and application of the predominance principle. Current GAAP either is unclear or does not include specific guidance on these eight cash flow classification issues. These amendments provide guidance for each of the eight issues, thereby reducing current and potential future diversity in practice. The amendments in this ASU are effective for fiscal years beginning after December 15, 2017, and interim periods within those fiscal years. Early adoption is permitted, including adoption in an interim period. Assuming the Company remains an emerging growth company, the new authoritative guidance will be effective for reporting periods after January 1, 2019. The Company is currently evaluating the provisions of ASU No. 2016-15 to determine the potential impact the new standard will have on the Company’s Consolidated Financial Statements.

In November 2016, the FASB issued ASU No. 2016-18, Statement of Cash Flows (230), Restricted Cash. The ASU will require that a statement of cash flows explain the change during the period in the total of cash, cash equivalents, and amounts generally described as restricted cash or restricted cash equivalents. Therefore, amounts generally described as restricted cash and restricted cash equivalents should be included with cash and cash equivalents when reconciling the beginning-of-period and end-of-period total amounts shown on the statement of cash flows. The amendments in this update apply to all entities that have restricted cash or restricted cash equivalents and are required to present a statement of cash

12

BYLINE BANCORP, INC. AND SUBSIDIARIES

NOTES TO CONSOLIDATED FINANCIAL STATEMENTS

(Table dollars in thousands, except share and per share data) (Unaudited)

flows under Topic 230. Theamendment is effective for annual reporting periods beginning after December 15, 2017, and interim periods within those fiscal years. Early adoption of the update is permitted. Assuming the Company remains an emerging growth company, the new authoritative guidance will be effective for reporting periods after January 1, 2019. The Company does not expect this ASU to have a material impact on the Company’s Consolidated Financial Statements.

Income Taxes (Topic 740) In October 2016, the FASB issued ASU No. 2016-16, Income Taxes,Intra-Entity Transfers of Assets Other Than Inventory. The ASU was issued to improve the accounting for income tax consequences of intra-entity transfers of assets other than inventory. Current GAAP prohibits the recognition of current and deferred income taxes for an intra-entity asset transfer until the asset has been sold to an outside party; this update clarifies that an entity should recognize the income tax consequences of an intra-entity transfer of assets other than inventory when the transfer occurs. The amendment is effective for annual reporting periods beginning after December 15, 2017, and interim periods within those fiscal years. Early adoption of the update is permitted. Assuming the Company remains an emerging growth company, the new authoritative guidance will be effective for reporting periods after January 1, 2019. The Company does not expect this ASU to have a material impact on the Company’s Consolidated Financial Statements.

Consolidation (Topic 810) In October 2016, the FASB issued ASU No. 2016-17, Consolidation, Interests Held through Related Parties That Are under Common Control. The ASU was issued to amend the consolidation guidance on how a reporting entity that is the single decision maker of a variable interest entity (“VIE”) should treat indirect interests in the entity held through related parties that are under common control with the reporting entity when determining whether it is the primary beneficiary of that VIE. The primary beneficiary of a VIE is the reporting entity that has a controlling financial interest in a VIE and, therefore, consolidates the VIE. A reporting entity has an indirect interest in a VIE if it has a direct interest in a related party that, in turn, has a direct interest in the VIE. The amendment is effective for annual reporting periods beginning after December 15, 2016, and interim periods within those fiscal years. Early adoption of the update is permitted. The Company adopted this new authoritative guidance on January 1, 2017 and it did not have an impact on the Company’s Consolidated Financial Statements.

Business Combinations (Topic 805) In January 2017, the FASB issued ASU No. 2017-01, Clarifying the Definition of a Business. The guidance clarifies the definition of a business to assist entities with evaluating whether transactions should be accounted for as acquisitions or disposals of assets or businesses. This guidance is effective for annual and interim periods beginning after December 15, 2017. Early adoption is permitted. Assuming the Company remains an emerging growth company, the new authoritative guidance will be effective for reporting periods after January 1, 2019. The Company does not expect a material impact of this ASU on the Company’s Consolidated Financial Statements.

Intangibles—Goodwill and Other (Topic 350) In January 2017, FASB issued ASU No. 2017-04, Simplifying the Test for Goodwill Impairment. The amendments in this ASU are intended to reduce the cost and complexity of the goodwill impairment test by eliminating step two from the impairment test. The amendments modify the concept of impairment from the condition that exists when the carrying amount of goodwill exceeds its implied fair value to the condition that exists when the carrying amount of a reporting unit exceeds its fair value. Under the amendments in this ASU, an entity will perform its annual, or interim, goodwill impairment test by comparing the fair value of the reporting unit with its carrying amount. An impairment charge should be recognized for the amount which the carrying amount exceeds the reporting unit’s fair value; however, the loss recognized should not exceed the total amount of goodwill allocated to that reporting unit. The amendments in this ASU are effective for the Company’s annual or any interim goodwill impairment test in fiscal years beginning after December 15, 2019. Early adoption is permitted for interim or annual goodwill impairment tests performed on testing dates after January 1, 2017. The Company is early adopting these amendments in 2017 and does not expect a material impact on the Company’s Consolidated Financial Statements.

Other Income (Subtopic 610-20) In February 2017, the FASB issued ASU No. 2017-05, Other Income-Gains and Losses from the Derecognition of Nonfinancial Assets.  This ASU will clarify the scope of Subtopic 610-20 and add guidance for partial sales of nonfinancial assets.   The amendments should be applied either on retrospectively to each period presented or with a modified retrospective approach.  The amendment is effective for annual periods beginning after December 15, 2018, and interim periods within annual periods beginning after December 15, 2019.  The Company is currently evaluating the provisions of ASU No. 2017-05 to determine the potential impact the new standard will have on the Company’s Consolidated Financial Statements.

13

BYLINE BANCORP, INC. AND SUBSIDIARIES

NOTES TO CONSOLIDATED FINANCIAL STATEMENTS

(Table dollars in thousands, except share and per share data) (Unaudited)

Nonrefundable Fees and Other Costs (Subtopic 310-20) In March 2017, FASB issued ASU No. 2017-08, Receivables—Nonrefundable Fees and Other Costs. The amendments in the ASU shorten the amortization period for certain callable debt securities held at a premium at the earliest call date. Under current GAAP, the Company amortizes the premium as an adjustment of yield over the contractual life of the instrument. As a result, upon exercise of a call on a callable debt security held at a premium, the unamortized premium is charged to earnings. The ASU shortens the amortization period for certain callable debt securities held at a premium and requires the premium to be amortized to the earliest call date. However, the amendments do not require an accounting change for securities held at a discount; the discount continues to be amortized to maturity. The amendments are effective for annual periods beginning after December 15, 2019, and interim periods within annual periods beginning after December 15, 2020. Early adoption is permitted. The Company is required to apply the amendments on a modified retrospective basis through a cumulative-effect adjustment directly to retained earnings as of the beginning of the period of adoption. Assuming the Company remains an emerging growth company, the new authoritative guidance will be effective for reporting periods after January 1, 2020. The Company is currently evaluating the provisions of ASU No. 2017-08 to determine the potential impact the new standard will have on the Company’s Consolidated Financial Statements.

Note 3—Acquisitionof a Business

On October 14, 2016, the Company acquired stock of Ridgestone Financial Services, Inc. (“Ridgestone”) and its subsidiaries under the terms of a definitive merger agreement (“Agreement”) dated June 9, 2016. Ridgestone operated two wholly-owned subsidiaries, Ridgestone Bank and RidgeStone Capital Trust I, and specialized in government guaranteed lending as a participant in the SBA and USDA lending programs. Ridgestone provided financial services through its two full-service banking offices in Brookfield, Wisconsin and Schaumburg, Illinois. In addition, Ridgestone had loan production offices located in Wisconsin (Green Bay and Wausau), Indiana (Indianapolis) and California (Newport Beach).

Under the terms of the Agreement, each Ridgestone common share was converted into the right to receive, at the election of the stockholder (subject to proration as outlined in the Agreement), either cash or Company common stock, or the combination of both. Total consideration included aggregate cash in the amount of $36.8 million and the issuance of 4,199,791 shares of the Company’s common stock valued at $16.25 per common share. The transaction resulted in goodwill of $26.3 million, which is nondeductible for tax purposes, as this acquisition was a nontaxable transaction. Goodwill represents the premium paid over the fair value of the net tangible and intangible assets acquired and reflects related synergies expected from the combined operations. Acquisition advisory expenses related to the Ridgestone acquisition of $1.1  million are reflected in non-interest expense on the Consolidated Statements of Operations for the nine months ended September 30, 2016. Stock issuance costs were not material. There were no contingent assets or liabilities arising from the acquisition.

The acquisition of Ridgestone was accounted for using the acquisition method of accounting in accordance with ASC Topic 805. Assets acquired, liabilities assumed and consideration exchanged were recorded at their respective acquisition date fair values. Determining the fair value of assets and liabilities involves significant judgment regarding methods and assumptions used to calculate estimated fair values. Fair values are preliminary and subject to refinement for up to one year after the closing date of the acquisition as additional information regarding the closing date fair values become available. Fair values are preliminary estimates due to deferred tax assets and deferred tax liabilities.

14

BYLINE BANCORP, INC. AND SUBSIDIARIES

NOTES TO CONSOLIDATED FINANCIAL STATEMENTS

(Table dollars in thousands, except share and per share data) (Unaudited)

The following table presents a summary of the estimates of fair values of assets acquired and liabilities assumed as of the acquisition date:

Assets
Cash and cash equivalents	$	25,480
Securities available-for-sale		27,662
Restricted stock		931
Loans held for sale		15,363
Loans		351,820
Servicing assets		20,295
Premises and equipment		2,011
Other real estate owned		1,525
Other intangible assets		486
Bank-owned life insurance		2,352
Other assets		8,228
Total assets acquired		456,153
Liabilities
Deposits		361,370
Federal Home Loan Bank advances		9,773
Junior subordinated debentures		1,339
Accrued expenses and other liabilities		4,958
Total liabilities assumed		377,440
Net assets acquired	$	78,713
Consideration paid
Common stock (4,199,791 shares issued at $16.25 per    share)		68,247
Cash paid		36,753
Total consideration paid		105,000
Goodwill	$	26,287

The following table presents the acquired non-impaired loans as of the acquisition date:  

Fair value	$	312,166
Gross contractual amounts receivable		450,292
Estimate of contractual cash flows not expected to be    collected(1)		19,661
Estimate of contractual cash flows expected to be collected		430,631

(1) Includes interest payments not expected to be collected due to loan prepayments as well as principal and interest payments not expected to be collected due to customer default.

The discount on the acquired non-impaired loans is being accreted into income over the life of the loans on an effective yield basis.

15

BYLINE BANCORP, INC. AND SUBSIDIARIES

NOTES TO CONSOLIDATED FINANCIAL STATEMENTS

(Table dollars in thousands, except share and per share data) (Unaudited)

The following table provides the pro forma information for the results of operations for the three and nine months ended September 30, 2016, as if the acquisition had occurred on January 1, 2016. The pro forma results combine the historical results of Ridgestone into the Company’s Consolidated Statements of Operations, including the impact of certain acquisition accounting adjustments, which includes loan discount accretion, intangible assets amortization, deposit premium accretion and borrowing net discount amortization. The pro forma results have been prepared for comparative purposes only and are not necessarily indicative of the results that would have been obtained had the acquisition actually occurred on January 1, 2016. No assumptions have been applied to the pro forma results of operations regarding possible revenue enhancements, provision for credit losses, expense efficiencies or asset dispositions. The acquisition-related expenses that have been recognized are included in net income in the following table.

	Three Months Ended		Nine Months Ended
	September 30, 2016		September 30, 2016
Total revenues (net interest income and non-interest income)	$	44,595	$	130,536
Net income (loss)	$	6,816	$	17,603
Earnings per share—basic	$	0.29	$	0.76
Earnings per share—diluted	$	0.28	$	0.76

The operating results of the Company include the operating results produced by the acquired assets and assumed liabilities of Ridgestone for period from January 1, 2017 through September 30, 2017. Revenues and earnings of the acquired company since the acquisition date have not been disclosed as it is not practicable as Ridgestone was merged into the Company and separate financial information is not readily available.

Note 4—Securities

The followingtablessummarizetheamortizedcostand fairvaluesof securitiesavailable-for-saleand securitiesheld-to-maturityas of the dates shown and thecorrespondingamountsof grossunrealized gainsand losses:

September 30, 2017	Amortized Cost		Gross Unrealized Gains		Gross Unrealized Losses			Fair Value
Available-for-sale
U.S. Treasury Notes	$	14,998	$	—	$	(73	)	$	14,925
U.S. Government agencies		54,231		—		(1,012	)		53,219
Obligations of states, municipalities, and political    subdivisions		32,619		129		(213	)		32,535
Residential mortgage-backed securities
Agency		329,782		7		(5,749	)		324,040
Non-agency		25,429		87		(46	)		25,470
Commercial mortgage-backed securities
Agency		72,190		44		(1,477	)		70,757
Non-agency		31,838		—		(581	)		31,257
Corporate securities		27,093		493		(62	)		27,524
Other securities		3,626		1,387		(56	)		4,957
Total	$	591,806	$	2,147	$	(9,269	)	$	584,684

16

BYLINE BANCORP, INC. AND SUBSIDIARIES

NOTES TO CONSOLIDATED FINANCIAL STATEMENTS

(Table dollars in thousands, except share and per share data) (Unaudited)

September 30, 2017	Amortized Cost		Gross Unrealized Gains		Gross Unrealized Losses			Fair Value
Held-to-maturity
Obligations of states, municipalities, and political subdivisions	$	24,078	$	317	$	(36	)	$	24,359
Residential mortgage-backed securities
Agency		56,453		275		(82	)		56,646
Non-agency		40,922		364		(25	)		41,261
Total	$	121,453	$	956	$	(143	)	$	122,266

December 31, 2016	Amortized Cost		Gross Unrealized Gains		Gross Unrealized Losses			Fair Value
Available-for-sale
U.S. Treasury Notes	$	14,995	$	4	$	(79	)	$	14,920
U.S. Government agencies		60,180		—		(1,323	)		58,857
Obligations of states, municipalities, and political    subdivisions		16,271		60		(272	)		16,059
Residential mortgage-backed securities
Agency		376,800		—		(8,640	)		368,160
Non-agency		20,107		—		(174	)		19,933
Commercial mortgage-backed securities
Agency		78,954		—		(1,551	)		77,403
Non-agency		32,061		—		(1,009	)		31,052
Corporate securities		17,065		350		(86	)		17,329
Other securities		4,161		742		(56	)		4,847
Total	$	620,594	$	1,156	$	(13,190	)	$	608,560

December 31, 2016	Amortized Cost		Gross Unrealized Gains		Gross Unrealized Losses			Fair Value
Held-to-maturity
Obligations of states, municipalities, and political    subdivisions	$	24,878	$	105	$	(229	)	$	24,754
Residential mortgage-backed securities
Agency		67,692		35		(283	)		67,444
Non-agency		46,276		50		(442	)		45,884
Total	$	138,846	$	190	$	(954	)	$	138,082

The Company did not classify securities as trading during 2016 or during the nine months ended September 30, 2017.

17

BYLINE BANCORP, INC. AND SUBSIDIARIES

NOTES TO CONSOLIDATED FINANCIAL STATEMENTS

(Table dollars in thousands, except share and per share data) (Unaudited)

Gross unrealized losses and fair values, aggregated by investment category and length of time that individual securities have been in a continuous unrealized loss position as of September 30, 2017 and December 31, 2016 are summarized as follows:

			Less than 12 Months					12 Months or Longer					Total
September 30, 2017	# of Securities		Fair Value		Unrealized Losses			Fair Value		Unrealized Losses			Fair Value		Unrealized Losses
Available-for-sale
U.S. Treasury Notes		5	$	14,925	$	(73	)	$	—	$	—		$	14,925	$	(73	)
U.S. Government agencies		9		28,418		(438	)		24,801		(574	)		53,219		(1,012	)
Obligations of states, municipalities and    political subdivisions		23		14,431		(122	)		2,082		(91	)		16,513		(213	)
Residential mortgage-backed securities
Agency		40		222,548		(3,356	)		93,293		(2,393	)		315,841		(5,749	)
Non-agency		1		4,789		(46	)		—		—			4,789		(46	)
Commercial mortgage-backed securities
Agency		7		39,378		(1,108	)		19,740		(369	)		59,118		(1,477	)
Non-agency		5		31,257		(581	)		—		—			31,257		(581	)
Corporate securities		3		4,959		(62	)		—		—			4,959		(62	)
Other securities		1		—		—			1,938		(56	)		1,938		(56	)
Total		94	$	360,705	$	(5,786	)	$	141,854	$	(3,483	)	$	502,559	$	(9,269	)

			Less than 12 Months					12 Months or Longer				Total
September 30, 2017	# of Securities		Fair Value		Unrealized Losses			Fair Value		Unrealized Losses		Fair Value		Unrealized Losses
Held-to-maturity
Obligations of states, municipalities, and    political subdivisions		7	$	4,855	$	(36	)	$	—	$	—	$	4,855	$	(36	)
Residential mortgage-backed securities
Agency		9		20,287		(82	)		—		—		20,287		(82	)
Non-agency		3		4,568		(25	)		—		—		4,568		(25	)
Total		19	$	29,710	$	(143	)	$	—	$	—	$	29,710	$	(143	)

			Less than 12 Months					12 Months or Longer					Total
December 31, 2016	# of Securities		Fair Value		Unrealized Losses			Fair Value		Unrealized Losses			Fair Value		Unrealized Losses
Available-for-sale
U.S. Treasury Notes		3	$	9,918	$	(79	)	$	—	$	—		$	9,918	$	(79	)
U.S. Government agencies		10		58,857		(1,323	)		—		—			58,857		(1,323	)
Obligations of states, municipalities and    political subdivisions		14		7,799		(259	)		115		(13	)		7,914		(272	)
Residential mortgage-backed securities
Agency		41		364,713		(8,483	)		3,447		(157	)		368,160		(8,640	)
Non-agency		2		19,933		(174	)		—		—			19,933		(174	)
Commercial mortgage-backed securities
Agency		8		70,762		(1,488	)		6,641		(63	)		77,403		(1,551	)
Non-agency		5		31,052		(1,009	)		—		—			31,052		(1,009	)
Corporate securities		4		5,097		(78	)		2,522		(8	)		7,619		(86	)
Other securities		1		—		—			1,994		(56	)		1,994		(56	)
Total		88	$	568,131	$	(12,893	)	$	14,719	$	(297	)	$	582,850	$	(13,190	)

18

BYLINE BANCORP, INC. AND SUBSIDIARIES

NOTES TO CONSOLIDATED FINANCIAL STATEMENTS

(Table dollars in thousands, except share and per share data) (Unaudited)

			Less than 12 Months					12 Months or Longer				Total
December 31, 2016	# of Securities		Fair Value		Unrealized Losses			Fair Value		Unrealized Losses		Fair Value		Unrealized Losses
Held-to-maturity
Obligations of states, municipalities, and    political subdivisions		22	$	16,235	$	(229	)	$	—	$	—	$	16,235	$	(229	)
Residential mortgage-backed securities
Agency		15		52,156		(283	)		—		—		52,156		(283	)
Non-agency		5		29,245		(442	)		—		—		29,245		(442	)
Total		42	$	97,636	$	(954	)	$	—	$	—	$	97,636	$	(954	)

Certainsecuritieshave fairvalueslessthanamortizedcostand, therefore,containunrealizedlosses.At September 30, 2017, theCompany evaluatedthesecuritieswhich had an unrealizedlossfor other than temporary impairment and determined alldeclinesin valueto be temporary.Therewere 113 investmentsecuritieswith unrealizedlossesat September 30, 2017, of which only one had a continuousunrealizedlosspositionfor12 consecutivemonthsor longerthatisgreaterthan5% of amortizedcost.The Company anticipatesfullrecoveryof amortizedcostwith respectto thesesecuritiesby maturity,or sooner,in theeventof a morefavorablemarketinterestrate environment.The Company does not intendto sellthesesecuritiesand itisnot morelikelythannot thatthe Company willbe requiredto sellthembeforerecoveryof theiramortizedcostbasis,which maybe atmaturity.

The proceedsfromallsalesof securitieswere available-for-sale,and theassociatedgainsand lossesfor thethree and nine months ended September 30, 2017 and 2016 arelistedbelow:

	For the Three Months Ended					For the Nine Months Ended
	September 30,					September 30,
	2017		2016			2017		2016
Proceeds	$	—	$	107,949		$	8	$	507,362
Gross gains		—		912			8		3,341
Gross losses		—		(110	)		—		(110	)

The amountof netgainsreclassifiedfromaccumulatedothercomprehensive income (loss)intoearningsforthe nine months ended September 30, 2017 and 2016 were $8,000 and $3.2 million, respectively. There were no gains or losses reclassified from accumulated other comprehensive income (loss) into earnings for the three months ended September 30, 2017 and $802,000 for the three months ended September 30, 2016.

Securities pledged at September 30, 2017 and December 31, 2016 had carrying amounts of $226.0 million and $178.6 million,respectively.At September 30, 2017 and December 31, 2016, of thosepledged,thecarryingamountsof securitiespledgedas collateralforpublicfund depositswere $189.9 million and $93.2 million,respectively and forcustomerrepurchaseagreementsof $35.9 million and $19.9 million,respectively. There were no securities pledged foradvances from the FederalHomeLoanBank at September 30, 2017.At December 31, 2016 the carrying amount of securities pledged for advances from the Federal Home Loan Bank were $58.7 million. Othersecuritieswere pledgedforderivativepositions,lettersof creditand for purposesrequiredor permittedby law. At September 30, 2017 and December 31, 2016, therewere no holdingsof securitiesof any one issuer,otherthantheU.S.Governmentand itsagencies,in an amountgreaterthan10% of stockholders’ equity.

19

BYLINE BANCORP, INC. AND SUBSIDIARIES

NOTES TO CONSOLIDATED FINANCIAL STATEMENTS

(Table dollars in thousands, except share and per share data) (Unaudited)

At September 30, 2017, theamortizedcostand fairvalueof debtsecuritiesareshown by contractual maturity.Expectedmaturitiesmaydifferfromcontractualmaturitiesifborrowershave therightto callor prepay obligationswith or withoutcallor prepaymentpenalties.Securitiesnot due ata singlematuritydateareshown separately.

	Amortized Cost		Fair Value
Available-for-sale
Due in one year or less	$	5,289	$	5,287
Due from one to five years		70,097		69,824
Due from five to ten years		42,448		42,006
Due after ten years		11,807		11,625
Mortgage-backed securities		459,239		451,524
Other securities with no defined maturity		2,926		4,418
Total	$	591,806	$	584,684
Held-to-maturity
Due from one to five years	$	524	$	528
Due from five to ten years		13,735		13,835
Due after ten years		9,819		9,996
Mortgage-backed securities		97,375		97,907
Total	$	121,453	$	122,266

Note 5—Loanand Lease Receivables

Outstanding loan and lease receivables as of the dates shown were categorized as follows:

	September 30,			December 31,
	2017			2016
Commercial real estate	$	862,523		$	796,950
Residential real estate		582,569			610,699
Construction, land development, and other land		94,639			141,122
Commercial and industrial		503,093			439,476
Installment and other		3,208			2,917
Lease financing receivables		168,924			155,999
Total loans and leases		2,214,956			2,147,163
Net unamortized deferred fees and costs		(1,874	)		(2,119	)
Initial direct costs		3,417			2,967
Allowance for loan and lease losses		(15,980	)		(10,923	)
Net loans and leases	$	2,200,519		$	2,137,088

	September 30,			December 31,
	2017			2016
Lease financing receivables
Net minimum lease payments	$	183,035		$	168,345
Unguaranteed residual values		1,580			1,787
Unearned income		(15,691	)		(14,133	)
Total lease financing receivables		168,924			155,999
Initial direct costs		3,417			2,967
Lease financial receivables before allowance for    lease losses	$	172,341		$	158,966

At September 30, 2017 and December 31, 2016, total loans and leases included the guaranteed amount of U.S. Government guaranteed loans of $51.9 million and $34.8 million, respectively. At September 30, 2017 and December 31,

20

BYLINE BANCORP, INC. AND SUBSIDIARIES

NOTES TO CONSOLIDATED FINANCIAL STATEMENTS

(Table dollars in thousands, except share and per share data) (Unaudited)

2016, installment and other loans included overdraft deposits of $483,000 and $1.0 million, respectively, which were reclassified as loans. At September 30, 2017 and December 31, 2016, loans and loans held for sale pledged as security for borrowings were $530.3 million and $507.2 million, respectively. Total loans and leases consist of originated loans and leases, acquired impaired loans and acquired non-impaired loans and leases.

The minimumannualleasepaymentsforleasefinancingreceivablesas of September 30, 2017 are summarizedas follows:

	Minimum Lease Payments
2017	$	15,345
2018		62,718
2019		48,463
2020		32,863
2021		17,699
Thereafter		5,947
Total	$	183,035

Originatedloansand leasesrepresentoriginationsfollowinga businesscombination.Acquiredimpaired loansareloansacquiredfroma businesscombinationwith evidenceof creditqualitydeteriorationand are accountedforunderASC Topic 310-30. Acquirednon-impairedloansand leasesrepresentloansand leasesacquired froma businesscombinationwithoutevidenceof creditqualitydeteriorationand areaccountedforunderASC Topic 310-20. Leasesand revolvingloansdo not qualifyto be accountedforas acquiredimpairedloansand are accountedforunderASC Topic 310-20. The followingtablessummarizethebalancesforeachrespectiveloanand leasecategoryas of September 30, 2017 and December 31, 2016:

September 30, 2017	Originated		Acquired Impaired		Acquired Non- Impaired		Total
Commercial real estate	$	463,020	$	173,106	$	225,759	$	861,885
Residential real estate		398,062		152,149		32,451		582,662
Construction, land development, and other land		85,666		5,424		3,214		94,304
Commercial and industrial		390,331		11,433		100,291		502,055
Installment and other		2,726		488		38		3,252
Lease financing receivables		134,193		—		38,148		172,341
Total loans and leases	$	1,473,998	$	342,600	$	399,901	$	2,216,499

December 31, 2016	Originated		Acquired Impaired		Acquired Non- Impaired		Total
Commercial real estate	$	338,752	$	207,303	$	250,289	$	796,344
Residential real estate		394,168		175,717		40,853		610,738
Construction, land development, and other land		119,357		6,979		14,430		140,766
Commercial and industrial		309,097		13,464		115,677		438,238
Installment and other		2,021		574		364		2,959
Lease financing receivables		118,493		—		40,473		158,966
Total loans and leases	$	1,281,888	$	404,037	$	462,086	$	2,148,011

21

BYLINE BANCORP, INC. AND SUBSIDIARIES

NOTES TO CONSOLIDATED FINANCIAL STATEMENTS

(Table dollars in thousands, except share and per share data) (Unaudited)

The outstandingbalanceand carryingamountof allacquiredimpairedloansaresummarizedbelow. The balancesdo not includean allowanceforloanand leaselossesof $3.8 million and $1.6 million,at September 30, 2017 and December 31, 2016, respectively.

	September 30, 2017				December 31, 2016
	Outstanding Balance		Carrying Value		Outstanding Balance		Carrying Value
Commercial real estate	$	245,182	$	173,106	$	278,893	$	207,303
Residential real estate		215,135		152,149		236,384		175,717
Construction, land development, and other land		13,511		5,424		15,292		6,979
Commercial and industrial		20,255		11,433		23,164		13,464
Installment and other		1,842		488		1,976		574
Total acquired impaired loans	$	495,925	$	342,600	$	555,709	$	404,037

The following table summarizes the changes in accretable yield for acquired impaired loans for the three and nine months ended September 30, 2017 and 2016:

	Three Months Ended						Nine Months Ended
	September 30,						September 30,
	2017			2016			2017			2016
Beginning balance	$	37,619		$	35,663		$	36,868		$	43,915
Accretion to interest income		(8,165	)		(5,859	)		(24,768	)		(20,071	)
Reclassification from nonaccretable difference		6,901			1,777			24,255			7,737
Ending balance	$	36,355		$	31,581		$	36,355		$	31,581

Acquired non-impaired loans and leases—The unpaidprincipalbalanceand carryingvalueforacquirednon-impairedloansand leasesat September 30, 2017 and December 31, 2016 were as follows:

	September 30, 2017				December 31, 2016
	Unpaid Principal Balance		Carrying Value		Unpaid Principal Balance		Carrying Value
Commercial real estate	$	232,016	$	225,759	$	259,055	$	250,289
Residential real estate		32,984		32,451		41,282		40,853
Construction, land development, and other land		3,277		3,214		14,619		14,430
Commercial and industrial		111,167		100,291		125,806		115,677
Installment and other		352		38		402		364
Lease financing receivables		39,053		38,148		40,205		40,473
Total acquired non-impaired loans and leases	$	418,849	$	399,901	$	481,369	$	462,086

Note 6—Allowance forLoanand Lease Losses and ReserveforUnfundedCommitments

Loans and leasesconsideredforinclusionin theallowanceforloanand leaselossesincludeacquired non-impairedloansand leases,thoseacquiredimpairedloanswith creditdeteriorationafteracquisition,and originatedloansand leases.Although allacquiredloansand leasesareincludedin the followingtable,only thosewith creditdeteriorationsubsequentto acquisitiondateareactuallyincludedin the allowanceforloanand leaselosses.

The followingtablessummarizethebalanceand activitywithintheallowanceforloanand leaselosses, thecomponentsof theallowanceforloanand leaselossesin termsof loansand leasesindividuallyand collectivelyevaluatedforimpairment,and correspondingloanand leasebalancesby typefor the three and nine months ended September 30, 2017 and 2016 are as follows:

22

BYLINE BANCORP, INC. AND SUBSIDIARIES

NOTES TO CONSOLIDATED FINANCIAL STATEMENTS

(Table dollars in thousands, except share and per share data) (Unaudited)

September 30, 2017	Commercial Real Estate			Residential Real Estate			Construction, Land Development, and Other Land			Commercial and Industrial			Installment and Other			Lease Financing Receivables			Total
Allowance for loan and lease losses
Three months ended
Beginning balance	$	3,668		$	1,835		$	327		$	5,689		$	344		$	2,106		$	13,969
Provisions		1,577			52			(111	)		1,440			13			929			3,900
Charge-offs		(186	)		(161	)		—			(763	)		(327	)		(862	)		(2,299	)
Recoveries		—			—			—			—			—			410			410
Ending balance	$	5,059		$	1,726		$	216		$	6,366		$	30		$	2,583		$	15,980
Nine months ended
Beginning balance	$	1,945		$	2,483		$	742		$	4,196		$	334		$	1,223		$	10,923
Provisions		3,591			(400	)		(526	)		3,932			23			2,686			9,306
Charge-offs		(477	)		(357	)		—			(1,762	)		(327	)		(2,399	)		(5,322	)
Recoveries		—			—			—			—			—			1,073			1,073
Ending balance	$	5,059		$	1,726		$	216		$	6,366		$	30		$	2,583		$	15,980
Ending balance:
Individually evaluated for    impairment	$	1,186		$	176		$	—		$	1,585		$	2		$	—		$	2,949
Collectively evaluated for    impairment		1,844			1,237			155			3,389			10			2,583			9,218
Loans acquired with deteriorated    credit quality		2,029			313			61			1,392			18			—			3,813
Total allowance for loan and lease    losses	$	5,059		$	1,726		$	216		$	6,366		$	30		$	2,583		$	15,980

September 30, 2017	Commercial Real Estate		Residential Real Estate		Construction, Land Development, and Other Land		Commercial and Industrial		Installment and Other		Lease Financing Receivables		Total
Loans and leases ending balance:
Individually evaluated for    impairment	$	14,928	$	1,948	$	565	$	6,075	$	2	$	—	$	23,518
Collectively evaluated for    impairment		673,851		428,565		88,315		484,547		2,762		172,341		1,850,381
Loans acquired with deteriorated    credit quality		173,106		152,149		5,424		11,433		488		—		342,600
Total loans and leases	$	861,885	$	582,662	$	94,304	$	502,055	$	3,252	$	172,341	$	2,216,499

23

BYLINE BANCORP, INC. AND SUBSIDIARIES

NOTES TO CONSOLIDATED FINANCIAL STATEMENTS

(Table dollars in thousands, except share and per share data) (Unaudited)

September 30, 2016	Commercial Real Estate			Residential Real Estate			Construction, Land Development, and Other Land			Commercial and Industrial			Installment and Other			Lease Financing Receivables			Total
Allowance for loan and lease losses
Three months ended
Beginning balance	$	2,119		$	1,303		$	489		$	1,472		$	367		$	740		$	6,490
Provisions		27			41			66			624			(3	)		928			1,683
Charge-offs		(1,078	)		25			(95	)		(2	)		(9	)		(671	)		(1,830	)
Recoveries		—			—			—			—			—			158			158
Ending balance	$	1,068		$	1,369		$	460		$	2,094		$	355		$	1,155		$	6,501
Nine months ended
Beginning balance	$	2,280		$	2,981		$	232		$	1,403		$	357		$	379		$	7,632
Provisions		3,050			(980	)		323			768			8			2,179			5,348
Charge-offs		(4,262	)		(632	)		(95	)		(77	)		(10	)		(1,934	)		(7,010	)
Recoveries		—			—			—			—			—			531			531
Ending balance	$	1,068		$	1,369		$	460		$	2,094		$	355		$	1,155		$	6,501
Ending balance:
Individually evaluated for    impairment	$	—		$	339		$	—		$	192		$	328		$	—		$	859
Collectively evaluated for    impairment		669			534			413			1,264			1			1,155			4,036
Loans acquired with deteriorated    credit quality		399			496			47			638			26			—			1,606
Total allowance for loan and lease    losses	$	1,068		$	1,369		$	460		$	2,094		$	355		$	1,155		$	6,501

September 30, 2016	Commercial Real Estate		Residential Real Estate		Construction, Land Development, and Other Land		Commercial and Industrial		Installment and Other		Lease Financing Receivables		Total
Loans and leases ending balance:
Individually evaluated for    impairment	$	6,374	$	2,553	$	—	$	192	$	328	$	—	$	9,447
Collectively evaluated for    impairment		377,090		438,446		104,369		244,566		1,055		154,557		1,320,083
Loans acquired with deteriorated    credit quality		187,359		185,979		7,539		6,512		590		—		387,979
Total loans and leases	$	570,823	$	626,978	$	111,908	$	251,270	$	1,973	$	154,557	$	1,717,509

The Company increased the allowance for loan and lease losses by $2.0 million and $5.1 million for the three and nine months ended September 30, 2017, respectively. The Company increased theallowanceforloanand lease lossesby $11,000 for the three months ended September 30, 2016 and decreased the allowance for loan and lease losses by $1.1 million forthe nine months ended September 30, 2016. For acquired impaired loans, the Company increased the allowance for loan and lease losses by $559,000 and $2.2 million for the three and nine months ended September 30, 2017, respectively. The Company increased the allowance for loan and lease losses for acquired impaired loans by $8,000 for the three months ended September 30, 2016 and decreased the allowance for loan and lease losses for acquired impaired loans by $1.7 million for the nine months ended September 30, 2016.

24

BYLINE BANCORP, INC. AND SUBSIDIARIES

NOTES TO CONSOLIDATED FINANCIAL STATEMENTS

(Table dollars in thousands, except share and per share data) (Unaudited)

The followingtablessummarizetherecordedinvestment,unpaidprincipalbalance, and relatedallowanceforloansand leasesconsideredimpaired as of September 30, 2017 and December 31, 2016, which excludes acquired impaired loans:

September 30, 2017	Recorded Investment		Unpaid Principal Balance		Related Allowance
With no related allowance recorded
Commercial real estate	$	9,541	$	10,149	$	—
Residential real estate		1,581		2,589		—
Construction, land development and other land		565		565		—
Commercial and industrial		3,465		3,652		—
With an allowance recorded
Commercial real estate		5,387		5,521		1,186
Residential real estate		367		387		176
Commercial and industrial		2,610		2,934		1,585
Installment and other		2		310		2
Total impaired loans	$	23,518	$	26,107	$	2,949

December 31, 2016	Recorded Investment		Unpaid Principal Balance		Related Allowance
With no related allowance recorded
Commercial real estate	$	8,916	$	9,502	$	—
Residential real estate		804		1,999		—
Commercial and Industrial		521		524		—
With an allowance recorded
Residential real estate		496		528		293
Commercial and industrial		861		869		396
Installment and other		328		361		328
Total impaired loans	$	11,926	$	13,783	$	1,017

The following tables summarize the average recorded investment and interest income recognized for loans and leases considered impaired, which excludes acquired impaired loans, for the periods ended as follows:

September 30, 2017	Average Recorded Investment		Interest Income Recognized
With no related allowance recorded
Commercial real estate	$	10,605	$	419
Residential real estate		1,698		33
Construction, land development and other land		269		2
Commercial and Industrial		2,391		253
With an allowance recorded
Commercial real estate		1,043		287
Residential real estate		444		4
Construction, land development and other land		19		—
Commercial and industrial		1,673		500
Installment and other		213		11
Total impaired loans	$	18,355	$	1,509

25

BYLINE BANCORP, INC. AND SUBSIDIARIES

NOTES TO CONSOLIDATED FINANCIAL STATEMENTS

(Table dollars in thousands, except share and per share data) (Unaudited)

September 30, 2016	Average Recorded Investment		Interest Income Recognized
With no related allowance recorded
Commercial real estate	$	4,129	$	128
Residential real estate		2,479		65
Construction, land development and other land		96		—
Commercial and industrial		12		—
With an allowance recorded
Commercial real estate		2,099		—
Residential real estate		727		7
Construction, land development and other land		156		—
Commercial and industrial		171		2
Installment and other		328		11
Total impaired loans	$	8,337	$	192

For purposesof thesetables,theunpaidprincipalbalancerepresentstheoutstandingcontractualbalance. Impairedloansincludeloansthatareindividuallyevaluatedforimpairmentas wellas troubleddebt restructuringsforallloancategories.The sumof non-accrualloansand loanspastdue 90 days stillon accrual willdifferfromthetotalimpairedloanamount.

The followingtablessummarizetheriskratingcategoriesof theloansand leasesconsideredfor inclusionin theallowanceforloanand leaselossescalculation,excludingacquiredimpairedloans,as of September 30, 2017 and December 31, 2016:

September 30, 2017	Commercial Real Estate		Residential Real Estate		Construction, Land Development, and Other Land		Commercial and Industrial		Installment and Other		Lease Financing Receivables		Total
Pass	$	617,061	$	421,109	$	73,781	$	400,838	$	2,761	$	170,410	$	1,685,960
Watch		44,273		4,871		11,947		71,752		3		214		133,060
Special Mention		11,958		2,513		2,587		10,104		—		894		28,056
Substandard		15,487		2,020		565		7,928		—		639		26,639
Doubtful		—		—		—		—		—		184		184
Loss		—		—		—		—		—		—		—
Total	$	688,779	$	430,513	$	88,880	$	490,622	$	2,764	$	172,341	$	1,873,899

December 31, 2016	Commercial Real Estate		Residential Real Estate		Construction, Land Development, and Other Land		Commercial and Industrial		Installment and Other		Lease Financing Receivables		Total
Pass	$	536,499	$	419,880	$	129,732	$	369,136	$	2,052	$	157,296	$	1,614,595
Watch		38,707		10,885		2,897		52,872		4		324		105,689
Special Mention		5,377		3,116		1,158		1,258		1		512		11,422
Substandard		8,458		1,140		—		1,508		328		739		12,173
Doubtful		—		—		—		—		—		95		95
Loss		—		—		—		—		—		—		—
Total	$	589,041	$	435,021	$	133,787	$	424,774	$	2,385	$	158,966	$	1,743,974

26

BYLINE BANCORP, INC. AND SUBSIDIARIES

NOTES TO CONSOLIDATED FINANCIAL STATEMENTS

(Table dollars in thousands, except share and per share data) (Unaudited)

The following tables summarize contractual delinquency information for acquired non-impaired and originated loans and leases by category at September 30, 2017 and December 31, 2016:

September 30, 2017	30-59 Days Past Due		60-89 Days Past Due		Greater than 90 Days and Accruing		Non- accrual		Total Past Due		Current		Total
Commercial real estate	$	350	$	596	$	—	$	8,672	$	9,618	$	679,161	$	688,779
Residential real estate		—		220		—		1,852		2,072		428,441		430,513
Construction, land development, and    other land		—		—		—		565		565		88,315		88,880
Commercial and industrial		2,245		416		—		3,537		6,198		484,424		490,622
Installment and other		2		—		—		—		2		2,762		2,764
Lease financing receivables		995		328		—		495		1,818		170,523		172,341
Total	$	3,592	$	1,560	$	—	$	15,121	$	20,273	$	1,853,626	$	1,873,899

December 31, 2016	30-59 Days Past Due		60-89 Days Past Due		Greater than 90 Days and Accruing		Non- accrual		Total Past Due		Current		Total
Commercial real estate	$	2,944	$	648	$	—	$	3,935	$	7,527	$	581,514	$	589,041
Residential real estate		243		—		—		1,118		1,361		433,660		435,021
Construction, land development, and    other land		1,363		—		—		—		1,363		132,424		133,787
Commercial and industrial		6,066		374		—		958		7,398		417,376		424,774
Installment and other		—		—		—		328		328		2,057		2,385
Lease financing receivables		2,070		390		—		445		2,905		156,061		158,966
Total	$	12,686	$	1,412	$	—	$	6,784	$	20,882	$	1,723,092	$	1,743,974

At September 30, 2017 and December 31, 2016, theCompany had a recordedinvestmentin troubleddebt restructuringsof $2.3 million and $1.2 million,respectively.The restructuringswere granteddue to borrower financialdifficultyand providefora modificationof loanrepaymentterms.The Company has not allocatedany specificallowancefortheseloansat September 30, 2017 and December 31, 2016. In addition,therewere no commitments outstandingon troubleddebtrestructurings.

Loans modifiedas troubleddebtrestructuringsthatoccurredduringthe three and nine months ended September 30, 2017 and year ended December 31, 2016 did not resultin any charge-offsor permanentreductionsof therecordedinvestmentsin theloans. There were $867,000 and $2.1 million of loans modified as troubled debt restructurings during the three and nine months ended September 30, 2017. Troubleddebtrestructuringsthatsubsequentlydefaultedwithintwelvemonthsof therestructuredateduringthe year ended December 31, 2016 had a recordedinvestmentof $477,000. No troubleddebtrestructuringssubsequentlydefaultedwithintwelvemonthsof therestructuredateduringthe three and nine months ended September 30, 2017.

At September 30, 2017 and December 31, 2016, thereserveforunfundedcommitmentswas $1.0 million and $760,000, respectively.During the nine months ended September 30, 2017 and 2016, theprovisionsforunfundedcommitments were $272,000 and $56,000, respectively.Therewere no charge-offsor recoveriesrelatedto thereservefor unfundedcommitmentsduringthe periods.

Note 7—ServicingAssets

As partof theRidgestoneacquisition,theCompany acquiredloanservicingassets.The Company did not hold any servicingassetsuntil the acquisition on October 14, 2016.

27

BYLINE BANCORP, INC. AND SUBSIDIARIES

NOTES TO CONSOLIDATED FINANCIAL STATEMENTS

(Table dollars in thousands, except share and per share data) (Unaudited)

Loans servicedforothersarenot includedin theConsolidatedStatementsof FinancialCondition.The unpaidprincipalbalancesof theseloansservicedforotherswere as follows as of September 30, 2017 and December 31, 2016:

	September 30,		December 31,
	2017		2016
Loan portfolios serviced for:
SBA guaranteed loans	$	1,001,845	$	911,803
USDA guaranteed loans		87,589		106,125
Total	$	1,089,434	$	1,017,928

Activityforservicingassetsand therelatedchangesin fairvalue for the nine months ended September 30, 2017 is as follows:

	Nine Months Ended
	September 30, 2017
Beginning balance	$	21,091
Additions, net		4,675
Changes in fair value		(4,097	)
Ending balance	$	21,669

Loan servicing income totaled $1.0 million and $3.0 million for the three and nine months ended September 30, 2017, respectively.

The fairvalueof servicingrightsishighlysensitiveto changesin underlyingassumptions.Changes in prepaymentspeedassumptionshave themostsignificantimpacton thefairvalueof servicingrights.

Generally, as interest rates rise on variable rate loans, loan prepayments increase due to an increase in refinance activity, which may result in a decrease in the fair value of servicing assets. Measurement of fair value is limited to the condition existing and the assumptions used as of a particular point in time, and those assumptions may change over time. Refer to Note 16—Fair Value Measurement for further details.

Note 8—Other Real Estate Owned

The following table presents the change in other real estate owned (“OREO”) for the nine months ended September 30, 2017 and 2016.

	Nine Months Ended September 30,
	2017			2016
Beginning balance	$	16,570		$	26,715
Net additions to OREO		5,701			3,721
Proceeds from the sales of OREO		(9,583	)		(15,392	)
Net gains on sales of OREO		1,538			1,134
Valuation adjustments		(367	)		(904	)
Ending balance	$	13,859		$	15,274

The recorded investment in residential mortgage loans secured by residential real estate properties (including purchased credit-impaired loans) for which foreclosure proceedings are in process totaled $2.0 million and $2.7 million at September 30, 2017 and December 31, 2016, respectively.

28

BYLINE BANCORP, INC. AND SUBSIDIARIES

NOTES TO CONSOLIDATED FINANCIAL STATEMENTS

(Table dollars in thousands, except share and per share data) (Unaudited)

Note 9—Goodwill, Core Deposit Intangible and Other Intangible Assets

The following table summarizes the changes in the Company’s goodwill and core deposit intangible assets for the nine months ended September 30, 2017 and 2016:

	Nine Months Ended September 30,
	2017					2016
	Goodwill		CoreDeposit Intangible			Goodwill		Core Deposit Intangible
Beginning balance	$	51,975	$	19,776		$	25,688	$	22,275
Amortization or accretion		—		(2,293	)		—		(2,228	)
Ending balance	$	51,975	$	17,483		$	25,688	$	20,047
Accumulated amortization or accretion	N/A		$	12,703		N/A		$	9,653
Weighted average remaining amortization or accretion    period	N/A		5.8 Years			N/A		6.8 Years

The Company had other intangible assets of $39,000 and $50,000 as of September 30, 2017 and December 31, 2016, respectively, related to trademark-related transactions.

The following table presents the estimated amortization expense for core deposit intangible and other intangible assets recognized at September 30, 2017:

	Estimated Amortization
2017	$	767
2018		3,060
2019		3,050
2020		3,027
2021		3,017
Thereafter		4,601
Total	$	17,522

Note 10—IncomeTaxes

The Company uses an estimated annual effective tax rate method in computing its interim tax provision. This effective tax rate is based on forecasted annual pre-tax income, permanent tax differences and statutory tax rates.

The effective tax rates for the nine months ended September 30, 2017 and 2016 were 24.4% and (8.6)%, respectively. The Company began to recognize income tax expense in the quarter ended December 31, 2016 after the reversal of $61.9 million of the Company’s previously established valuation allowance on its net deferred tax assets.

Deferred tax assets decreased $7.4 million from $67.8 million at December 31, 2016 to $60.4 million at September 30, 2017. This decrease was primarily due to a reduction in the Company’s net operation loss carryforwards being applied to the current year tax liability.

As part of a budget package passed by the Legislature of the State of Illinois, the corporate income tax rate increased from 5.25% to 7.00% effective July 1, 2017.   As a result of the increase in the corporate income tax rate, we recorded a state income tax benefit of $4.6 million due to increased value of our deferred tax asset related to our Illinois net loss deduction.

29

BYLINE BANCORP, INC. AND SUBSIDIARIES

NOTES TO CONSOLIDATED FINANCIAL STATEMENTS

(Table dollars in thousands, except share and per share data) (Unaudited)

Note 11—Deposits

The composition of deposits was as follows as of September 30, 2017 and December 31, 2016:

	September 30,		December 31,
	2017		2016
Non-interest bearing demand deposits	$	753,662	$	724,457
Interest bearing checking accounts		187,232		173,929
Money market demand accounts		418,006		369,074
Other savings		435,536		446,418
Time deposits (below $100,000)		377,929		392,854
Time deposits ($100,000 and above)		348,564		383,662
Total deposits	$	2,520,929	$	2,490,394

Time deposits of $100,000 or more included $30.8 million of brokered deposits at December 31, 2016 and none at September 30, 2017. Time deposits in denominations of $250,000 or more at September 30, 2017 and December 31, 2016 were $83.4 million and $117.4 million, respectively.

Note 12—FederalHomeLoanBankAdvances

The followingtablesummarizestheFHLBadvancesas of September 30, 2017 and December 31, 2016, which include acquisition accounting adjustments of $72,000 and $228,000, respectively, alongwith weightedaveragecostsand scheduledmaturities:

	September 30,			December 31,
	2017			2016
Federal Home Loan Bank advances	$	234,559		$	313,715
Weighted average cost		1.32	%		0.73	%

	Scheduled Maturities
2017	$	225,000
2018		9,559
Total	$	234,559

At September 30, 2017, advances had fixed terms with interestratesrangingfrom 1.24% to 3.22% and maturitiesrangingfrom December 2017 to February2018. The Bank’sadvancesfromtheFHLBarecollateralizedby residentialrealestateloansand securities. At September 30, 2017 and December 31, 2016, the Bank had additional borrowing capacity from the FHLB of $913.0 million and $647.9 million, respectively, subject to the availability of proper collateral.  The Bank’s maximumborrowingcapacityislimitedto 35% of totalassets.

FHLBadvancesassumedfromtheRidgestoneacquisitionof $1.5 millionareputablequarterlyand are requiredto be repaidupon therequestof theFHLB.

The Company hedgesinterestrateson borrowedfundsusinginterestrateswaps throughwhich the Company receivesvariableamountsand pays fixedamounts.Referto Note 17—DerivativeInstrumentsand Hedge Activitiesforadditionalinformation.

30

BYLINE BANCORP, INC. AND SUBSIDIARIES

NOTES TO CONSOLIDATED FINANCIAL STATEMENTS

(Table dollars in thousands, except share and per share data) (Unaudited)

Note 13—Other Borrowings

The following is a summary of the Company’s other borrowings as of September 30, 2017 and December 31, 2016:

	September 30,		December 31,
	2017		2016
Securities sold under agreements to repurchase	$	30,807	$	17,249
Line of credit		—		20,650
Total	$	30,807	$	37,899

Securitiessoldunderagreementsto repurchaserepresenta demanddepositproductofferedto customers thatsweep balancesin excessof theFDICinsurancelimitintoovernightrepurchaseagreements.The Company pledgessecuritiesas collateralfortherepurchaseagreements.Referto Note 4—Securitiesforadditional discussion.

OnOctober13,2016,inconnectionwiththeRidgestoneacquisition,theCompany enteredintoa$30.0million creditagreementwithThe PrivateBank and Trust and Company, now known as CIBC Bank USA (“CIBC”), witha$300,000commitmentfeepayableat suchtime.Thelineofcreditmatured onOctober12,2017andcarriedaninterestrateequaltothePrime Rate.At September 30, 2017 and December 31, 2016,the interestratewas 4.25% and 3.75%, respectively.Asof September 30, 2017 and December 31, 2016,theCompanywasincompliancewithallfinancialcovenantsset forthinthelineofcreditagreement.  In April 2017, the revolving line of credit was amended to a non-revolving line of credit as long as the outstanding balance exceeds $5.0 million. When the outstanding balance reaches $5.0 million, the line of credit will be converted to a revolving line of credit with credit availability up to $5.0 million until maturity.  In July 2017, the Company repaid the outstanding balance, in full, under this line of credit of $16.2 million with proceeds from its initial public offering.  On October 12, 2017, the Company amended the credit agreement, which extended the maturity date to October 11, 2018. The amended revolving line of credit bears interest at either the LIBOR Rate plus 250 basis points or the Prime Rate minus 25 basis points, based on the Company’s election, which is required to be communicated to CIBC at least three business days prior to the commencement of an interest period. If the Company fails to provide timely notification, the interest rate will be Prime Rate minus 25 basis points.

The followingtablepresentsshort-termcreditlinesavailableforuse, forwhich theCompany did not have an outstandingbalanceas of September 30, 2017 and December 31, 2016:

	September 30,		December 31,
	2017		2016
Federal Reserve Bank of Chicago discount window line	$	135,278	$	110,600
Available federal funds lines		40,000		20,000

Note 14—Junior Subordinated Debentures

At September 30, 2017 and December 31, 2016, theCompany’sjuniorsubordinateddebenturesby issuancewere as follows:

Name of Trust	Aggregate Principal Amount September 30, 2017			Aggregate Principal Amount December 31, 2016			Stated Maturity	Contractual Rate at September 30, 2017			Interest Rate Spread
MetropolitanStatutory Trust 1	$	35,000		$	35,000		March17, 2034		4.11	%	Three-month LIBOR + 2.79%
RidgeStone Capital Trust I		1,500			1,500		June 30, 2033		5.09	%	Five-year LIBOR + 3.50%
Total liability, at par		36,500			36,500
Discount		(9,018	)		(9,574	)
Total liability, at carrying value	$	27,482		$	26,926

In 2004, theCompany’spredecessor,MetropolitanBank Group, Inc.,issued$35.0 millionfloatingrate juniorsubordinateddebenturesto MetropolitanStatutoryTrust1, which was formedfortheissuanceof trust preferredsecurities.

31

BYLINE BANCORP, INC. AND SUBSIDIARIES

NOTES TO CONSOLIDATED FINANCIAL STATEMENTS

(Table dollars in thousands, except share and per share data) (Unaudited)

The debenturesbearinterestatthree-monthLondon InterbankOfferedRate (“LIBOR”) plus 2.79% (4.11%and 3.78% at September 30, 2017 and December 31, 2016, respectively).Interestispayablequarterly.The Company has therightto redeemthedebentures,in whole or in part,on any interestpaymentdateon or after March2009. Accruedinterestpayablewas $54,000 and $50,000 as of September 30, 2017 and December 31, 2016, respectively.

As part of the Ridgestone acquisition, the Company assumed the obligations to RidgeStone Capital Trust I of $1.5 million in principal amount, which was formed for the issuance of trust preferred securities. Refer to Note 3—Acquisition of a Business for additional information. Beginning on June 30, 2008, the interest rate reset to the five-year LIBOR plus 3.50% (5.09% at September 30, 2017 and December 31, 2016), which is in effect until September 30, 2018 and updated every five years. Interest is paid on a quarterly basis. The Company has the right to redeem the debentures, in whole or in part, on any interest payment date on or after June 30, 2008. There was no accrued interest payable as of September 30, 2017 or December 31, 2016.

The Trustsarenot consolidatedwith theCompany. Accordingly,theCompany reportsthesubordinated debenturesheldby theTrustsas liabilities.The Company owns allof thecommonsecuritiesof eachtrust.The juniorsubordinateddebenturesqualify,and aretreatedas, Tier1 regulatorycapitalof theCompany subjectto regulatorylimitations.The trustpreferredsecuritiesissuedby eachtrustrankequallywith thecommonsecurities in rightof payment,exceptthatifan eventof defaultundertheindenturegoverningthenoteshas occurredand is continuing,thepreferredsecuritieswillrankseniorto thecommonsecuritiesin rightof payment.

Note 15—Commitmentsand Contingent Liabilities

Legalcontingencies—Intheordinarycourseofbusiness,theCompanyandBankhavevarious outstandingcommitmentsandcontingentliabilitiesthatarenotrecognizedintheaccompanyingconsolidated financialstatements.Inaddition,theCompanymaybeadefendantincertainclaimsandlegalactionsarisinginthe ordinarycourseofbusiness.Intheopinionofmanagement,afterconsultationwithlegalcounsel,theultimate dispositionofthesemattersiscurrentlynotexpectedtohaveamaterialadverseeffectonthe Company’s Consolidated Statements of Financial Condition.

Operatingleasecommitments—The Company has enteredintovariousoperatingleaseagreements primarilyforfacilitiesand landon which bankingfacilitiesarelocated.Certainleaseagreementshave renewal optionsattheend of theoriginalleasetermand certainleaseagreementshave escalationclausesin therent payments.

The minimumannualrentalcommitmentsforoperatingleasessubsequentto September 30, 2017, exclusiveof taxesand othercharges,aresummarizedas follows:

	MinimumRental Commitments
2017	$	754
2018		2,849
2019		2,506
2020		2,006
2021		1,759
Thereafter		3,025
Total	$	12,899

The Company’srentalexpensesforthe nine months ended September 30, 2017 and 2016  were $3.4 millionand $2.7 million,respectively. Rental expenses for the three months ended September 30, 2017 and 2016 were $1.1 million and $950,000, respectively. For the nine months ended September 30, 2017 and 2016, theCompany received $526,000 and $551,000, respectively,in subleaseincomewhich isincludedin the ConsolidatedStatementsof Operationsas a reductionof occupancyexpense. Sublease income for the three months ended September 30, 2017 and 2016 was $166,000 and $187,000, respectively. In additionto theabove requiredleasepayments, the Company has contractualobligationsrelated primarilyto informationtechnologycontractsand othermaintenancecontracts.The amountsarenot material.

Commitmentsto extend credit—The Bank ispartyto financialinstrumentswith off-balancesheetrisk in thenormalcourseof businessto meetthefinancingneedsof itscustomers.These financialinstrumentsinclude commitmentsto extendcreditand standbylettersof credit.Those instrumentsinvolve,to varyingdegrees, elementsof creditand interestrate

32

BYLINE BANCORP, INC. AND SUBSIDIARIES

NOTES TO CONSOLIDATED FINANCIAL STATEMENTS

(Table dollars in thousands, except share and per share data) (Unaudited)

riskin excessof theamountrecognizedin theConsolidatedStatementsof FinancialCondition.The contractualor notionalamountsof thoseinstrumentsreflecttheextentof involvement theBank has in particularclassesof financialinstruments.

The Bank’s exposureto creditlossin theeventof non-performanceby theotherpartyto thefinancial instrumentforcommitmentsto extendcreditand standbylettersof creditisrepresentedby thecontractualor notionalamountof thoseinstruments.The Bank usesthesamecreditpoliciesin makingcommitmentsand conditionalobligationsas itdoes forfundedinstruments.The Bank does not anticipateany materiallossesas a resultof thecommitmentsand standbylettersof credit.

The followingtablesummarizesthecontractor notionalamountof outstandingloanand lease commitmentsat September 30, 2017 and December 31, 2016:

	September 30,				December 31,
	2017				2016
	Fixed Rate		Variable Rate		Fixed Rate		Variable Rate
Commitments to extend credit	$	46,427	$	425,115	$	37,731	$	332,928
Standby letters of credit		1,050		3,655		1,060		4,135
Total	$	47,477	$	428,770	$	38,791	$	337,063

Commitmentsto extendcreditareagreementsto lendto a customeras long as thereisno violationof any conditionestablishedin thecontract.Commitmentsgenerallyhave fixedexpirationdatesor other terminationclausesand mayrequirepaymentof a fee.Sincemanyof thecommitmentsareexpectedto expire withoutbeingdrawn upon, thetotalcommitmentamountdoes not necessarilyrepresentfuturecashrequirements. The Bank evaluateseachcustomer’screditworthinesson a case-by-casebasis.The amountof collateralobtained, ifdeemednecessaryby theBank upon extensionof credit,isbasedon management’screditevaluationof the counterparty.Collateralisprimarilyobtainedin theformof commercialand residentialrealestate(including incomeproducingcommercialproperties).

Standby lettersof creditareconditionalcommitmentsissuedby theBank to guaranteeto a third-party theperformanceof a customer.Those guaranteesareprimarilyissuedto supportpublicand privateborrowing arrangements,bond financingand similartransactions.The creditriskinvolvedin issuinglettersof creditis essentiallythesameas thatinvolvedin extendingloanfacilitiesto customers.

Commitmentsto makeloansaregenerallymadeforperiodsof 90 days or less.The fixedrateloan commitmentshave interestratesrangingfrom3.23% to 19.50% and maturitiesup to 2020. Variablerateloan commitmentshave interestratesrangingfrom2.45% to 8.25% and maturitiesup to 2040.

Note 16—Fair Value Measurement

Fairvalueistheexchangepricethatwould be receivedforan assetor paidto transfera liability(exit price)in theprincipalor mostadvantageousmarketfortheassetor liabilityin an orderlytransactionbetween marketparticipantson themeasurementdate.In addition,theCompany has theabilityto obtainfairvaluesfor marketsthatarenot accessible.

These typesof inputscreatethefollowingfairvaluehierarchy:

Level 1—Quoted pricesin activemarketsforidenticalassetsor liabilities.

Level 2—Quoted pricesforsimilarinstrumentsin activemarkets,quotedpricesforidenticalor similar instrumentsin marketsthatarenot activeand model-derivedvaluationswhose inputsareobservableor whose significantvaluedriversareobservable.

Level 3—Unobservableinputsthataresupportedby littleor no marketactivityand thataresignificant to thefairvalueof theassetor liability.Unobservableinputsareused to measurefairvalueto theextentthat observableinputsarenot available.The Company’sown dataused to developunobservableinputsmaybe adjustedformarketconsiderationswhen reasonablyavailable.

A financialinstrument’scategorizationwithinthevaluationhierarchyisbasedupon thelowestlevelof inputthatissignificantto thefairvaluemeasurement.The Company’sassessmentof thesignificanceof a particularinputto thefairvaluemeasurementin itsentiretyrequiresjudgment,and considersfactorsspecificto assetsand liabilities.

33

BYLINE BANCORP, INC. AND SUBSIDIARIES

NOTES TO CONSOLIDATED FINANCIAL STATEMENTS

(Table dollars in thousands, except share and per share data) (Unaudited)

The Company used thefollowingmethodsand significantassumptionsto estimatefairvalueforcertain assetsmeasuredand carriedatfairvalueon a recurringbasis:

Securitiesavailable-for-sale—The Company obtainsfairvaluemeasurementsfroman independent pricingservice.Managementreviewstheproceduresused by thethirdparty,includingsignificantinputsused in thefairvaluecalculations.The fairvaluemeasurementsconsiderobservabledatathatmayincludedealerquotes, marketspreads,cashflows,theU.S.Treasuryyieldcurve,livetradinglevels,tradeexecutiondata,market consensusprepaymentspeeds,creditinformationand thebond’stermsand conditions,amongotherthings.When marketquotesarenot readilyaccessibleor available,alternativeapproachesareutilized,such as matrixor model pricing.

The Company’smethodologyforpricingnon-ratedbonds focuseson threedistinctinputs:equivalent rating,yieldand otherpricingterms.To determinetheratingfora givennon-ratedmunicipalbond, theCompany referencesa publiclyissuedbond by thesameissuerifavailableas wellas otheradditionalkey metricsto supportthecreditworthiness.Typically,pricingforthesetypesof bonds would requirea higheryieldthana similarratedbond fromthesameissuer.A reductionin priceisappliedto theratingobtainedfromthe comparablebond, as theCompany believesifliquidated,a non-ratedbond would be valuedlessthana similar bond with a verifiablerating.The reductionappliedby theCompany isone notchlower(i.e.a “AA” ratingfora comparablebond would be reducedto “AA-” fortheCompany’svaluation).In 2017 and 2016, allof theratingsderivedby theCompany were “BBB”or betterwith and withoutcomparablebond proxies.The fairvaluemeasurementof municipalbonds issensitiveto theratinginput,as a higherratingtypicallyresultsin an increasedvaluation.The remainingpricinginputsused in thebond valuationareobservable.Based on theratingdetermined,the Company obtainsa correspondingcurrentmarketyieldcurveavailableto marketparticipants.Otherterms includingcoupon, maturitydate,redemptionprice,numberof coupon paymentsperyear,and accrualmethodare obtainedfromtheindividualbond termsheets.

Servicingassets—Fairvalueisbasedon a loan-by-loanbasistakingintoconsiderationtheoriginalterm to maturity,thecurrentage of theloanand theremainingtermto maturity.The valuationmethodologyutilized fortheservicingassetsbeginswith generatingfuturecashflowsforeachservicingasset,basedon theirunique characteristicsand market-basedassumptionsforprepaymentspeeds.The presentvalueof thefuturecashflows arethencalculatedutilizingmarket-baseddiscountrateassumptions.

Derivativeinstruments—Interestrateswaps arevaluedby a thirdparty,usingmodelsthatprimarily use marketobservableinputs,such as yieldcurves,and arevalidatedby comparisonwith valuationsprovidedby therespectivecounterparties.Derivativefinancialinstrumentsareincludedin otherassetsand otherliabilitiesin theConsolidatedStatementsof FinancialCondition.

34

BYLINE BANCORP, INC. AND SUBSIDIARIES

NOTES TO CONSOLIDATED FINANCIAL STATEMENTS

(Table dollars in thousands, except share and per share data) (Unaudited)

The followingtablessummarizetheCompany’sfinancialassetsand liabilitiesthatwere measuredatfair valueon a recurringbasisat September 30, 2017 and December 31, 2016:

			Fair Value Measurements Using
September 30, 2017	Fair Value		Level 1		Level 2		Level 3
Financial assets
Securities available-for-sale
U.S. Treasury Notes	$	14,925	$	14,925	$	—	$	—
U.S. Government agencies		53,219		—		53,219		—
Obligations of states, municipalities, and political    subdivisions		32,535		—		31,985		550
Mortgage-backed securities; residential
Agency		324,040		—		324,040		—
Non-Agency		25,470		—		25,470		—
Mortgage-backed securities; commercial
Agency		70,757		—		70,757		—
Non-Agency		31,257		—		31,257		—
Corporate securities		27,524		—		27,524		—
Other securities		4,957		1,938		2,480		539
Servicing assets		21,669		—		—		21,669
Derivative assets		3,913		—		3,913		—
Financial liabilities
Derivative liabilities		1,190		—		1,190		—

			Fair Value Measurements Using
December 31, 2016	Fair Value		Level 1		Level 2		Level 3
Financial assets
Securities available-for-sale
U.S. Treasury Notes	$	14,920	$	14,920	$	—	$	—
U.S. Government agencies		58,857		—		58,857		—
Obligations of states, municipalities, and political    subdivisions		16,059		—		15,509		550
Mortgage-backed securities; residential
Agency		368,160		—		368,160		—
Non-Agency		19,933		—		19,933		—
Mortgage-backed securities; commercial
Agency		77,403		—		77,403		—
Non-Agency		31,052		—		31,052		—
Corporate securities		17,329		—		17,329		—
Other securities		4,847		1,938		2,379		530
Servicing assets		21,091		—		—		21,091
Derivative assets		4,317		—		4,317		—
Financial liabilities
Derivative liabilities		559		—		559		—

During 2016, theCompany acquiredtheservicingassetsand single-issuertrustpreferredsecurities includedin othersecuritiescategorizedas Level3 of thefairvaluehierarchythrougha businesscombination.

In addition,during2016, theCompany purchasedprivately-issuedmunicipalsecuritiesthatare categorizedas Level3. These municipalsecuritiesarebonds issuedforone municipalgovernmententity locatedin theChicago metropolitan area and areprivatelyplaced,non-ratedbonds withoutCommittee on Uniform Security Identification Proceduresnumbers.

35

BYLINE BANCORP, INC. AND SUBSIDIARIES

NOTES TO CONSOLIDATED FINANCIAL STATEMENTS

(Table dollars in thousands, except share and per share data) (Unaudited)

The Company did not have any transfersbetweenLevel1 and Level2 of thefairvaluehierarchyduringthe nine months ended September 30, 2017 and 2016. The Company’spolicyfordeterminingtransfersbetweenlevelsoccursattheend of thereportingperiodwhen circumstancesin theunderlyingvaluationcriteriachangeand resultin transfer betweenlevels.

The following table presents additional information about financial assets measured at fair value on recurring basis for which the Company used significant unobservable inputs (Level 3):

	Nine Months Ended
	September 30,
	2017		2016		2017			2016
	Investment Securities				Servicing Assets
Balance, beginning of period	$	1,080	$	—	$	21,091		$	—
Additions, net		—		—		4,675			—
Amortization		3		—		—			—
Change in unrealized loss		6		—		—			—
Change in fair value		—		—		(4,097	)		—
Balance, end of period	$	1,089	$	—	$	21,669		$	—

The followingtablepresentsadditionalinformationabouttheunobservableinputsused in thefairvalue measurementson recurringbasisthatwere categorizedwithinLevel3 of thefairvaluehierarchyas of September 30, 2017:

Financial Instruments	Valuation Technique	Unobservable Inputs	Range of Inputs	Weighted Average Range			Impact to Valuation from an Increased or Higher Input Value
Obligations of states, municipalities,    and political obligations	Discountedcash flow	Probability of default	2.0%—2.4%		2.2	%	Decrease
Single issuer trust preferred	Discounted cash flow	Probability of default	7.5%—9.9%		8.9	%	Decrease
Servicing assets	Discounted cash flow	Prepayment speeds	1.7%—9.0%		7.6	%	Decrease
		Discount rate	9.1%—16.2%		12.8	%	Decrease
		Expected weighted average loan life	0.4—11.5 years	6.1 years			Increase

The Company used thefollowingmethodsand significantassumptionsto estimatefairvalueforcertain assetsmeasuredand carriedatfairvalueon a non-recurringbasis:

Impairedloans (excludingacquired impairedloans)—Impairedloans,otherthanthoseexistingon thedateof a businessacquisition,areprimarilycarriedatthefairvalueof theunderlyingcollateral,less estimatedcoststo sell,iftheloaniscollateraldependent.Valuationsof impairedloansthatarecollateral dependentaresupportedby thirdpartyappraisalsin accordancewith theBank’s creditpolicy.Impairedloansthatarenot collateraldependentarenot material.

Assetsheld forsale—Assetsheldforsaleconsistof formerbranchlocations,vacantland,and a house previouslypurchasedforexpansion.Assetsareconsideredheldforsalewhen managementhas approvedto sell theassetsfollowinga branchclosureor otherevents.The propertiesarebeingactivelymarketedand transferred to assetsheldforsalebasedon thelowerof carryingvalueor itsfairvalue,lessestimatedcoststo sell.

Otherrealestateowned—Certainassetsheldwithinotherrealestateowned representrealestateor othercollateralthathas been adjustedto itsestimatedfairvalue,lesscostto sell,as a resultof transferringfrom theloanportfolioatthetimeof foreclosureor repossessionand basedon management’speriodicimpairment evaluation.Fromtimeto time,non-recurring

36

BYLINE BANCORP, INC. AND SUBSIDIARIES

NOTES TO CONSOLIDATED FINANCIAL STATEMENTS

(Table dollars in thousands, except share and per share data) (Unaudited)

fairvalueadjustmentsto otherrealestateowned arerecordedto reflectpartialwrite-downsbasedon an observablemarketpriceor currentappraisedvalueof property.

Adjustmentsto fairvaluebasedon such non-recurringtransactionsgenerallyresultfromtheapplication of lower-of-cost-or-marketaccountingor write-downsof individualassetsdue to impairment.The following tablessummarizetheCompany’sassetsthatwere measuredatfairvalueon a non-recurringbasis,excluding acquiredimpairedloans,as of September 30, 2017 and December 31, 2016:

			Fair Value Measurements Using
September 30, 2017	Fair Value		Level 1		Level 2		Level 3
Non-recurring
Impaired loans
(excluding acquired impaired loans)
Commercial real estate	$	13,742	$	—	$	—	$	13,742
Residential real estate		1,772		—		—		1,772
Construction, land development, and other land		565		—		—		565
Commercial and industrial		4,490		—		—		4,490
Installment and other		-		—		—		-
Assets held for sale		12,938		—		—		12,938
Other real estate owned		13,859		—		—		13,859

			Fair Value Measurements Using
December 31, 2016	Fair Value		Level 1		Level 2		Level 3
Non-recurring
Impaired loans
(excluding acquired impaired loans)
Commercial real estate	$	8,916	$	—	$	—	$	8,916
Residential real estate		1,007		—		—		1,007
Construction, land development, and other land		—		—		—		—
Commercial and industrial		986		—		—		986
Installment and other		—		—		—		—
Assets held for sale		14,748		—		—		14,748
Other real estate owned		16,570		—		—		16,570

The followingtableprovidesa descriptionof thevaluationtechnique,unobservableinputsand qualitativeinformationabouttheCompany’sassetsand liabilitiesclassifiedas Level3 and measuredatfairvalue on a non-recurringbasisas of September 30, 2017:

Financial Instruments	Valuation Technique	Unobservable Inputs	Range of Inputs	Impact to Valuation from an Increased or Higher Input Value
Impaired loans (excluding    acquired impaired loans)	Appraisals	Appraisal adjustments, sales costs and other discount adjustments for market conditions	6% - 10%	Decrease
Assets held for sale	List price, contract price	Sales costs and other discount adjustments for market conditions	7%	Decrease
Other real estate owned	Appraisals	Appraisal adjustments, sales costs and other discount adjustments for market conditions	7% - 20%	Decrease

37

BYLINE BANCORP, INC. AND SUBSIDIARIES

NOTES TO CONSOLIDATED FINANCIAL STATEMENTS

(Table dollars in thousands, except share and per share data) (Unaudited)

The followingmethodsand assumptionswere used by theCompany in estimatingfairvaluesof other assetsand liabilitiesfordisclosurepurposes:

Cash and cash equivalents—For theseshort-terminstruments,thecarryingamountisa reasonable estimateof fairvalue.The fairvaluefortimecertificateswith otherbanks isbasedon themarketvaluesfor comparableinvestments.

Securitiesheld-to-maturity—The Company obtainsfairvaluemeasurementsfroman independent pricingservice.Managementreviewstheproceduresused by thethirdparty,includingsignificantinputsused in thefairvaluecalculations.The fairvaluemeasurementsconsiderobservabledatathatmayincludedealerquotes, marketspreads,cashflows,theU.S.Treasuryyieldcurve,livetradinglevels,tradeexecutiondata,market consensusprepaymentspeeds,creditinformationand thebond’stermsand conditions,amongotherthings.When marketquotesarenot readilyaccessibleor available,alternativeapproachesareutilized,such as matrixor model pricing.

Restrictedstock—The fairvaluehas been determinedto approximatecost.

Loans held forsale—The fairvalueof loansheldforsalearebasedon quotedmarketprices,where available,and determinedby discountedestimatedcashflowsusinginterestratesapproximatingtheCompany’s currentoriginationratesforsimilarloansadjustedto reflecttheinherentcreditrisk.

Loanand leasereceivables,net—For certainvariablerateloansthatrepricefrequentlyand with no significantchangesin creditrisk,fairvalueisestimatedatcarryingvalue.The fairvalueof othertypesof loansis estimatedby discountingfuturecashflows,usingcurrentratesatwhich similarloanswould be madeto borrowerswith similarcreditratingsand forthesameremainingmaturities.

Depositliabilities—The fairvalueof demanddeposits,savingsaccounts,and certainmoneymarket depositsistheamountpayableon demandatthereportingdate.The fairvalueof fixed-maturitycertificatesof depositisestimatedby discountingfuturecashflows,usingratescurrentlyofferedfordepositsof similar remainingmaturities.

FederalHomeLoanBankadvances—The fairvalueof FHLBadvancesisestimatedby discounting theagreementsbasedon maturitiesusingratescurrentlyofferedforFHLBadvancesof similarremaining maturitiesadjustedforprepaymentpenaltiesthatwould be incurrediftheborrowingswere paidoffon the measurementdate.

Securitiessold under agreementsto repurchase—The carryingamountapproximatesfairvaluedue to  maturitiesof lessthanninetydays.

Junior subordinated debentures—The fairvalueof juniorsubordinateddebentures,in theformof trustpreferredsecurities,isdeterminedusingratescurrentlyavailableto theCompany fordebtwith similarterms and remainingmaturities.

Accrued interestreceivableand payable—The carryingamountapproximatesfairvalue.

Commitmentsto extend creditand commercialand standby lettersof credit—The fairvaluesof theseoff-balancesheetcommitmentsto extendcreditand commercialand standbylettersof creditarenot consideredpracticableto estimatebecauseof thelackof quotedmarketpricesand theinabilityto estimatefair valuewithoutincurringexcessivecosts.

38

BYLINE BANCORP, INC. AND SUBSIDIARIES

NOTES TO CONSOLIDATED FINANCIAL STATEMENTS

(Table dollars in thousands, except share and per share data) (Unaudited)

The estimatedfairvaluesof financialinstrumentsand levelswithinthefairvaluehierarchyareas follows:

			September 30,				December 31,
	Fair Value		2017				2016
	Hierarchy Level		Carrying Amount		Estimated Fair Value		Carrying Amount		Estimated Fair Value
Financial assets
Cash and due from banks		1	$	16,193	$	16,193	$	17,735	$	17,735
Interest bearing deposits with other banks		2		46,043		46,043		28,798		28,798
Securities held-to-maturity		2		121,453		122,266		138,846		138,082
Other restricted stock		2		10,628		10,628		14,993		14,993
Loans held for sale		3		2,087		2,335		23,976		26,487
Loans and lease receivables, net		3		2,200,519		2,118,769		2,137,088		2,068,157
Accrued interest receivable		3		7,183		7,183		6,866		6,866
Financial liabilities
Non-interest bearing deposits		2		753,662		753,662		724,457		724,457
Interest bearing deposits		2		1,767,267		1,721,537		1,765,937		1,723,941
Accrued interest payable		2		1,184		1,184		2,427		2,427
Line of credit		2		-		-		20,650		20,650
Federal Home Loan Bank advances		2		234,559		234,543		313,715		313,646
Securities sold under repurchase agreement		2		30,807		30,807		17,249		17,249
Junior subordinated debentures		3		27,482		26,779		26,926		26,943

Note 17—Derivative Instruments and Hedge Activities

The Company recognizes derivative financial instruments at fair value regardless of the purpose or intent for holding the instrument. The Company records derivative assets and derivative liabilities on the Consolidated Statements of Financial Condition within accrued interest receivable and other assets and accrued interest payable and other liabilities, respectively. The following tables present the fair value of the Company’s derivative financial instruments and classification on the Consolidated Statements of Financial Condition as of September 30, 2017 and December 31, 2016:

	September 30, 2017						December 31, 2016
			Fair Value						Fair Value
	Notional Amount		Other Assets		Other Liabilities		Notional Amount		Other Assets		Other Liabilities
Derivatives designated as hedging instruments
Interest rate swaps designated as cash     flow hedges	$	250,000	$	3,265	$	545	$	100,000	$	3,719	$	—
Derivatives not designated as hedging instruments
Other interest rate swaps		81,712		648		645		51,213		598		559
Total derivatives	$	331,712	$	3,913	$	1,190	$	151,213	$	4,317	$	559

Interest rate swaps designated as cash flow hedges—Cash flow hedges of interest payments associated with certain FHLB advances had notional amounts totaling $250.0 million as of September 30, 2017. The aggregate fair value of the swaps is recorded in other assets or other liabilities with changes in fair value recorded in other comprehensive income (loss), net of taxes, to the extent effective. The amount included in accumulated other comprehensive income (loss) would be reclassified to current earnings when the hedged FHLB advances affect earnings. The Company assesses the effectiveness of each hedging relationship by comparing the changes in fair value of the derivative hedging instrument with the changes in fair value of the designated hedged transactions. The Company expects the hedges to remain highly effective during the remaining terms of the swaps and did not recognize any hedge ineffectiveness in current earnings during the three or nine months ended September 30, 2017 and 2016.

Interest expense recorded on these swap transactions totaled $159,000 and $426,000 during the three and nine months ended September 30, 2017, respectively, and is reported as a component of interest expense on FHLB advances.

39

BYLINE BANCORP, INC. AND SUBSIDIARIES

NOTES TO CONSOLIDATED FINANCIAL STATEMENTS

(Table dollars in thousands, except share and per share data) (Unaudited)

Interest expense recorded on swap transactions totaled $4,000 during the three and nine months ended September 30, 2016. At September 30, 2017, the Company estimates $249,000 of the unrealized gain to be reclassified as an increase to interest expense during the next twelve months.

The following table reflects the net gains (losses) recorded in accumulated other comprehensive income (loss) and the Consolidated Statements of Operations relating to the cash flow derivative instruments for the nine months ended September 30, 2017. 

	Amount of Gain Recognized in OCI (Effective Portion)			Amount of Loss Reclassified from OCI to Income as an Increase to Interest Expense			Amount of Gain (Loss) Recognized in Other Non-Interest Income (Ineffective Portion)
Interest rate swaps	$	(1,408	)	$	(426	)	$	—

Other interest rate swaps—The total combined notional amount was $81.7 million with maturities ranged from January 2020 to August 2027. The fair values of the interest rate swap agreements are reflected in other assets and other liabilities with corresponding gains or losses reflected in non-interest income. During the three and nine months ended September 30, 2017, transaction fees related to these derivative instruments were $40,000 and $219,000, respectively. During the three and nine months ended September 30, 2016, transaction fees were $191,000 and $580,000, respectively.

The following table reflects other interest rate swaps as of September 30, 2017:

Notional amounts	$	81,712
Derivative assets fair value		648
Derivative liabilities fair value		645
Weighted average pay rates		4.26	%
Weighted average receive rates		3.68	%
Weighted average maturity	6.1 years

Credit risk—Derivative instruments are inherently subject to market risk and credit risk. Market risk is associated with changes in interest rates and credit risk relates to the Company’s risk of loss when the counterparty to a derivative contract fails to perform according to the terms of the agreement. Market and credit risks are managed and monitored as part of the Company’s overall asset-liability management process. The credit risk related to derivatives entered into with certain qualified borrowers is managed through the Company’s loan underwriting process. The Company’s loan underwriting process also approves the Bank’s swap counterparty used to mirror the borrowers’ swap. The Company has a bilateral agreement with each swap counterparty that provides that fluctuations in derivative values are to be fully collateralized with either cash or securities. The credit valuation adjustment (“CVA”) is a fair value adjustment to the derivative to account for this risk. During the three and nine months ended September 30, 2017, the CVA resulted in a decrease to non-interest income of $6,000 and $36,000, respectively. During the three and nine months ended September 30, 2016, the CVA resulted in a decrease to non-interest income of $14,000 and $51,000, respectively.

The Company has agreements with its derivative counterparties that contain a cross-default provision under which if the Company defaults on any of its indebtedness, including default where repayment of the indebtedness has not been accelerated by the lender, then the Company could also be declared in default on its derivative obligations. The Company also has agreements with certain derivative counterparties that contain a provision where if the Company fails to maintain its status as a well or adequately capitalized institution, then the counterparty could terminate the derivative positions and the Company would be required to settle its obligations resulted in a net asset position.

The Company records interest rate derivatives subject to master netting agreements at their gross value and does not offset derivative asset and liabilities on the Consolidated Statements of Financial Condition. The table below summarizes the Company’s interest rate derivatives and offsetting positions as of September 30, 2017: 

40

BYLINE BANCORP, INC. AND SUBSIDIARIES

NOTES TO CONSOLIDATED FINANCIAL STATEMENTS

(Table dollars in thousands, except share and per share data) (Unaudited)

	Derivative Assets Fair Value			Derivative Liabilities Fair Value
Gross amounts recognized	$	3,913		$	1,190
Less: Amounts offset in the Consolidated Statements of Financial Condition		—			—
Net amount presented in the Consolidated Statements of Financial Condition	$	3,913		$	1,190
Gross amounts not offset in the Consolidated Statements of Financial Condition
Offsetting derivative positions		(677	)		(677	)
Collateral posted		(2,949	)		(502	)
Net credit exposure	$	287		$	11

Note 18 – Share-Based Compensation

In June 2017, the Company adopted the 2017 Omnibus Incentive Compensation Plan (the “Omnibus Plan”) in connection with our initial public offering (“IPO”).  The Omnibus Plan provides for the grant of stock options, stock appreciation rights, restricted stock, restricted stock units, dividend equivalent rights and other equity-based, equity-related or cash-based awards.  A total of 1,550,000 shares of our common stock have been reserved and are available for issuance under the Omnibus Plan.

On July 6, 2017, in conjunction with the completion of the IPO, the Company granted 58,900 restricted shares of the Company’s voting common stock, par value of $0.01 per share, to certain key employees, pursuant to the Omnibus Plan.  The restricted shares will cliff vest on the third anniversary of the grant date, subject to continued employment.  Subsequent to the grant date, 400 restricted shares were forfeited.  As of September 30, 2017, there were 1,491,500 shares available for future grants under the Omnibus Plan.

The following table discloses the changes in restricted shares for the nine months ended September 30, 2017:

	Omnibus Plan
	Number of Shares			Weighted Average Grant Date Fair Value
Beginning balance		—		$	—
Granted		58,900		$	20.18
Vested		—		$	—
Forfeited		(400	)	$	20.18
Ending balance outstanding at September 30, 2017		58,500		$	20.18

No restricted shares vested during the nine months ended September 30, 2017.  

The Company recognizes share-based compensation based on the estimated fair value of the restricted stock at the grant date. Share-based compensation expense is included in non-interest expense in the Consolidated Statements of Operations. No restricted shares were outstanding in 2016.

  The following table summarizes restricted stock compensation expense for the nine months ended September 30, 2017:

41

BYLINE BANCORP, INC. AND SUBSIDIARIES

NOTES TO CONSOLIDATED FINANCIAL STATEMENTS

(Table dollars in thousands, except share and per share data) (Unaudited)

	Nine Months Ended September 30,
	2017
Total share-based compensation - restricted stock	$	94
Income tax benefit		38
Unrecognized compensation expense		1,087
Weighted-average amortization period remaining		2.8 years

In October 2017, the Company granted 7,500 restricted shares of the Company’s voting common stock, par value $0.01 per share, under the Omnibus Plan.  These restricted shares will vest ratably over four years on each anniversary of the grant date, subject to continued employment.

The Company maintained a nonqualified, share-based, stock option plan adopted prior to recapitalization (“MBG Plan”). There were no options granted or exercised under this plan during the year ended December 31, 2016 or for the nine months ended September 30, 2017.  At the time of the Company’s reincorporation in Delaware, in June 2017, the Board of Directors cancelled the MBG Plan and all outstanding options were cancelled.

In October 2014, the Company adopted the Byline Bancorp, Inc. Equity Incentive Plan (“BYB Plan”). The maximum number of shares available for grants under this Plan was 2,476,122 shares. During 2016 and 2015, the Company granted options to purchase  212,400 and 1,634,568 shares, respectively, under this plan. The Company did not grant any stock options during the nine months ended September 30, 2017.  In June 2017, the Board of Directors terminated the BYB Plan and no future grants can be made under this plan.  Options to purchase a total of 1,798,220 shares remain outstanding under the BYB Plan.

The types of stock options granted under the BYB Plan were Time Options and Performance Options. The exercise price of each option is equal to the fair value of the stock as of the date of grant. These option awards have vesting periods ranging from 1 to 5 years and have 10-year contractual terms. Stock volatility was computed as the average of the volatilities of peer group companies.  

The vesting of Time Options is conditional based on completion of service. Performance Options have conditional vesting based on either performance targets or market performance. Certain Performance Options’ performance goals will be satisfied (in whole or in part) if the Bank achieves various performance targets such as profitability, asset quality, and conditional based on market performance, as outlined in the BYB Plan. Each of the performance goals identified are measured for achievement (or failure to achieve) independent of each other. In October 2017, the Board of Directors determined that the Performance Option goals were satisfied, in whole, and these Performance Options converted to Time Options.  As a result of the previous completion of service, 414,894 performance options vested on October 3, 2017.

The fair values of the stock options were determined using the Black-Scholes-Merton model for Time Options and a Monte Carlo simulation model for Performance Options. The fair values of options under the BYB Plan were determined using the following assumptions as of the grant dates:

	Time Options Grants
	2016			2015
Risk-free interest rate	1.34% - 1.40%			1.68% - 1.85%
Expected term (years)	5.2 - 5.6			5.7 - 6.3
Expected stock price volatility		20.39	%	16.18%-16.55%
Expected dividend yield		0.00	%		0.00	%
Weighted average grant date fair value	$	3.55		$	2.25

42

BYLINE BANCORP, INC. AND SUBSIDIARIES

NOTES TO CONSOLIDATED FINANCIAL STATEMENTS

(Table dollars in thousands, except share and per share data) (Unaudited)

	Performance Options Grants
	2016			2015
Risk-free interest rate	Implied forward rates			Implied forward rates
Expected term (years)	Variable			Variable
Expected stock price volatility	20.34% - 20.39%			16.18%-16.55%
Expected dividend yield		0.00	%		0.00	%
Weighted average grant date fair value	$	3.75		$	1.65

The following table discloses the activity in shares subject to options and the weighted average exercise prices, in actual dollars, for the nine months ended September 30, 2017:

	BYB Plan
	Number of Shares		Weighted Average Exercise Price		Intrinsic Value		Weighted Average Remaining Contractual Term (in Years)
Beginning balance		1,798,220	$	11.95	$	15,788		9.8
Granted		—
Expired		—
Exercised		—
Forfeited		—
Ending balance outstanding at September 30, 2017		1,798,220	$	11.95	$	16,545		7.9
Exercisable at September 30, 2017		835,263	$	11.31	$	8,310		7.7

There were no stock options exercised during the nine months ended September 30, 2017.  The total fair value of stock options vested during the nine months ended September 30, 2017 was $477,000.

The Company recognizes share-based compensation based on the estimated fair value of the option at the grant date. Forfeitures are estimated based upon industry standards. Share-based compensation expense is included in non-interest expense in the Consolidated Statements of Operations. The following table summarizes stock option compensation expense for the nine months ended September 30, 2017 and 2016:

	Nine Months Ended September 30,
	2017		2016
Total share-based compensation – stock options	$	857	$	553
Income tax benefit		348		—
Unrecognized compensation expense		1,074		1,431
Weighted-average amortization period remaining		1.2 years		2.0 years

Note 19—Earnings per Share

A reconciliation of the numerators and denominators for earnings per common share computations is presented below. Incremental shares represent outstanding stock options for which the exercise price is less than the average market price of the Company’s common stock during the periods presented. Options to purchase 1,798,223 shares of common stock were outstanding as of September 30, 2017 and 2016. There were 58,500 restricted stock awards outstanding at September 30, 2017.  There were no restricted stock awards outstanding at September 30, 2016.

43

BYLINE BANCORP, INC. AND SUBSIDIARIES

NOTES TO CONSOLIDATED FINANCIAL STATEMENTS

(Table dollars in thousands, except share and per share data) (Unaudited)

The following represent the calculation of basic and diluted earnings per share:

	Three Months Ended September 30,				Nine Months Ended September 30,
	2017		2016		2017		2016
Net income	$	9,755	$	1,565	$	22,461	$	2,814
Less: Dividends on preferred shares		195		—		11,081		—
Net income available to common stockholders	$	9,560	$	1,565	$	11,380	$	2,814
Weighted-average common stock outstanding:
Weighted-average common stock outstanding (basic)		29,246,900		19,497,811		26,194,025		18,838,354
Incremental shares		505,431		265,623		503,816		265,623
Weighted-average common stock outstanding (dilutive)		29,752,331		19,763,434		26,697,841		19,103,977
Basic earnings per common share	$	0.33	$	0.08	$	0.43	$	0.15
Diluted earnings per common share	$	0.32	$	0.08	$	0.43	$	0.15

Note 20—Stockholders’ Equity

A summary of the Company’s preferred and common stock at September 30, 2017 and December 31, 2016 is as follows:

	September 30,		December 31,
	2017		2016
Series A non-cumulative perpetual preferred stock
Par value	$	0.01	$	0.01
Shares authorized	15,003			15,003
Shares issued	—			15,003
Shares outstanding	—			15,003
Series B 7.5% fixed non-cumulative perpetual    preferred stock
Par value	$	0.01	$	0.01
Shares authorized		50,000		50,000
Shares issued		10,438		9,388
Subscription receivable		—		1,050
Shares outstanding		10,438		9,388
Common stock, voting
Par value	$	0.01	$	—
Shares authorized		150,000,000		150,000,000
Shares issued		29,305,400		24,616,706
Shares outstanding		29,305,400		24,616,706

During 2016, the Company authorized and issued Series B 7.50% fixed-to-floating non-voting, noncumulative perpetual preferred stock with a liquidation preference of $1,000 per share, plus the amount of unpaid dividends, if any, which is redeemable at the Company’s option on or after March 31, 2022. Holders of either Series A or Series B preferred stock do not have any rights to convert such stock into shares of any other class of capital stock of the Company.

On January 30, 2017, the Company issued an additional 1,050 shares of Series B preferred stock, which is reflected as a subscription receivable as of December 31, 2016. For the nine months ended September 30, 2017, the Company declared and paid dividends on the Series B preferred stock of $580,000.

On May 31, 2017, the Company filed a registration statement on Form S-1with the SEC in connection with its initial public offering (the ”Registration Statement”), which was subsequently amended on June 19, 2017. The Registration Statement was declared effective by the SEC on June 29, 2017. In connection with the IPO, the Company issued 4,630,194 shares of common stock, par value $0.01 per share, which included 855,000 shares sold pursuant to the underwriters’ exercise of their option to purchase additional shares. The securities were sold at a price to the public of $19.00 per share and

44

BYLINE BANCORP, INC. AND SUBSIDIARIES

NOTES TO CONSOLIDATED FINANCIAL STATEMENTS

(Table dollars in thousands, except share and per share data) (Unaudited)

began trading on the New York Stock Exchange on June 30, 2017.  On July 6, 2017, the closing date of the IPO, the Company received net proceeds of $82.7 million.

On June 14, 2017, the Company’s stockholders approved the reincorporation of the Company to a Delaware corporation. Under the terms of the merger agreement, the Company reincorporated from Illinois to Delaware by merging with and into Byline Bancorp, Inc. Delaware (“Byline Delaware”), with Byline Delaware surviving (such transaction, the “Merger”).  Each share of Company common stock issued and outstanding immediately prior to the effective time of the Merger, was converted automatically into the right to receive one fifth (0.20) of a share of common stock of Byline Delaware.  There were no fractional shares issued in connection with the Merger.   The reincorporation and share conversion are retrospectively reflected in the consolidated financial statements.

On June 16, 2017, after obtaining the necessary approval from the Federal Reserve, the Board of Directors of Byline Delaware unanimously approved the repurchase of all of the Company’s outstanding Series A preferred stock at a purchase price per share representing a liquidation value of $1,000 per share, equal to the cash value of (i) 89.469 shares of the Company’s common stock, multiplied by (ii) the initial public offering price of the common stock of $19.00 per share.  On July 14, 2017, the Company completed the repurchase of all of the Series A Preferred Stock for $25.5 million. The $10.5 million excess of the purchase price over the carrying value of the Series A was recorded as a dividend.

45

Item 2.Management’s Discussion and Analysis of Financial Condition and Results of Operations

The following is a discussion and analysis of Byline Bancorp, Inc.’s financial condition and results of operations and should be read in conjunction with our consolidated financial statements and notes thereto included elsewhere in this report. The words “the Company,” “we,” “our” and “us” refer to Byline Bancorp, Inc. and its consolidated subsidiaries, unless we indicate otherwise.

Overview

Our business

We are a bank holding company headquartered in Chicago, Illinois and conduct all our business activities through our subsidiary, Byline Bank, a full service commercial bank, and Byline Bank’s subsidiaries. Through Byline Bank, we offer a broad range of banking products and services to small and medium sized businesses, commercial real estate and financial sponsors and to consumers who generally live or work near our branches. In addition to our core commercial banking products, we provide small ticket equipment leasing solutions through Byline Financial Group, a wholly-owned subsidiary of Byline Bank, headquartered in Bannockburn, Illinois with sales offices in Texas, North Carolina, Florida, New York, Michigan and Arizona. Following our acquisition of Ridgestone Financial Services, Inc. (“Ridgestone”) in October 2016, we also participate in U.S. government guaranteed lending programs and originate U.S. government guaranteed loans. Byline Bank was the eighth most active originator of Small Business Administration (“SBA”) loans in the country and the most active SBA lender in Illinois and Wisconsin, as reported by the SBA for the year ended September 30, 2017.

We offer traditional retail deposit products through our branch network, along with online, mobile and direct banking channels. The wide variety of deposit products we offer include non-interest bearing accounts, interest-bearing demand products, savings accounts, money market accounts and certificates of deposit with original maturities ranging from seven days to five years. We also offer consumer lending products, including mortgage loans, home equity loans and other consumer loans to individuals through our branch network.

Recapitalization

In 2013, our predecessor, Metropolitan Bank Group (“Metropolitan”), experienced significant credit and financial losses resulting primarily from the collapse of real estate prices during the severe economic recession occurring during 2007 through 2009, in addition to a number of regulatory and other operational challenges. Despite deterioration in asset quality and financial performance, Metropolitan maintained a high quality deposit base, an attractive branch network and strong customer loyalty, which made it an ideal candidate for a turnaround.

An investment group raised $206.7 million in equity capital to recapitalize and gain control of Metropolitan through a series of transactions by which Metropolitan merged its multiple subsidiary banks into one and an investor group acquired voting common stock and Series A Preferred Stock of Metropolitan.

We accounted for the Recapitalization as a business combination in accordance with Accounting Standards Codification Topic 805, Business Combinations (“Topic 805”). The transaction qualified as a recapitalization under Section 368(a)(1)(E) of the Internal Revenue Code (the “Code”) and resulted in carryover treatment of the existing tax bases and tax loss carryforwards treatment of the existing tax bases and tax loss carryforwards, although the utilization of tax attributes (including net operating loss carryforwards and tax credits) became subject to limitations under Sections 382 and 383 of the Code. Accordingly, the assets acquired and liabilities assumed were recorded at their fair value on the date of acquisition. Fair value amounts were determined in accordance with the guidance provided in ASC Topic 820, Fair Value Measurements (“Topic 820”). In many cases, the determination of the fair value required management to make estimates about discount rates, future expected cash flows, market conditions and other future events that are highly subjective in nature.

As of the Recapitalization, which occurred on June 28, 2013, we had $2.5 billion in assets that were measured at fair value, including $1.3 billion in loans, $212.2 million in investment securities, $84.0 million of OREO and $29.7 million of core deposit intangible assets. We also acquired $2.3 billion of liabilities at fair value, including $2.2 billion of deposits and $36.9 million of borrowings. The Recapitalization resulted in goodwill of $21.2 million as the estimated fair value of liabilities assumed and consideration paid exceeded the estimated fair value of assets acquired. The goodwill is included within “Goodwill” in our consolidated statement of condition.

46

As of the Recapitalization, approximately 76.5%, or $1.0 billion, of the loans acquired in the Recapitalization were accounted for under ASC Topic 310-30, Accounting for Purchased Loans with Deteriorated Credit Quality. We also acquired loans with a fair value of $310.3 million that are accounted for under ASC Topic 310-20, Receivables—Nonrefundable Fees and Other Costs, as these specific loans did not exhibit deteriorated credit quality since origination or were loans to borrowers that had revolving privileges at the acquisition date.

Since the Recapitalization, we have added $1.5 billion in net originated loans and leases while significantly improving our asset quality to create a more diversified and balanced loan and lease portfolio. We aggressively reduced the level of non-performing loans and leases and other real estate owned in our portfolio as a percentage of loans and leases and real estate owned, declining to 1.4% as of September 30, 2017 and 1.1% as of December 31, 2016 from 28.2% as of March 31, 2013. In addition, we sought to optimize our deposit base by expanding the percentage of non-interest bearing deposits to total deposits, enhance online and mobile capabilities and broaden our cash management products to better meet our customers’ needs. Since the Recapitalization, we consolidated from 88 to 57 branches, reducing our costs with minimal deposit attrition, and improving our efficiency, including through the consolidation of multiple banking platforms into one. In addition to improving efficiency, consolidating our banking platforms allowed us to better manage our customer relationships and their banking activities while strengthening our governance and controls for compliance, legal and operational risk.

Small Ticket Leasing Acquisition

On October 10, 2014, Byline Bank acquired certain assets and liabilities related to the small ticket leasing operation of Baytree National Bank and Trust Company and Baytree Leasing Company LLC (collectively, “Baytree”). The purchase was accounted for under the acquisition method of accounting in accordance with ASC Topic 805 and resulted in lease financing receivables of $42.0 million and goodwill of $4.5 million. There are no contingent assets or liabilities remaining from the acquisition.

In a separate but related transaction, on September 3, 2014, Byline Bank purchased approximately $55.7 million of direct finance leases that Baytree had sold to a third party. We have grown our leasing portfolio to $172.3 million as of September 30, 2017.

Ridgestone Acquisition

On October 14, 2016, we completed the Ridgestone acquisition under the terms of a definitive merger agreement (the “Ridgestone Agreement”). As of the acquisition date, Ridgestone had $447.4 million in assets, including $347.3 million of loans, $14.7 million of loans held for sale, $27.2 million of securities, $21.5 million of servicing assets and total deposits of $358.7 million. Ridgestone’s loan portfolio was primarily comprised of the retained unguaranteed portion of U.S. government guaranteed loans as a participant in the SBA and USDA lending programs. 

As a result of the acquisition, each share of Ridgestone common stock was converted into the right to receive, at the election of the shareholder and subject to proration under the terms of the Ridgestone Agreement, either cash or shares of our common stock, or a combination of both. Total consideration included aggregate cash consideration in the amount of $36.8 million and the issuance of 4,199,791 shares of our common stock valued at $16.25 per common share. There were no contingent assets or liabilities arising from the acquisition.

As a result of the Ridgestone acquisition, we:

• Grew consolidated total assets from $2.8 billion to $3.3 billion as of October 14, 2016, after giving effect to acquisition accounting adjustments;

• Increased total loans from $1.7 billion to $2.1 billion as of October 14, 2016;

• Increased total deposits from $2.2 billion to $2.6 billion as of October 14, 2016;

• Expanded our employee base from 684 full time equivalent employees to 834 full time equivalent employees as of October 14, 2016; and

• Expanded our footprint through the addition of two full-service banking offices in Brookfield, Wisconsin, and Schaumburg, Illinois. In addition, Ridgestone had loan production offices located in Wisconsin (Green Bay and Wausau), Indiana (Indianapolis) and California (Newport Beach) where we continue to operate.

47

We determined that the Ridgestone acquisition constituted a business combination as defined by ASC Topic 805. Accordingly, the assets acquired and liabilities assumed were recorded at their fair value amount on the date of acquisition. Fair values were determined in accordance with the guidance provided in ASC Topic 820. The fair values may be adjusted through the end of the measurement period, which closes at the earlier of the Company receiving all necessary information to complete the acquisition or one year from the date of acquisition.

Strategic Branch Consolidation

During 2015 and 2016, we performed a strategic review of our existing core banking footprint. With technology improvements and changes to customers’ banking preferences, we examined branch growth potential, customer usage, branch profitability, services provided, markets served and proximity to other locations with a goal of minimizing customer impact and deposit runoff. Since the Recapitalization, our branch network has been reduced from 88 to 57. We will continue to strategically evaluate our locations based on our growth and profitability standards.

Our Initial Public Offering

On June 29, 2017, we commenced our initial public offering (the “IPO”) whereby we sold 4,630,194 shares of our common stock at a price to the public of $19.00 per share, resulting in net proceeds to us of $76.8 million after deducting offering related commissions and expenses. In addition, certain selling stockholders participated in the offering and sold an aggregate of 1,924,806 shares of our common stock at the same price per share. Our common stock is currently traded on the New York Stock Exchange under the symbol “BY”. We believe that the capital raised through our IPO will allow us to continue to grow our franchise and increase our market share among small businesses and middle-market companies in the markets we serve.

Critical Accounting Policies and Significant Estimates

Our accounting and reporting policies conform to GAAP and conform to general practices within the industry in which we operate. To prepare financial statements in conformity with GAAP, management makes estimates, assumptions and judgments based on available information. These estimates, assumptions and judgments affect the amounts reported in the financial statements and accompanying notes. These estimates, assumptions and judgements are based on information available as of the date of the financial statements and, as this information changes, actual results could differ from the estimates, assumptions and judgments reflected in the financial statements. In particular, management has identified several accounting policies that, due to the estimates, assumptions and judgements inherent in those policies, are critical in understanding our financial statements.

These policies include (i) acquisition-related fair value computations, (ii) the carrying value of loans and leases, (iii) determining the provision and allowance for loan and lease losses, (iv) the valuation of intangible assets such as goodwill, servicing assets and core deposit intangibles, (v) the determination of fair value for financial instruments, including Other Than Temporary Impairment (“OTTI”) losses, (vi) the valuation of real estate held for sale and (vii) the valuation of or recognition of deferred tax assets and liabilities.

The Jumpstart Our Business Startups Act of 2012, or the JOBS Act, permits us an extended transition period for complying with new or revised accounting standards affecting public companies. We have elected to take advantage of this extended transition period, which means that the financial statements included in this report, as well as any financial statements that we file in the future, will not be subject to all new or revised accounting standards generally applicable to public companies for the transition period for so long as we remain an emerging growth company or until we affirmatively and irrevocably opt out of the extended transition period under the JOBS Act.

The following is a discussion of the critical accounting policies and significant estimates that require us to make complex and subjective judgments. Additional information about these policies can be found in Note 1 of Byline’s Consolidated Financial Statements as of December 31, 2016 and 2015, included in our prospectus in connection with our initial public offering that we filed with the SEC on July 3, 2017.

48

Business Combinations

We account for business combinations under the acquisition method of accounting in accordance with ASC Topic 805. We recognize the fair value of the assets acquired and liabilities assumed as of the date of acquisition, with any excess of the fair value of consideration provided over the fair value of the identifiable net tangible and intangible assets acquired recorded as goodwill. Transaction costs are expensed as incurred. Application of the acquisition method requires extensive use of accounting estimates and judgements to determine the fair values of the identifiable assets acquired and liabilities assumed at the acquisition date.

In accordance with ASC Topic 805, the acquiring company retains the right to make appropriate adjustments to the assets and liabilities of the acquired entity for information obtained during the measurement period about facts and circumstances that existed as of the acquisition date. The measurement period ends as of the earlier of (i) one year from the acquisition date or (ii) the date when the acquirer receives the information necessary to complete the business combination accounting.

Carrying Value of Loans and Leases

Our accounting methods for loans and leases differ depending on whether the loans and leases are new loans and leases, or acquired loans and leases; and for acquired loans, whether the loans were acquired at a discount as a result of credit deterioration since the date of origination.

Originated Loans and Leases

We account for originated loans and leases and purchased loans and leases not acquired through business combinations as originated loans. The new loans that management has the intent and ability to hold for the foreseeable future are reported at their outstanding principal balances net of any allowance for loan and lease losses, unamortized deferred fees and costs and unamortized premiums or discounts. The net amount of nonrefundable loan origination fees and certain direct costs associated with the lending process are deferred and amortized to interest income over the contractual lives of the new loans using methods which approximate the level yield method. Discounts and premiums are amortized or accreted to interest income over the estimated term of the new loans using methods that approximate the effective yield method. Interest income on new loans is accrued based on the unpaid principal balance outstanding.

Acquired Loans and Leases

Acquired loans and leases are recorded at fair value as of the acquisition date. Credit discounts are included in the determination of fair value; therefore, an allowance for loan and lease losses is not recorded at the acquisition date. Acquired loans are evaluated upon acquisition and classified as either acquired impaired or acquired non-impaired. Acquired impaired loans reflect evidence of credit deterioration since origination for which it is probable that all contractually required principal and interest will not be collected by us. Subsequent to acquisition, we periodically update for changes in cash flow expectations, and is reflected in interest income over the life of the loan as accretable yield. Any subsequent decreases in expected cash flow attributable to credit deterioration are recognized by recording a provision for loan and lease losses.

For acquired non-impaired loans and leases, the excess or deficit of the loan or lease principal balance over the fair value is recorded as a discount or premium at acquisition and is accreted through interest income over the life of the loan or lease. Subsequent to acquisition, these loans and leases are evaluated for credit deterioration and a provision for loan and lease losses would be recorded when probable loss is incurred. These loans and leases are evaluated for impairment consistent with originated loans and leases.

Provision and Allowance for Loan and Lease Losses

The provision for loan and lease losses reflects the amount required to maintain the allowance for loan and lease losses (“ALLL”) at an appropriate level based upon management’s evaluation of the adequacy of general and specific loss reserves.

The ALLL is maintained at a level that management believes is appropriate to provide for known and inherent incurred loan and lease losses as of the date of the Consolidated Statements of Financial Condition and we have established methodologies for the determination of its adequacy. The methodologies are set forth in a formal policy and take into consideration the need for an overall general valuation allowance as well as specific allowances that are determined on an

49

individual loan basis. We increase our ALLL by charging provisions for probable losses against our income and it is decreased by charge-offs, net of recoveries.

The evaluation is inherently subjective, as it requires estimates that are susceptible to significant revision as more information becomes available. While management uses available information to recognize losses on loans and leases, changes in economic or other conditions may necessitate revision of the estimate in future periods.

The ALLL is maintained at a level management believes is sufficient to provide for probable losses based upon an ongoing review of the originated and acquired non-impaired loan and lease portfolios by portfolio category, which include consideration of actual loss experience, peer loss experience, changes in the size and risk profile of the portfolio, identification of individual problem loan and lease situations which may affect a borrower’s ability to repay, and evaluation of prevailing economic conditions.

For acquired impaired loans, a specific valuation allowance is established when it is probable that we will be unable to collect all of the cash flows expected at acquisition, plus the additional cash flows expected to be collected arising from changes in estimates after acquisition.

The originated and acquired non-impaired loans have limited delinquency and credit loss history and have not yet exhibited an observable loss trend. The credit quality of loans in these loan portfolios are impacted by delinquency status and debt service coverage generated by the borrowers’ businesses and fluctuations in the value of real estate collateral.

Acquired non-impaired loans and originated loans are considered impaired when, based on current information and events, it is probable that we will be unable to collect the scheduled payments of principal or interest when due, according to the contractual terms of the loan agreements. All acquired non-impaired loans and originated loans of $250,000 or greater with an internal risk rating of substandard or below and on non-accrual, as well as loans classified as TDR, are reviewed individually for impairment on a quarterly basis.

Goodwill and Intangible Assets

Goodwill

Goodwill represents the excess of the purchase consideration over the fair value of net assets acquired in connection with the Recapitalization and acquisitions using the acquisition method of accounting. Goodwill is not amortized but is periodically evaluated for impairment under the provisions of ASC Topic 350, Intangibles—Goodwill and Other (“ASC Topic 350”).

Impairment testing is performed by comparing the carrying value of the reporting unit with the fair value of the reporting unit. Our goodwill is allocated to Byline Bank, which is our only applicable reporting unit for the purposes of testing goodwill for impairment. We have selected November 30 as the date to perform the annual goodwill impairment test. Additionally, we perform a goodwill impairment evaluation on an interim basis when events or circumstances indicate impairment potentially exists.

Servicing Assets

Servicing assets are recognized separately when they are acquired through sales of loans or when the rights to service loans are purchased. When loans are sold, servicing assets are recorded at fair value in accordance with ASC Topic 860, Transfers and Servicing (“ASC Topic 860”). Fair value is based on market prices for comparable servicing contracts, when available, or alternatively, is based on a valuation model that calculates the present value of estimated future net servicing income. The fair value of servicing rights is highly sensitive to changes in underlying assumptions. Changes in the prepayment speed and discount rate assumptions have the most significant impact on the fair value of servicing rights. See Note 7 and Note 16 of our Unaudited Interim Condensed Consolidated Financial Statements as of September 30, 2017, included in this report, for additional information.

Core Deposit Intangible

Other intangible assets primarily consist of core deposit intangible assets. In valuing core deposit intangibles, we consider variables such as deposit servicing costs, attrition rates and market discount rates. Core deposit intangibles are reviewed annually or more frequently, when events or changes in circumstances occur that indicate that their carrying values

50

may not be recoverable. If the recoverable amount of the core deposit intangibles is determined to be less than its carrying value, we then measure the amount of impairment based on an estimate of the fair value at that time. We also evaluate whether the events or circumstances have occurred that warrant a revision to the remaining useful lives of intangible assets. In cases where a revision is deemed appropriate, the remaining carrying amounts of the intangible assets are amortized over the revised remaining useful life. Core deposit intangibles are currently amortized over a ten year period.

Fair value of Financial Instruments

ASC Topic 820, Fair Value Measurement defines fair value as the price that would be received to sell a financial asset or paid to transfer a financial liability in an orderly transaction between market participants at the measurement date.

The degree of management judgment involved in determining the fair value of assets and liabilities is dependent upon the availability of quoted market prices or observable market parameters. For financial instruments that trade actively and have quoted market prices or observable market parameters, there is minimal subjectivity involved in measuring fair value. When observable market prices and parameters are not available, management judgment is necessary to estimate fair value. In addition, changes in market conditions may reduce the availability of quoted prices or observable data. For example, reduced liquidity in the capital markets or changes in secondary market activities could result in observable market inputs becoming unavailable. Therefore, when market data is not available, we would use valuation techniques requiring more management judgment to estimate the appropriate fair value measurement.

See Note 18 of Byline’s Consolidated Financial Statements as of December 31, 2016 and 2015, included in our prospectus in connection with our initial public offering that we filed with the SEC on July 3, 2017, for a complete discussion of our use of fair value of financial assets and liabilities and their related measurement practices.

Valuation of Real Estate Held for Sale

Other Real Estate Owned (OREO)

OREO includes real estate assets that have been acquired through, or in lieu of, loan foreclosure or repossession and are to be sold. OREO assets are initially recorded at fair value, less estimated costs to sell, of the collateral of the loan, on the date of foreclosure or repossession, establishing a new cost basis. Adjustments that reduce loan balances to fair value at the time of foreclosure or repossession are recognized as charge-offs in the allowance for loan and lease losses. Positive adjustments, if any, at the time of foreclosure or repossession are recognized, as a reduction, in non-interest expense. After foreclosure or repossession, management periodically obtains new valuations and real estate or other assets may be adjusted to a lower carrying amount, determined by the fair value of the asset, less estimated costs to sell. Any subsequent write-downs are recorded as a decrease in the asset and charged against other real estate owned valuation adjustments. Operating expenses of such properties, net of related income, are included in non-interest expense, and gains and losses on their disposition are included in non-interest expense. Gains on internally financed other real estate owned sales are accounted for in accordance with the methods stated in ASC Topic 360-20, Real Estate Sales (“ASC Topic 360-20”). Any losses on the sales of other real estate owned properties are recognized immediately.

Assets Held for Sale

Assets held for sale consist of former branch locations and real estate purchased for expansion. Assets are considered held for sale when management has approved a plan to sell the assets following a branch closure or other events. The properties are being actively marketed and transferred to assets held for sale based at the lower of its carrying value or its fair value, less estimated costs to sell. Adjustments to reduce the asset balances to fair value are recorded at the time of transfer and are recognized through a charge to non-interest expense.

Income Taxes

We use the asset and liability method to account for income taxes. The objective of the asset and liability method is to establish deferred tax assets and liabilities for the temporary differences between the financial reporting basis and the income tax basis of our assets and liabilities at enacted tax rates expected to be in effect when such amounts are realized or settled. Our annual tax rate is based on its income, statutory tax rates and available tax planning opportunities. Tax laws are complex and subject to different interpretations by the taxpayer and respective governmental taxing authorities. Significant judgment is required in determining tax expense and in evaluating tax positions, including evaluating uncertainties.

51

Deferred income tax assets represent amounts available to reduce income taxes payable on taxable income in future years. Such assets arise because of temporary differences between the financial reporting and tax bases of assets and liabilities, as well as from net operating loss carryforwards. We review our deferred tax positions quarterly for changes which may impact realizability. We evaluate the recoverability of these future tax deductions by assessing the adequacy of future expected taxable income from all sources, including reversal of taxable temporary differences, forecasted operating earnings and available tax planning strategies. We use short and long-range business forecasts to provide additional information for our evaluation of the recoverability of deferred tax assets. It is our policy to recognize interest and penalties associated with uncertain tax positions, if applicable, as components of non-interest expense.

A deferred tax valuation allowance is established to reduce the net carrying amount of deferred tax assets if it is determined to be more likely than not that all or some of the deferred tax asset will not be realized. See Note 11 of Byline’s Consolidated Financial Statements as of December 31, 2016 and 2015, included in our prospectus in connection with our initial public offering that we filed with the SEC on July 3, 2017, for further information on income taxes.

Recently Issued Accounting Pronouncements

Refer to Note 2 of our Interim Unaudited Condensed Consolidated Financial Statements as of September 30, 2017, included in this report, for a description of recent accounting pronouncements, including the effective dates of adoption and anticipated effects on our results of operations and financial condition.

Primary Factors Used to Evaluate Our Business

As a financial institution, we manage and evaluate various aspects of both our results of operations and our financial condition. We evaluate the levels and trends of the line items included in our consolidated balance sheet and income statement as well as various financial ratios that are commonly used in our industry. We analyze these ratios and financial trends against our own historical performance, our budgeted performance and the final condition and performance of comparable financial institutions in our region. Comparison of our financial performance against other financial institutions is impacted by the accounting for acquired non-impaired and acquired impaired loans.

These factors and metrics described in this report may not provide an appropriate basis to compare our results or financial condition to the results or financial condition of other financial services companies, given our limited operating history and strategic acquisitions since the Recapitalization.

Results of Operations

Overview

Our results of operations depend substantially on net interest income, which is the difference between interest income on interest-earning assets, consisting primarily of interest income on loans and lease receivables, including accretion income on loans and leases, investment securities and other short-term investments, and interest expense on interest-bearing liabilities, consisting primarily of deposits and borrowings. Our results of operations are also dependent upon our generation of non-interest income, consisting primarily of income from fees and service charges on deposits, servicing fees, ATM and interchange fees, and net gains on sales of investment securities and loans. Other factors contributing to our results of operations include our provisions for loan and lease losses, income taxes, and non-interest expenses, such as salaries and employee benefits, occupancy and equipment expenses and other miscellaneous operating costs.

Our third quarter 2017 results reflect the positive impact of our efforts over the past year to continue to drive revenue growth and improve efficiencies. Compared to the third quarter of 2016, our total revenues increased by more than 65% while our efficiency ratio improved to 69.92% from 84.38%. As a result, we were able to deliver a 523.4% year-over-year increase in net income.

52

Selected Financial Data

	As of or For the Three Months Ended September 30,						As of or For the Nine Months Ended September 30,
(dollars in thousands, except share and per share data)	2017			2016			2017			2016
Summary of Operations
Net interest income	$	31,412		$	20,865		$	90,761		$	62,366
Provision for loan and lease losses		3,900			1,683			9,306			5,348
Non-interest income		11,918			4,776			37,419			15,262
Non-interest expense		31,065			22,384			89,165			69,688
Income before provision for income taxes		8,365			1,574			29,709			2,592
Provision (benefit) for income taxes		(1,390	)		9			7,248			(222	)
Net income		9,755			1,565			22,461			2,814
Dividends on preferred shares		195			—			11,081			-
Net income available to common stockholders	$	9,560		$	1,565		$	11,380		$	2,814
Earnings per Common Share
Basic earnings per common share	$	0.33		$	0.08		$	0.43		$	0.15
Diluted earnings per common share	$	0.32		$	0.08		$	0.43		$	0.15
Weighted average common shares outstanding (basic)		29,246,900			19,497,811			26,194,025			18,838,354
Weighted average common shares outstanding (diluted)		29,752,331			19,763,434			26,697,841			19,103,977
Common shares outstanding		29,305,400			20,410,850			29,305,400			20,410,850
Key Ratios (annualized where applicable)
Net interest margin		4.18	%		3.37	%		4.07	%		3.46	%
Cost of deposits		0.33	%		0.19	%		0.29	%		0.20	%
Efficiency ratio(1)		69.92	%		84.38	%		67.76	%		86.88	%
Non-interest income to total revenues(2)		27.51	%		18.62	%		29.19	%		19.66	%
Non-interest expense to average assets		3.73	%		3.33	%		3.61	%		3.55	%
Return on average stockholders' equity		8.44	%		2.63	%		7.23	%		1.70	%
Return on average assets		1.17	%		0.23	%		0.91	%		0.14	%
Pre-tax pre-provision return on average assets(2)		1.47	%		0.48	%		1.58	%		0.40	%
Non-interest bearing deposits to total deposits		29.90	%		30.04	%		29.90	%		30.04	%
Deposits per branch	$	44,227		$	33,475		$	44,227		$	33,475
Loans and leases held for sale and loans and lease held for investment to total deposits		88.01	%		76.63	%		88.01	%		76.63	%
Deposits to total liabilities		88.58	%		89.83	%		88.58	%		89.83	%
Tangible book value per common share(2)	$	12.95		$	9.32		$	12.95		$	9.32
Asset Quality Ratios
Non-performing loans and leases to total loan and leases held for investment, net before ALLL		0.76	%		0.46	%		0.76	%		0.46	%
ALLL to total loans and leases held for investment, net before ALLL		0.72	%		0.38	%		0.65	%		0.40	%
Net charge-offs to average total loans and leases held for investment, net before ALLL		0.34	%		0.40	%		0.26	%		0.56	%
Acquisition accounting adjustments(3)	$	34,249		$	15,864		$	34,249		$	15,864
Capital Ratios
Common equity to assets		13.59	%		8.59	%		13.59	%		8.59	%
Tangible common equity to tangible assets(2)		11.73	%		7.04	%		11.73	%		7.04	%
Leverage ratio		11.95	%		9.29	%		11.95	%		9.29	%
Common equity tier 1 capital ratio		13.93	%		10.22	%		13.93	%		10.22	%
Tier 1 capital ratio		15.38	%		12.84	%		15.38	%		12.84	%
Total capital ratio		16.08	%		13.22	%		16.08	%		13.22	%

53

(1) Represents non-interest expense less amortization of intangible assets divided by net interest income and non-interest income.

(2) Represents a non-GAAP financial measure. See “Reconciliation of non-GAAP Financial Measures” for a reconciliation of our non-GAAP measures to the most directly comparable GAAP financial measure.

(3) Represents the remaining unamortized premium or unaccreted discount as a result of applying the fair value adjustment at the time of the business combination on acquired loans.  

We reported consolidated net income for the three months ended September 30, 2017 of $9.8 million compared to net income of $1.6 million for the three months ended September 30, 2016, an increase of $8.2 million. Consolidated net income for the three months ended September 30, 2017, includes three months of our Small Business Capital operations, which was established with our acquisition of Ridgestone on October 14, 2016.  The increase in earnings was due to a $10.5 million increase in net interest income, a $7.1 million increase in non-interest income, and a $1.4 million decrease in provision for income taxes, offset by an $8.7 million increase in non-interest expense and a $2.2 million increase in provision for loan and lease losses.  The increase in non-interest expense was primarily due to increases in salaries and employee benefits of $5.0 million as a result of our expanded employee base resulting from the Ridgestone acquisition, a $543,000 increase in legal, audit and other professional fees, primarily due to the increased costs associated with being a public company, and an increase of $2.0 million in other non-interest expense, which included impairment charges on assets held for sale of $951,000. This charge was primarily related to the planned disposition of the former headquarters of Byline Bank. Benefit for income taxes recognized was $1.4 million during the three months ended September 30, 2017 compared to a provision for income taxes of $9,000 for same period in 2016. The decrease in income tax provision was primarily due to a state income tax benefit of $4.6 million during the quarter ended September 30, 2017, as a result of increased value to the deferred tax asset related to the Company’s Illinois net loss deduction.

For the three months ended September 30, 2017, net income available to common stockholders was $9.6 million or $0.33 per basic and $0.32 per diluted common share.

Our results of operations for the three months ended September 30, 2017 produced an annualized return on average assets of 1.17% and a return on average stockholders’ equity of 8.44%, compared to returns for the three months ended September 30, 2016 of 0.23% and 2.63%, respectively.  

We reported consolidated net income for the nine months ended September 30, 2017 of $22.5 million compared to net income of $2.8 million for the nine months ended September 30, 2016, an increase of $19.7 million. Consolidated net income for the nine months ended September 30, 2017, includes nine months of our Small Business Capital operations.  The increase in earnings was due to a $28.4 million increase in net interest income and a $22.1 million increase in non-interest income offset by a $19.5 million increase in non-interest expense and a $4.0 million increase in provision for loan and lease losses.  The increase in non-interest expense was primarily due to increases in salaries and employee benefits of $16.0 million as a result of the Ridgestone acquisition, which was partially offset by lower net loss recognized on the sale of other real estate owned and related expenses of $1.3 million. Provision for income taxes recognized was $7.2 million for the nine months ended September 30, 2017 compared to a benefit for income taxes of $222,000 for same period in 2016.

During the second quarter of 2017, and in connection with our initial public offering, we agreed to repurchase all $15.0 million of our outstanding shares of Series A Preferred Stock for $25.5 million.  The $10.5 million excess of consideration paid over the $15.0 million carrying amount of the Series A Preferred Stock was treated as a one-time dividend declaration on the Series A Preferred Stock.  Both the dividend declared on the Series A Preferred Stock and the regular quarterly dividends paid on our Series B Preferred Stock are reflected in the reported net income available to common stockholders for the nine months ended September 30, 2017, which was $11.4 million, or $0.43 per basic and diluted common share. There were no preferred dividends declared or paid for the nine months ended September 30, 2016.

Our results of operations for the nine months ended September 30, 2017 produced an annualized return on average assets of 0.91% and a return on average shareholders’ equity of 7.23%, compared to returns for the nine months ended September 30, 2016 of 0.14% and 1.70%, respectively.  

Net Interest Income

Net interest income, representing interest income less interest expense, is a significant contributor to our revenues and earnings. We generate interest income from interest and dividends on interest-earning assets, which include loans, leases and investment securities we own. We incur interest expense from interest paid on interest-bearing liabilities, which include

54

interest-bearing deposits, FHLB advances, junior subordinated debentures and other borrowings. To evaluate net interest income, we measure and monitor (i) yields on our loans and other interest-earning assets, (ii) the costs of our deposits and other funding sources, (iii) our net interest spread, and (iv) our net interest margin. Net interest spread is the difference between rates earned on interest-earning assets and rates paid on interest-bearing liabilities. Net interest margin is calculated as the annualized net interest income divided by average interest-earning assets. Because non-interest-bearing sources of funds, such as non-interest-bearing deposits and stockholders’ equity, also fund interest-earning assets, net interest margin includes the benefit of these non-interest-bearing sources.

We also recognize income from the accretable discounts associated with the purchase of interest-earning assets. Because of the Recapitalization and the acquisition of Ridgestone, we derive a portion of our interest income from the accretable discounts on acquired loans. The accretion is recognized over the life of the loan and is impacted by changes in expected cash flows on the loan. This accretion will continue to have an impact on our net interest income as long as loans acquired with evidence of credit deterioration at acquisition represent a meaningful portion of our interest-earning assets. As of September 30, 2017, acquired loans with evidence of credit deterioration accounted for under ASC Topic 310-30, Accounting for Purchased Loans with Deteriorated Credit Quality, represented 15.4% of our total loan portfolio.

Changes in the market interest rates and interest rates we earn on interest-earning assets or pay on interest-bearing liabilities, as well as the volume and types of interest-earning assets, interest-bearing and non-interest-bearing liabilities, are usually the largest drivers of periodic changes in net interest spread, net interest margin and net interest income. In addition, our interest income includes the accretion of the discounts on our acquired loans, which will also affect our net interest spread, net interest margin and net interest income.

55

The following tables present, for the periods indicated, information about (i)  average balances, the total dollar amount of interest income from interest-earning assets and the resultant average yields; (ii) average balances, the total dollar amount of interest expense on interest-bearing liabilities and the resultant average rates; (iii) net interest income; (iv) the interest rate spread; and (v) the net interest margin. Yields have been calculated on a pre-tax basis (dollars in thousands).  

	For the Three Months Ended September 30,
	2017								2016
	Average Balance(5)			Interest Inc / Exp		Average Yield / Rate			Average Balance(5)			Interest Inc / Exp		Average Yield / Rate
ASSETS
Cash and cash equivalents	$	48,354		$	106		0.87	%	$	31,794		$	25		0.31	%
Loans and leases(1)		2,193,076			30,933		5.60	%		1,660,323			19,081		4.57	%
Securities available-for-sale(2)		602,146			3,181		2.10	%		614,285			2,750		1.78	%
Securities held-to-maturity		111,345			650		2.32	%		134,989			649		1.91	%
Tax-exempt securities		26,166			174		2.63	%		19,953			152		3.03	%
Total interest-earning assets	$	2,981,087		$	35,044		4.66	%	$	2,461,344		$	22,657		3.66	%
Allowance for loan and lease losses		(14,570	)							(6,938	)
All other assets		340,669								220,494
TOTAL ASSETS	$	3,307,186							$	2,674,900
LIABILITIES AND STOCKHOLDERS’    EQUITY
Deposits
Interest checking	$	186,447		$	29		0.06	%	$	185,583		$	33		0.07	%
Money market accounts		388,365			275		0.28	%		406,531			261		0.27	%
Savings		441,096			79		0.07	%		442,269			76		0.07	%
Time deposits		758,518			1,729		0.90	%		507,570			693		0.54	%
Total interest bearing deposits		1,774,426			2,112		0.47	%		1,541,953			1,063		0.27	%
Federal Home Loan Bank advances		222,800			850		1.51	%		173,141			200		0.46	%
Other borrowed funds		60,418			670		4.40	%		38,482			529		5.46	%
Total borrowings		283,218			1,520		2.13	%		211,623			729		1.37	%
Total interest bearing liabilities	$	2,057,644		$	3,632		0.70	%	$	1,753,576		$	1,792		0.41	%
Non-interest checking		748,523								653,642
Other liabilities		42,577								30,913
Total stockholders’ equity		458,442								236,769
TOTAL LIABILITIES AND STOCKHOLDERS’    EQUITY	$	3,307,186							$	2,674,900
Net interest spread(3)							3.96	%							3.25	%
Net interest income				$	31,412							$	20,865
Net interest margin(4)							4.18	%							3.37	%
Net loan accretion impact on margin				$	2,166		0.29	%				$	1,185		0.19	%
Net interest margin excluding loan accretion(6)							3.89	%							3.18	%

(1) Loan and lease balances are net of deferred origination fees and costs and initial direct costs. Non-accrual loans and leases are included in total loan and lease balances.

(2) Interest income and rates exclude the effects of a tax equivalent adjustment to adjust tax exempt investment income on tax exempt investment securities to a fully taxable basis due to immateriality.

(3) Represents the average rate earned on interest-earning assets minus the average rate paid on interest-bearing liabilities.

(4) Represents net interest income (annualized) divided by total average earning assets.

(5) Average balances are average daily balances.

(6)   Represents a non-GAAP financial measure. See “Reconciliation of non-GAAP Financial Measures” for a reconciliation of our non-GAAP measures to the most directly comparable GAAP financial measure.

56

	For the Nine Months Ended September 30,
	2017								2016
	Average Balance(5)			Interest Inc / Exp		Average Yield / Rate			Average Balance(5)			Interest Inc / Exp		Average Yield / Rate
ASSETS
Cash and cash equivalents	$	54,894		$	327		0.80	%	$	29,954		$	66		0.29	%
Loans and leases(1)		2,180,507			88,510		5.43	%		1,543,948			56,334		4.87	%
Securities available-for-sale(2)		610,249			9,525		2.09	%		676,334			8,647		1.71	%
Securities held-to-maturity		116,764			2,027		2.32	%		136,127			2,033		1.99	%
Tax-exempt securities		22,033			458		2.78	%		20,932			509		3.25	%
Total interest-earning assets	$	2,984,447		$	100,847		4.52	%	$	2,407,295		$	67,589		3.75	%
Allowance for loan and lease losses		(12,715	)							(7,525	)
All other assets		330,209								225,316
TOTAL ASSETS	$	3,301,941							$	2,625,086
LIABILITIES AND STOCKHOLDERS’    EQUITY
Deposits
Interest checking	$	185,409		$	87		0.06	%	$	187,159		$	97		0.07	%
Money market accounts		376,751			712		0.25	%		399,240			747		0.25	%
Savings		445,082			237		0.07	%		441,773			227		0.07	%
Time deposits		782,672			4,482		0.77	%		526,516			2,210		0.56	%
Total interest bearing deposits		1,789,914			5,518		0.41	%		1,554,688			3,281		0.28	%
Federal Home Loan Bank advances		249,630			2,282		1.22	%		124,277			371		0.40	%
Other borrowed funds		68,803			2,286		4.44	%		37,620			1,571		5.58	%
Total borrowings		318,433			4,568		1.92	%		161,897			1,942		1.60	%
Total interest bearing liabilities	$	2,108,347		$	10,086		0.64	%	$	1,716,585		$	5,223		0.41	%
Non-interest checking		736,982								650,803
Other liabilities		41,393								37,249
Total stockholders’ equity		415,219								220,449
TOTAL LIABILITIES AND STOCKHOLDERS’    EQUITY	$	3,301,941							$	2,625,086
Net interest spread(3)							3.88	%							3.34	%
Net interest income				$	90,761							$	62,366
Net interest margin(4)							4.07	%							3.46	%
Net loan accretion impact on margin				$	6,347		0.28	%				$	1,502		0.08	%
Net interest margin excluding loan accretion(6)							3.79	%							3.38	%

(1) Loan and lease balances are net of deferred origination fees and costs and initial direct costs. Non-accrual loans and leases are included in total loan and lease balances.

(2) Interest income and rates exclude the effects of a tax equivalent adjustment to adjust tax exempt investment income on tax exempt investment securities to a fully taxable basis due to immateriality.

(3) Represents the average rate earned on interest-earning assets minus the average rate paid on interest-bearing liabilities.

(4) Represents net interest income (annualized) divided by total average earning assets.

(5) Average balances are average daily balances.

(6)   Represents a non-GAAP financial measure. See “Reconciliation of non-GAAP Financial Measures” for a reconciliation of our non-GAAP measures to the most directly comparable GAAP financial measure.

57

Increases and decreases in interest income and interest expense result from changes in average balances (volume) of interest-earning assets and interest-bearing liabilities, as well as changes in average interest rates. The following table sets forth the effects of changing rates and volumes on our net interest income during the periods shown. Information is provided with respect to (i) effects on interest income attributable to changes in volume (changes in volume multiplied by prior rate) and (ii) effects on interest income attributable to changes in rate (changes in rate multiplied by prior volume). Changes applicable to both volume and rate have been allocated to volume. Yields have been calculated on a pre-tax basis. The table below is a summary of increases and decreases in interest income and interest expense resulting from changes in average balances (volume) and changes in average interest rates (dollars in thousands):

	Three Months Ended September 30, 2017 compared to Three Months Ended September 30, 2016
	Increase (Decrease) Due to
	Volume			Rate			Total
Interest income
Cash and cash equivalents	$	36		$	45		$	81
Loans and leases(1)		7,567			4,285			11,852
Securities available for sale		(57	)		488			431
Securities held to maturity		(137	)		138			1
Tax-exempt securities		42			(20	)		22
Total interest income	$	7,451		$	4,936		$	12,387
Interest expense
Deposits
Interest checking	$	—		$	(4	)	$	(4	)
Money market accounts		(12	)		26			14
Savings		—			3			3
Time deposits		574			462			1,036
Total interest bearing deposits		562			487			1,049
Federal Home Loan Bank advances		190			460			650
Other borrowed funds		244			(103	)		141
Total borrowings		434			357			791
Total interest expense	$	996		$	844		$	1,840
Net interest income	$	6,455		$	4,092		$	10,547

(1) Includes loans and leases on non-accrual status.

Net interest income for the three months ended September 30, 2017 was $31.4 million compared to $20.9 million during the same period in 2016, an increase of $10.5 million, or 50.6%. The increase in interest income of $12.4 million was primarily a result of organic growth of the loan and lease portfolio and the Ridgestone acquisition.  Interest expense increased by $1.8 million for the three months ended September 30, 2017 compared to the three months ended September 30, 2016, primarily due to additional FHLB advances and acquired time deposits, partially offset by fair value adjustments on time deposits as a result of the Ridgestone acquisition.  

58

	Nine Months Ended September 30, 2017 compared to Nine Months Ended September 30, 2016
	Increase (Decrease) Due to
	Volume			Rate			Total
Interest income
Cash and cash equivalents	$	149		$	112		$	261
Loans and leases(1)		25,787			6,389			32,176
Securities available for sale		(1,040	)		1,918			878
Securities held to maturity		(338	)		332			(6	)
Tax-exempt securities		22			(73	)		(51	)
Total interest income	$	24,580		$	8,678		$	33,258
Interest expense
Deposits
Interest checking	$	(1	)	$	(9	)	$	(10	)
Money market accounts		(44	)		9			(35	)
Savings		2			8			10
Time deposits		1,465			807			2,272
Total interest-bearing deposits		1,422			815			2,237
Federal Home Loan Bank advances		1,146			765			1,911
Other borrowed funds		1,035			(320	)		715
Total borrowings		2,181			445			2,626
Total interest expense	$	3,603		$	1,260		$	4,863
Net interest income	$	20,977		$	7,418		$	28,395

(1) Includes loans and leases on non-accrual status.

Net interest income for the nine months ended September 30, 2017 was $90.8 million compared to $62.4 million during the same period in 2016, an increase of $28.4 million, or 45.5% .  The increase in interest income of $33.2 million was primarily a result of organic growth of the loan and lease portfolio and the Ridgestone acquisition.  Interest expense increased by $4.9 million for the nine months ended September 30, 2017 compared to the nine months ended September 30, 2016, primarily due to additional FHLB advances and acquired time deposits, partially offset by fair value adjustments on time deposits as a result of the Ridgestone acquisition.

The net interest margin for the three months ended September 30, 2017 was 4.18%, an increase of 81 basis points compared to 3.37% for the three months ended September 30, 2016.  The net interest margin for the nine months ended September 30, 2017 was 4.07%, an increase of 61 basis points compared to 3.46% for the nine months ended September 30, 2016. The primary driver of the increase for the three and nine month periods was due to a favorable shift in the mix and yield of earning assets and an increase in loan accretion income.  Net loan accretion income was $2.2 million for the three months ended September 30, 2017 compared to $1.2 million for the three months ended September 30, 2016.  Net loan accretion income was $6.3 million for the nine months ended September 30, 2017 compared to $1.5 million for the nine months ended September 30, 2016.

Provision for Loan and Lease Losses

The provision for loan and lease losses represents a charge to earnings necessary to establish an allowance for loan and lease losses that, in management’s evaluation, is appropriate to provide coverage for probable losses incurred in the loan and lease portfolio. The allowance for loan and lease losses is increased by the provision for loan and lease losses and is decreased by charge-offs, net of recoveries on prior charge-offs.

59

Provisions for loan and lease losses totaled $3.9 million and $1.7 million for the three months ended September 30, 2017 and 2016, respectively. Provisions for loan lease losses totaled $9.3 million and $5.3 million for the nine months ended September 30, 2017 and 2016, respectively. These increases reflect growth in the loan and lease portfolio during the periods as well as net impairment of certain acquired loans based on a periodic update of expected loan cash flows, which resulted in a reclassification of $6.9 million and $24.3 million from non-accretable to accretable yield that can be recognized over the life of the portfolio for the three and nine months ended September 30, 2017, respectively.

The ALLL as a percentage of loans and leases, net of acquisition accounting adjustments, increased from 0.51% at December 31, 2016, to 0.72% at September 30, 2017. The increase was primarily due to the change in loan and lease composition; the originated portfolio increased by $192.1 million to $1.5 billion at September 30, 2017 while the acquired portfolio decreased by $123.6 million for the same period.    

Non-Interest Income

We reported non-interest income of $11.9 million and $4.8 million for the three months ended September 30, 2017 and 2016, respectively.  The increase of $7.1 million was primarily due to gains on sales of government guaranteed loans through our Small Business Capital operation of $7.5 million. There were no gains on sales of government guaranteed loans during the three months ended September 30, 2016.  This was partially offset by a decrease in gains on sales of securities available-for-sale of $802,000 during the three months ended September 30, 2016.

We reported non-interest income of $37.4 million and $15.3 million for the nine months ended September 30, 2017 and 2016, respectively.  The increase of $22.1 million was primarily due to gains on sales of government guaranteed loans through our Small Business Capital operation of $24.0 million. There were no gains on sales of government guaranteed loans during the nine months ended September 30, 2016.  This was partially offset by a decrease in gains on sales of securities available-for-sale of $3.2 million for the nine months ended September 30, 2016.

	For the Three Months Ended September 30,					For the Nine Months Ended September 30,
	2017		2016			2017		2016
Fees and service charges on deposit s	$	1,418	$	1,465		$	3,985	$	4,227
Servicing fees		959		—			2,954		—
ATM and interchange fees		1,495		1,470			4,342		4,392
Net gains on sales of securities available-for-sale		—		802			8		3,231
Net gains on sales of loans		7,499		(60	)		24,026		(39	)
Fees on mortgage loan sales, net		—		46			2		101
Other non-interest income		547		1,053			2,102		3,350
Total non-interest income	$	11,918	$	4,776		$	37,419	$	15,262

Service charges and fees represent fees charged to customers for banking services, such as fees on deposit accounts, and include, but are not limited to, maintenance fees, insufficient fund fees, overdraft protection fees, wire transfer fees and other fees. Fees and service charges on deposits decreased $47,000 for the three months ended September 30, 2017 compared to the same period in 2016.  Fees and service charges on deposits decreased $242,000 for the nine months ended September 30, 2017 compared to the same period in 2016.  

ATM and interchange fee income increased by $25,000 for the three months ended September 30, 2017 versus the three months ended September 30, 2016 and decreased $50,000 for the nine months ended September 30, 2017 compared to the nine months ended September 30, 2016.

While portions of the loans that we originate are sold and generate gain on sale revenue, servicing rights for the majority of loans that we sell are retained by Byline Bank. In exchange for continuing to service loans that have been sold, Byline Bank receives a servicing fee paid from a portion of the interest cash flow of the loan. As a result of the Ridgestone acquisition, we received $959,000 in servicing fees on the sold portion of the government guaranteed portfolio for the three months ended September 30, 2017, and $3.0 million for the nine months ended September 30, 2017. We did not receive servicing fees during the three or nine months ended September 30, 2016.  

60

We had no securities sales during the second or third quarters of 2017 and minimal securities sales during the first quarter of 2017.  As a result, gains on sales of securities during the nine months ended September 30, 2017 were $8,000 compared to $3.2 million for the nine months ended September 30, 2016, and $802,000 for the three months ended September 30, 2016.

For the three and nine months ended September 30, 2017, net gains on sales of loans were $7.5 million and $24.0 million, respectively.  We did not have a government guaranteed lending unit during the three and nine months ended September 30, 2016, prior to our acquisition of Ridgestone.  

Other non-interest income was $547,000 for the three months ended September 30, 2017; a decrease of 48.0% compared to $1.1 million for the three months ended September 30, 2016.  Other non-interest income was $2.1 million compared to $3.4 million for the nine months ended September 30, 2017 and 2016, respectively.  The primary driver of the decrease was a decrease in gains on sales of assets held for sale of $778,000 and a decrease in customer swap fee income of $361,000, due to reduced volume.

Non-Interest Expense

Non-interest expense for the three months ended September 30, 2017 was $31.1 million compared to $22.4 million for the three months ended September 30, 2016, an increase of $8.7 million or 38.8%. Non-interest expense for the nine months ended September 30, 2017 was $89.2 million compared to $69.7 million for the nine months ended September 30, 2016, an increase of $19.5 million or 28.0%. These increases are primarily due to the additional expenses as a result of the acquisition of Ridgestone.

The following table presents the major components of our non-interest expense for the periods indicated (dollars in thousands):

	For the Three Months Ended  September 30,				For the Nine Months Ended September 30,
	2017		2016		2017		2016
Salaries and employee benefits	$	16,323	$	11,266	$	50,151	$	34,206
Occupancy expense, net		3,301		3,358		10,525		10,511
Equipment expense		630		516		1,809		1,519
Loan and lease related expenses		891		443		2,569		1,090
Legal, audit and other professional fees		1,608		1,065		4,369		3,785
Data processing		2,399		1,990		7,255		5,760
Net loss recognized on other real estate owned and other related expenses		565		292		136		1,386
Regulatory assessments		326		502		894		1,930
Other intangible assets amortization expense		769		747		2,307		2,242
Advertising and promotions		196		156		803		454
Telecommunications		351		370		1,165		1,284
Other non-interest expense		3,706		1,679		7,182		5,521
Total non-interest expense	$	31,065	$	22,384	$	89,165	$	69,688

Salaries and employee benefits, the single largest component of our non-interest expense, totaled $16.3 million for the three months ended September 30, 2017, an increase of $5.0 million compared to the three months ended September 30, 2016.  Salaries and employee benefits totaled $50.2 million for the nine months ended September 30, 2017, an increase of $16.0 million increase compared to the nine months ended September 30, 2016.  These increases are primarily due to an addition in the number of employees as a result of the Ridgestone acquisition. Our staffing increased from 682 full-time equivalent employees as of September 30, 2016 to 824 as of September 30, 2017.  

Occupancy expense increased $14,000 for the nine months ended September 30, 2017 from the same period in 2016 and decreased $57,000 for the three months ended September 30, 2017 compared to the same period in 2016.  The decrease in occupancy expense for the three months ended September 30, 2017, was primarily as a result of our branch optimization

61

strategy in which we consolidated 28 branches during 2016, partially offset by increased expenses as a result of the Ridgestone acquisition.

Equipment expense for three months ended September 30, 2017 was $630,000 compared to $516,000 for the three months ended September 30, 2016, an increase of $114,000.  Equipment expense for the nine months ended September 30, 2017 was $1.8 million compared to $1.5 million for the nine months ended September 30, 2016, an increase of $290,000.  These increases are primarily due to increased depreciation expense related to increased investment in equipment and technology assets.

Loan and lease related expenses for the three months ended September 30, 2017 were $891,000 compared to $443,000 for the three months ended September 30, 2016, an increase of $448,000. Loan and lease related expenses for the nine months ended September 30, 2017 were $2.6 million compared to $1.1 million for the nine months ended September 30, 2016, an increase of $1.5 million. These increases are primarily due to the increased lending activity resulting from our Small Business Capital operations, partially offset by lower loan real estate tax expense for problem loans.

Legal, audit and other professional fees for the three months ended September 30, 2017 were $1.6 million compared to $1.1 million for the three months ended September 30, 2016, an increase of $543,000 or 50.9%. Legal, audit and other professional fees for the nine months ended September 30, 2017 were $4.4 million compared to $3.8 million for the nine months ended September 30, 2016, an increase of $584,000. These increases are primarily driven by increased legal and professional fees related to our costs associated with becoming a public company at the end of the second quarter of 2017.

Data processing expense for the three months ended September 30, 2017 was $2.4 million compared to $2.0 million for the three months ended September 30, 2016, an increase of $409,000, or 20.6%, and was $7.3 million for the nine months ended September 30, 2017 compared to $5.8 million for the same period during 2016. These increases are primarily due to increased data processing expenses related to the Ridgestone acquisition.

Net loss recognized on other real estate owned and other related expenses were $565,000 for the three months ended September 30, 2017, an increase of $273,000 compared to the same period in 2016.  The increase is primarily due to lower gains on sales of other real estate owned properties, partially offset by lower write-downs of values, subsequent to transfer to OREO.  Net loss recognized on other real estate owned and other related expenses for the nine months ended September 30, 2017 were $136,000 compared to OREO expense of $1.4 million for the nine months ended September 30, 2016.  This decrease in net loss recognized on other real estate owned and other related expenses was primarily attributed to reduced OREO related expenses and an increase in gains on sales of other real estate owned.

Regulatory assessments for the three months ended September 30, 2017 were $326,000 compared to $502,000 for the same period in 2016, a decrease of $176,000 or 34.9%. Regulatory assessments for the nine months ended September 30, 2017 were $894,000 compared to $1.9 million for the same period in 2016, a decrease of $1.0 million or 53.7%.  These decreases are primarily due to our improved risk profile as a result of improved capital ratios, performance and asset quality.

Advertising and promotions for the three months ended September 30, 2017 were $196,000 compared to $156,000 for same period in 2016, an increase of $40,000 and were $803,000 for the nine months ended September 30, 2017 compared to $454,000 for the same period in 2016, an increase of $349,000, primarily due to increased advertising and promotions, attributable to our Small Business Capital operations.

Telecommunications expense was $351,000 for the three months ended September 30, 2017 compared to $370,000 for the three months ended September 30, 2016, a decrease of $19,000.  Telecommunications expense was $1.2 million for the nine months ended September 30, 2017, a decrease of $119,000 or 9.2% compared to the same period in 2016.   These decreases are a result of our ongoing cost savings initiatives.

Other non-interest expense for the three months ended September 30, 2017 was $3.7 million compared to $1.7 million for the three months ended September 30, 2016, an increase of $2.0 million.  During the third quarter of 2017, we incurred impairment charges on assets held for sale of $951,000, primarily related to the planned disposition of the former headquarters of Byline Bank.  Our provision for unfunded commitments was $299,000 for the three months ended September 30, 2017 compared to a benefit of $14,000 for the three months ended September 30, 2016.  This increase of $313,000 is primarily due to growth in our unfunded loan and lease commitments.  Directors fees were $406,000 for the three

62

months ended September 30, 2017 compared to $307,000 for the three months ended September 30, 2016, an increase of $99,000.

Other non-interest expense was $7.2 million for the nine months ended September 30, 2017 compared to $5.5 million for the same period in 2016. In addition to incurring impairment charges on assets held for sale, travel and entertainment related expenses increased $368,000 to $786,000 for the nine months ended September 30, 2017, over the comparable period in 2016, primarily attributable to our Small Business Capital operations. Our provision for unfunded commitments was $272,000 for the nine months ended September 30, 2017 compared to $56,000 for the nine months ended September 30, 2016, an increase of $216,000, primarily due to growth in our unfunded loan and lease commitments.

Our efficiency ratio was 69.92% for the three months ended September 30, 2017, compared to 84.38% for the three months ended September 30, 2016. Our efficiency ratio was 67.76% for the nine months ended September 30, 2017, compared to 86.88% for the comparable period in 2016.  The improvement in our efficiency ratio is primarily attributable to increased revenues resulting from our acquisition of Ridgestone and the continued organic growth of our loan and lease portfolios over the last 12 months.

Income Taxes

We recorded a benefit for income taxes of $1.4 million for the three months ended September 30, 2017 compared to expense of $9,000 for the three months ended September 30, 2016.  As part of a budget package passed by the Legislature of the State of Illinois, the corporate income tax rate increased from 5.25% to 7.00% effective July 1, 2017.   As a result of the increase in the corporate income tax rate, we recorded a state income tax benefit of $4.6 million due to increased value of our deferred tax asset related to our Illinois net loss deduction.

Our provision for income taxes for the nine months ended September 30, 2017 totaled $7.2 million compared to a benefit of $222,000 for the nine months ended September 30, 2016.  The increase in income tax expense is primarily due to the reversal of our deferred tax asset valuation allowance at the end of 2016 and the increase in taxable income for the three and nine months ended September 30, 2017 compared to the same periods in 2016.  Our effective tax rate was 24.4% for the nine months ended September 30, 2017.

Financial Condition

Balance Sheet Analysis

Our total assets increased by $9.6 million, or 0.3%, to $3.3 billion at September 30, 2017, compared to December 31, 2016. The increase in total assets includes an increase of $68.5 million, or 3.2%, in loans and leases from $2.1 billion at December 31, 2016 to $2.2 billion at September 30, 2017.  The increase in loans and leases was offset by a decrease in investment securities of $41.3 million to fund loan and lease growth. Due from counterparty increased $21.1 million related to loan sales not settled offset by a decrease in loans held for sale of $21.9 million.    

Investment Portfolio

The investment securities portfolio consists of securities classified as available-for-sale and held-to-maturity. There were no trading securities in our investment portfolio as of September 30, 2017 or December 31, 2016. All available-for sale securities are carried at fair value and may be used for liquidity purposes should management consider it to be in our best interest. Securities available-for-sale consist primarily of residential mortgage-backed securities, commercial mortgage backed securities and U.S. government agencies securities.

Securities available-for-sale decreased $23.9 million, from $608.6 million at December 31, 2016 to $584.7 million at September 30, 2017. The decrease was primarily due to the redeployment of liquidity into higher yielding loans and leases.

The held-to-maturity securities portfolio consists of mortgage-backed securities and obligations of states, municipalities and political subdivisions. We carry these securities at amortized cost. As of September 30, 2017 this portfolio totaled $121.5 million compared to $138.8 million at December 31, 2016.  

63

We had no securities that were classified as having other than temporary impairment as of September 30, 2017 or December 31, 2016.

The following table summarizes the fair value of the available-for-sale and held-to-maturity securities portfolio as of the dates presented (dollars in thousands):

	September 30, 2017				December 31, 2016
	Amortized Cost		Fair Value		Amortized Cost		Fair Value
Available-for-sale
U.S. Treasury Notes	$	14,998	$	14,925	$	14,995	$	14,920
U.S. Government agencies		54,231		53,219		60,180		58,857
Obligations of states, municipalities, and political    subdivisions		32,619		32,535		16,271		16,059
Residential mortgage-backed securities
Agency		329,782		324,040		376,800		368,160
Non-agency		25,429		25,470		20,107		19,933
Commercial mortgage-backed securities
Agency		72,190		70,757		78,954		77,403
Non-agency		31,838		31,257		32,061		31,052
Corporate securities		27,093		27,524		17,065		17,329
Other securities		3,626		4,957		4,161		4,847
Total	$	591,806	$	584,684	$	620,594	$	608,560

	Amortized Cost		Fair Value		Amortized Cost		Fair Value
Held-to-maturity
Obligations of states, municipalities, and political    subdivisions	$	24,078	$	24,359	$	24,878	$	24,754
Residential mortgage-backed securities
Agency		56,453		56,646		67,692		67,444
Non-agency		40,922		41,261		46,276		45,884
Total	$	121,453	$	122,266	$	138,846	$	138,082

We did not classify any securities as trading securities during 2017 or 2016.

Certain securities have fair values less than amortized cost and, therefore, contain unrealized losses. At September 30, 2017, we evaluated the securities which had an unrealized loss for other than temporary impairment and determined all declines in value to be temporary. There were 113 investment securities with unrealized losses at September 30, 2017, of which only one had a continuous unrealized loss position for 12 consecutive months or longer that is greater than 5% of amortized cost. We anticipate full recovery of amortized cost with respect to these securities by maturity, or sooner, in the event of a more favorable market interest rate environment. We do not intend to sell these securities and it is not more likely than not that we will be required to sell them before recovery of their amortized cost basis, which may be at maturity.

64

The following table (dollars in thousands) sets forth certain information regarding contractual maturities and the weighted average yields of our investment securities as of the dates presented. Expected maturities may differ from contractual maturities if borrowers have the right to call or prepay obligations with or without call or prepayment penalties.

	Maturity as of September 30, 2017
	Due in One Year or Less					Due from One to  Five Years					Due from Five to Ten Years					Due after Ten Years
	Amortized Cost		Weighted Average Yield(1)			Amortized Cost		Weighted Average Yield(1)			Amortized Cost		Weighted Average Yield(1)			Amortized Cost		Weighted Average Yield(1)
Available-for-sale
U.S. Treasury Notes	$	4,999		1.04	%	$	9,999		1.21	%	$	—		0.00	%	$	—		0.00	%
U.S. government agencies		—		0.00	%		39,235		1.40	%		14,996		1.83	%		—		0.00	%
Obligations of states,    municipalities, and political    subdivisions		290		3.27	%		4,583		2.81	%		16,639		2.52	%		11,107		3.18	%
Residential mortgage-backed    securities
Agency		—		0.00	%		—		0.00	%		16,818		1.61	%		312,964		1.97	%
Non-agency		—		0.00	%		—		0.00	%		—		0.00	%		25,429		3.19	%
Commercial mortgage-backed    securities
Agency		—		0.00	%		—		0.00	%		11,596		1.84	%		60,594		2.18	%
Non-agency		—		0.00	%		—		0.00	%		—		0.00	%		31,838		2.61	%
Corporate securities		—		0.00	%		16,280		4.44	%		10,813		3.55	%		—		0.00	%
Other securities		—		0.00	%		—		0.00	%		—		0.00	%		3,626		3.44	%
Total	$	5,289		1.25	%	$	70,097		2.17	%	$	70,862		2.20	%	$	445,558		2.16	%

	Amortized Cost		Weighted Average Yield(1)			Amortized Cost		Weighted Average Yield(1)			Amortized Cost		Weighted Average Yield(1)			Amortized Cost		Weighted Average Yield(1)
Held-to-maturity
Obligations of states,    municipalities, and political     subdivisions	$	—		0.00	%	$	524		1.50	%	$	13,735		2.45	%	$	9,819		2.89	%
Residential mortgage-backed     securities
Agency		—		0.00	%		—		0.00	%		—		0.00	%		56,453		2.20	%
Non-agency		—		0.00	%		—		0.00	%		—		0.00	%		40,922		3.29	%
Total	$	—		0.00	%	$	524		1.50	%	$	13,735		2.45	%	$	107,194		2.68	%

65

	Maturity as of December 31, 2016
	Due in One Year or Less					Due from One to  Five Years					Due from Five to Ten Years					Due after Ten Years
	Amortized Cost		Weighted Average Yield(1)			Amortized Cost		Weighted Average Yield(1)			Amortized Cost		Weighted Average Yield(1)			Amortized Cost		Weighted Average Yield(1)
Available-for-sale
U.S. Treasury Notes	$	—		0.00	%	$	14,995		1.16	%	$	—		0.00	%	$	—		0.00	%
U.S. government agencies		—		0.00	%		50,180		1.41	%		10,000		1.74	%		—		0.00	%
Obligations of states,    municipalities, and political    subdivisions		200		2.48	%		5,172		3.31	%		6,720		3.05	%		4,179		3.25	%
Residential mortgage-backed    securities
Agency		—		0.00	%		—		0.00	%		20,101		1.66	%		356,699		2.09	%
Non-agency		—		0.00	%		—		0.00	%		—		0.00	%		20,107		3.28	%
Commercial mortgage-backed    securities
Agency		—		0.00	%		—		0.00	%		11,969		1.22	%		66,985		2.15	%
Non-agency		—		0.00	%		—		0.00	%		—		0.00	%		32,061		2.61	%
Corporate securities		—		0.00	%		13,254		4.55	%		3,811		2.46	%		—		0.00	%
Other securities		—		0.00	%		—		0.00	%		539		1.11	%		3,622		3.43	%
Total	$	200		2.48	%	$	83,601		1.98	%	$	53,140		1.80	%	$	483,653		2.20	%

	Amortized Cost		Weighted Average Yield(1)			Amortized Cost		Weighted Average Yield(1)			Amortized Cost		Weighted Average Yield(1)			Amortized Cost		Weighted Average Yield(1)
Held-to-maturity
Obligations of states,    municipalities, and political    subdivisions	$	—		0.00	%	$	1,731		2.19	%	$	14,268		2.48	%	$	8,879		2.82	%
Residential mortgage-backed    securities
Agency		—		0.00	%		—		0.00	%		—		0.00	%		67,692		2.23	%
Non-agency		—		0.00	%		—		0.00	%		—		0.00	%		46,276		3.32	%
Total	$	—		0.00	%	$	1,731		2.19	%	$	14,268		2.48	%	$	122,847		2.68	%

(1) The weighted average yields are based on amortized cost.

Total non-taxable securities classified as obligations of states, municipalities and political subdivisions were $27.5 million at September 30, 2017, an increase of $8.5 million from December 31, 2016.

There were no holdings of securities of any one issuer, other than U.S. government-sponsored entities and agencies, with total outstanding balances greater than 10% of our stockholders’ equity as of September 30, 2017 or December 31, 2016.

Restricted Stock

As a member of the Federal Home Loan Bank system, our bank is required to maintain an investment in the capital stock of the FHLB. No market exists for this stock, and it has no quoted market value. The stock is redeemable at par by the FHLB and is, therefore, carried at cost. In addition, our bank owns stock of Bankers’ Bank that was acquired as part of the Ridgestone acquisition. The stock is redeemable at par and carried at cost. As of September 30, 2017 and December 31, 2016, we held approximately $10.6 million and $15.0 million, respectively, in FHLB and Bankers’ Bank stocks. We evaluate impairment of our investment in FHLB and Bankers’ Bank based on the ultimate recoverability of the par value rather than by recognizing temporary declines in value. We did not identify any indicators of impairment of FHLB and Bankers’ Bank stock as of September 30, 2017 and December 31, 2016.

66

Loan and Lease Portfolio

Lending-related income is the most important component of our net interest income and is the main driver of the results of our operations. Total loans and leases at September 30, 2017 were $2.2 billion, an increase of $68.5 million compared to December 31, 2016.  Our originated loan and lease portfolio increased $192.1 million, offset by a decrease in the acquired loan and lease portfolio of $123.6 million, during the first nine months of 2017.  The growth in the originated loan and lease portfolio was primarily driven by increases in commercial real estate loans, commercial and industrial loans and leases, partially offset by decreases in construction, land development and other land loans.

We strive to maintain a relatively diversified loan portfolio to help reduce the risk inherent in concentration in certain types of collateral. The following table shows our allocation of originated, acquired impaired and acquired non-impaired loans as of the dates presented (dollars in thousands):  

	September 30, 2017						December 31, 2016
	Amount			% of Total			Amount			% of Total
Originated loans
Commercial real estate	$	463,020			20.9	%	$	338,752			15.8	%
Residential real estate		398,062			18.0	%		394,168			18.3	%
Construction, land development, and other land		85,666			3.9	%		119,357			5.6	%
Commercial and industrial		390,331			17.6	%		309,097			14.4	%
Installment and other		2,726			0.1	%		2,021			0.1	%
Leasing financing receivables		134,193			6.0	%		118,493			5.5	%
Total originated loans	$	1,473,998			66.5	%	$	1,281,888			59.7	%
Acquired impaired loans
Commercial real estate	$	173,106			7.8	%	$	207,303			9.7	%
Residential real estate		152,149			6.9	%		175,717			8.2	%
Construction, land development, and other land		5,424			0.2	%		6,979			0.3	%
Commercial and industrial		11,433			0.5	%		13,464			0.6	%
Installment and other		488			0.0	%		574			0.0	%
Total acquired impaired loans	$	342,600			15.4	%	$	404,037			18.8	%
Acquired non-impaired loans
Commercial real estate	$	225,759			10.2	%	$	250,289			11.6	%
Residential real estate		32,451			1.5	%		40,853			1.9	%
Construction, land development, and other land		3,214			0.2	%		14,430			0.7	%
Commercial and industrial		100,291			4.5	%		115,677			5.4	%
Installment and other		38			0.0	%		364			0.0	%
Leasing financing receivables		38,148			1.7	%		40,473			1.9	%
Total acquired non-impaired loans	$	399,901			18.1	%	$	462,086			21.5	%
Total loans and leases	$	2,216,499			100.0	%	$	2,148,011			100.0	%
Allowance for loan and lease losses		(15,980	)					(10,923	)
Total loans and leases, net of allowance for loan and lease losses	$	2,200,519					$	2,137,088

Loans collateralized by real estate comprised 69.4% and 72.1% of the loan and lease portfolio at September 30, 2017 and December 31, 2016, respectively. Commercial real estate loans comprised the largest portion of the real estate loan portfolio as of September 30, 2017 and December 31, 2016 and totaled $861.9 million, or 56.0%, of real estate loans and 38.9% of the total loan and lease portfolio at September 30, 2017.  At December 31, 2016, commercial real estate loans totaled $796.3 million and comprised 51.4% of real estate loans and 37.1% of the total loan and lease portfolio. Acquired impaired commercial real estate loans continue to decrease from $207.3 million as of December 31, 2016 to $173.1 million as of September 30, 2017, or 16.5%.

Residential real estate loans totaled $582.7 million at September 30, 2017 compared to $610.7 million at December 31, 2016, a decrease of $28.1 million or 4.6%. The residential real estate loan portfolio comprised 37.9% and 39.5% of real estate

67

loans as of September 30, 2017 and December 31, 2016, respectively, and 26.3% and 28.4% of total loans and leases at September 30, 2017 and December 31, 2016, respectively. Acquired impaired residential real estate loans continue to decrease from $175.7 million as of December 31, 2016 to $152.1 million as of September 30, 2017, or 13.4%.

Construction, land development and other land loans totaled $94.3 million at September 30, 2017 compared to $140.8 million at December 31, 2016, a decrease of $46.5 million or 33.0%. The construction, land development and other land loan portfolio comprised 6.1% and 9.1% of real estate loans as of September 30, 2017 and December 31, 2016, respectively, and 4.2% and 6.6% of the total loan and lease portfolio as of September 30, 2017 and December 31, 2016, respectively.

Commercial and industrial loans totaled $502.1 million and $438.2 million at September 30, 2017 and December 31, 2016, respectively, an increase of $63.9 million or 14.6% primarily due to organic growth. The commercial and industrial loan portfolio comprised 22.7% and 20.4% of the total loan and lease portfolio as of September 30, 2017 and December 31, 2016, respectively.

Lease financing receivables comprised 7.8% and 7.4% of the loan and lease portfolio as of September 30, 2017 and December 31, 2016, respectively. Total lease financing receivables were $172.3 million and $159.0 million at September 30, 2017 and December 31, 2016, respectively, an increase of $13.3 million, or 8.4%, due to continued growth in our small-ticket vendor sales channels, and our increased syndication activities.

Loan Portfolio Maturities and Interest Rate Sensitivity

The following table shows our loan and lease portfolio by scheduled maturity at September 30, 2017 (dollars in thousands):

	Due in One Year or Less				Due after One Year Through Five Years				Due after Five Years
	Fixed Rate		Floating Rate		Fixed Rate		Floating Rate		Fixed Rate		Floating Rate		Total
Originated loans
Commercial real estate	$	14,158	$	28,802	$	123,502	$	175,718	$	23,926	$	96,914	$	463,020
Residential real estate		324		17,560		80,789		53,925		227,473		17,991		398,062
Construction, land development, and other land		1,930		32,995		9,317		30,722		—		10,702		85,666
Commercial and industrial		9,635		32,130		14,909		211,436		5,518		116,703		390,331
Installment and other		26		1,629		602		—		469		—		2,726
Leasing financing receivables		2,794		—		120,532		—		10,867		—		134,193
Total originated loans	$	28,867	$	113,116	$	349,651	$	471,801	$	268,253	$	242,310	$	1,473,998
Acquired impaired loans
Commercial real estate	$	48,136	$	468	$	110,779	$	359	$	5,331	$	8,033	$	173,106
Residential real estate		40,340		555		87,188		2,522		21,423		121		152,149
Construction, land development, and other land		1,221		158		3,508		—		133		404		5,424
Commercial and industrial		2,737		207		1,080		259		3,106		4,044		11,433
Installment and other		48		—		173		—		267		—		488
Total acquired impaired loans	$	92,482	$	1,388	$	202,728	$	3,140	$	30,260	$	12,602	$	342,600
Acquired non-impaired loans
Commercial real estate	$	20,286	$	2,099	$	46,670	$	3,387	$	1,747	$	151,570	$	225,759
Residential real estate		6,669		5,503		9,368		9,288		1,159		464		32,451
Construction, land development, and other land		678		—		1,662		—		—		874		3,214
Commercial and industrial		3,368		5,187		1,338		12,454		298		77,646		100,291
Installment and other		36		2		—		—		—		—		38
Leasing financing receivables		3,468		—		31,651		—		3,029		—		38,148
Total acquired non-impaired loans	$	34,505	$	12,791	$	90,689	$	25,129	$	6,233	$	230,554	$	399,901
Total loans	$	155,854	$	127,295	$	643,068	$	500,070	$	304,746	$	485,466	$	2,216,499

68

At September 30, 2017, 49.8% of the loan and lease portfolio bears interest at fixed rates and 50.2% at floating rates. The expected life of our loan portfolio will differ from contractual maturities because borrowers may have the right to curtail or prepay their loans with or without penalties. Because a portion of the portfolio is accounted for under ASC 310-30, the carrying value is significantly affected by estimates and it is impracticable to allocate scheduled payments for those loans based on those estimates. Consequently, the tables above include information limited to contractual maturities of the underlying loans.

Allowance for Loan and Lease Losses

The ALLL is determined by us on a quarterly basis, although we are engaged in monitoring the appropriate level of the allowance on a more frequent basis. The ALLL reflects management’s estimate of probable incurred credit losses inherent in the loan and lease portfolios. The computation includes element of judgement and high levels of subjectivity.

Factors considered by us include, but are not limited to, actual loss experience, peer loss experience, changes in size and risk profile of the portfolio, identification of individual problem loan and lease situations which may affect a borrower’s ability to repay, and evaluation of the prevailing economic conditions. Changes in conditions may necessitate revision of the estimate in future periods.

We assess the ALLL based on three categories: (i) originated loans and leases, (ii) acquired non-impaired loans and leases, and (iii) acquired impaired loans with further credit deterioration after the acquisition or recapitalization.

Total ALLL was $16.0 million at September 30, 2017 compared to $10.9 million at December 31, 2016, an increase of $5.1 million, or 46.3%. The increase was primarily due to the overall portfolio growth and increased weighting of our qualitative factors.

Total ALLL was 0.72% and 0.51% of total loans and leases at September 30, 2017 and December 31, 2016, respectively. This ratio is generally below the median of our peer banks, as we valued significant amounts of acquired loans at fair value at acquisition date as a result of the Recapitalization and the Ridgestone acquisition, which, management believes limits the amount of reserves needed to cover these loans as of September 30, 2017 and December 31, 2016, in accordance with applicable accounting guidance. Acquisition accounting adjustments remaining balances resulting from the Recapitalization and the Ridgestone acquisition totaled $34.2 million and $43.2 million as of September 30, 2017 and December 31, 2016, respectively.

69

The following table presents an analysis of the allowance of the loan and lease losses for the periods presented (dollars in thousands):

	Commercial Real Estate			Residential Real Estate			Construction, Land Development, and Other Land			Commercial and Industrial			Installment and Other			Lease Financing Receivables			Total
Balance at June 30, 2017	$	3,668		$	1,835		$	327		$	5,689		$	344		$	2,106		$	13,969
Provision for acquired impaired loans		493			45			36			375			5			—			954
Provision for acquired non-impaired loans and leases		818			96			(18	)		613			5			78			1,592
Provision for originated loans		266			(89	)		(129	)		452			3			851			1,354
Total provision	$	1,577		$	52		$	(111	)	$	1,440		$	13		$	929		$	3,900
Charge-offs for acquired impaired loans		(186	)		(73	)		—			(136	)		—			—			(395	)
Charge-offs for acquired non-impaired loans and leases		—			(88	)		—			(627	)		(327	)		(33	)		(1,075	)
Charge-offs for originated loans and leases		—			—			—			—			—			(829	)		(829	)
Total charge-offs	$	(186	)	$	(161	)	$	—		$	(763	)	$	(327	)	$	(862	)	$	(2,299	)
Recoveries for acquired impaired loans		—			—			—			—			—			—			—
Recoveries for acquired non-impaired loans and leases		—			—			—			—			—			—			—
Recoveries for originated loans and leases		—			—			—			—			—			410			410
Total recoveries	$	—		$	—		$	—		$	—		$	—		$	410		$	410
Net charge-offs		186			161			—			763			327			452			1,889
Acquired impaired loans		2,029			313			61			1,392			18			—			3,813
Acquired non-impaired loans and leases		942			400			3			1,615			4			556			3,520
Originated loans and leases		2,088			1,013			152			3,359			8			2,027			8,647
Balance at September 30, 2017	$	5,059		$	1,726		$	216		$	6,366		$	30		$	2,583		$	15,980
Ending ALLL balance
Acquired impaired loans	$	2,029		$	313		$	61		$	1,392		$	18		$	—		$	3,813
Acquired non-impaired loans and leases and originated loans individually evaluated for impairment		1,186			176			—			1,585			2			—			2,949
Acquired non-impaired loans and leases and originated loans and leases collectively evaluated for impairment		1,844			1,237			155			3,389			10			2,583			9,218
Loans and leases ending balance
Acquired impaired loans	$	173,106		$	152,149		$	5,424		$	11,433		$	488		$	—		$	342,600
Acquired non-impaired loans and leases and originated loans individually evaluated for impairment		14,928			1,948			565			6,075			2			—			23,518
Acquired non-impaired loans and leases and originated loans and leases collectively evaluated for impairment		673,851			428,565			88,315			484,547			2,762			172,341			1,850,381
Total loans and leases at September 30, 2017, gross	$	861,885		$	582,662		$	94,304		$	502,055		$	3,252		$	172,341		$	2,216,499
Ratio of net charge-offs to average loans and leases outstanding during the period
Acquired impaired loans		0.03	%		0.01	%		0.00	%		0.02	%		0.00	%		0.00	%		0.07	%
Acquired non-impaired loans and leases		0.00	%		0.02	%		0.00	%		0.11	%		0.06	%		0.01	%		0.19	%
Originated loans and leases		0.00	%		0.00	%		0.00	%		0.00	%		0.00	%		0.08	%		0.08	%
Loans and leases ending balance as a percentage of total loans and leases, gross
Acquired impaired loans		7.81	%		6.86	%		0.24	%		0.52	%		0.02	%		0.00	%		15.46	%
Acquired non-impaired loans and leases and originated loans individually evaluated for impairment		0.67	%		0.09	%		0.03	%		0.27	%		0.00	%		0.00	%		1.06	%
Acquired non-impaired loans and leases and originated loans and leases collectively evaluated for impairment		30.40	%		19.34	%		3.98	%		21.86	%		0.12	%		7.78	%		83.48	%

70

	Commercial Real Estate			Residential Real Estate			Construction, Land Development, and Other Land			Commercial and Industrial			Installment and Other			Lease Financing Receivables			Total
Balance at December 31, 2016	$	1,945		$	2,483		$	742		$	4,196		$	334		$	1,223		$	10,923
Provision for acquired impaired loans		2,017			95			61			1,039			17			—			3,229
Provision for acquired non-impaired loans and leases		827			184			(7	)		2,500			3			519			4,026
Provision for originated loans		747			(679	)		(580	)		393			3			2,167			2,051
Total provision	$	3,591		$	(400	)	$	(526	)	$	3,932		$	23		$	2,686		$	9,306
Charge-offs for acquired impaired loans		(477	)		(229	)		—			(321	)		—			—			(1,027	)
Charge-offs for acquired non-impaired loans and leases		—			(128	)		—			(959	)		(327	)		(500	)		(1,914	)
Charge-offs for originated loans and leases		—			—			—			(482	)		—			(1,899	)		(2,381	)
Total charge-offs	$	(477	)	$	(357	)	$	—		$	(1,762	)	$	(327	)	$	(2,399	)	$	(5,322	)
Recoveries for acquired impaired loans		—			—			—			—			—			—			—
Recoveries for acquired non-impaired loans and leases		—			—			—			—			—			259			259
Recoveries for originated loans and leases		—			—			—			—			—			814			814
Total recoveries	$	—		$	—		$	—		$	—		$	—		$	1,073		$	1,073
Net charge-offs		477			357			—			1,762			327			1,326			4,249
Acquired impaired loans		2,029			313			61			1,392			18			—			3,813
Acquired non-impaired loans and leases		942			400			3			1,615			4			556			3,520
Originated loans and leases		2,088			1,013			152			3,359			8			2,027			8,647
Balance at September 30, 2017	$	5,059		$	1,726		$	216		$	6,366		$	30		$	2,583		$	15,980
Ending ALLL balance
Acquired impaired loans	$	2,029		$	313		$	61		$	1,392		$	18		$	—		$	3,813
Acquired non-impaired loans and leases and originated loans individually evaluated for impairment		1,186			176			—			1,585			2			—			2,949
Acquired non-impaired loans and leases and originated loans and leases collectively evaluated for impairment		1,844			1,237			155			3,389			10			2,583			9,218
Loans and leases ending balance
Acquired impaired loans	$	173,106		$	152,149		$	5,424		$	11,433		$	488		$	—		$	342,600
Acquired non-impaired loans and leases and originated loans individually evaluated for impairment		14,928			1,948			565			6,075			2			—			23,518
Acquired non-impaired loans and leases and originated loans and leases collectively evaluated for impairment		673,851			428,565			88,315			484,547			2,762			172,341			1,850,381
Total loans and leases at September 30, 2017, gross	$	861,885		$	582,662		$	94,304		$	502,055		$	3,252		$	172,341		$	2,216,499
Ratio of net charge-offs to average loans and leases outstanding during the period
Acquired impaired loans		0.03	%		0.01	%		0.00	%		0.02	%		0.00	%		0.00	%		0.06	%
Acquired non-impaired loans and leases		0.00	%		0.01	%		0.00	%		0.06	%		0.02	%		0.01	%		0.10	%
Originated loans and leases		0.00	%		0.00	%		0.00	%		0.03	%		0.00	%		0.07	%		0.10	%
Loans and leases ending balance as a percentage of total loans and leases, gross
Acquired impaired loans		7.81	%		6.86	%		0.24	%		0.52	%		0.02	%		0.00	%		15.46	%
Acquired non-impaired loans and leases and originated loans individually evaluated for impairment		0.67	%		0.09	%		0.03	%		0.27	%		0.00	%		0.00	%		1.06	%
Acquired non-impaired loans and leases and originated loans and leases collectively evaluated for impairment		30.40	%		19.34	%		3.98	%		21.86	%		0.12	%		7.78	%		83.48	%

71

	Commercial Real Estate			Residential Real Estate			Construction, Land Development, and Other Land			Commercial and Industrial			Installment and Other			Lease Financing Receivables			Total
Balance at June 30, 2016	$	2,119		$	1,303		$	489		$	1,472		$	367		$	740		$	6,490
Provision for acquired impaired loans		205			(89	)		(48	)		(10	)		—			—			58
Provision for acquired non-impaired loans and leases		(1,307	)		(16	)		(5	)		1			(1	)		(327	)		(1,655	)
Provision for originated loans		1,129			146			119			633			(2	)		1,255			3,280
Total provision	$	27		$	41		$	66		$	624		$	(3	)	$	928		$	1,683
Charge-offs for acquired impaired loans		(64	)		25			—			(2	)		(9	)		—			(50	)
Charge-offs for acquired non-impaired loans and leases		(3	)		—			—			—			—			(39	)		(42	)
Charge-offs for originated loans and leases		(1,011	)		—			(95	)		—			—			(632	)		(1,738	)
Total charge-offs	$	(1,078	)	$	25		$	(95	)	$	(2	)	$	(9	)	$	(671	)	$	(1,830	)
Recoveries for acquired impaired loans		—			—			—			—			—			—			—
Recoveries for acquired non-impaired loans and leases		—			—			—			—			—			14			14
Recoveries for originated loans and leases		—			—			—			—			—			144			144
Total recoveries	$	—		$	—		$	—		$	—		$	—		$	158		$	158
Net charge-offs (recoveries)		1,078			(25	)		95			2			9			513			1,672
Acquired impaired loans		448			494			—			638			26			—			1,606
Acquired non-impaired loans and leases		74			326			9			49			328			203			989
Originated loans and leases		546			549			451			1,407			1			952			3,906
Balance at September 30, 2016	$	1,068		$	1,369		$	460		$	2,094		$	355		$	1,155		$	6,501
Ending ALLL balance
Acquired impaired loans	$	399		$	496		$	47		$	638		$	26		$	—		$	1,606
Acquired non-impaired loans and leases and originated loans individually evaluated for impairment		—			339			—			192			328			—			859
Acquired non-impaired loans and leases and originated loans and leases collectively evaluated for impairment		669			534			413			1,264			1			1,155			4,036
Loans and leases ending balance
Acquired impaired loans	$	187,359		$	185,979		$	7,539		$	6,512		$	590		$	—		$	387,979
Acquired non-impaired loans and leases and originated loans individually evaluated for impairment		6,374			2,553			—			192			328			—			9,447
Acquired non-impaired loans and leases and originated loans and leases collectively evaluated for impairment		377,090			438,446			104,369			244,566			1,055			154,557			1,320,083
Total loans and leases at September 30, 2016, gross	$	570,823		$	626,978		$	111,908		$	251,270		$	1,973		$	154,557		$	1,717,509
Ratio of net charge-offs to average loans and leases outstanding during the period
Acquired impaired loans		0.02	%		-0.01	%		0.00	%		0.00	%		0.00	%		0.00	%		0.01	%
Acquired non-impaired loans and leases		0.00	%		0.00	%		0.00	%		0.00	%		0.00	%		0.01	%		0.01	%
Originated loans and leases		0.24	%		0.00	%		0.02	%		0.00	%		0.00	%		0.12	%		0.38	%
Loans and leases ending balance as a percentage of total loans and leases, gross
Acquired impaired loans		10.91	%		10.83	%		0.44	%		0.38	%		0.03	%		0.00	%		22.59	%
Acquired non-impaired loans and leases and originated loans individually evaluated for impairment		0.37	%		0.15	%		0.00	%		0.01	%		0.02	%		0.00	%		0.55	%
Acquired non-impaired loans and leases and originated loans and leases collectively evaluated for impairment		21.96	%		25.53	%		6.08	%		14.24	%		0.06	%		9.00	%		76.86	%

72

	Commercial Real Estate			Residential Real Estate			Construction, Land Development, and Other Land			Commercial and Industrial			Installment and Other			Lease Financing Receivables			Total
Balance at December 31, 2015	$	2,280		$	2,981		$	232		$	1,403		$	357		$	379		$	7,632
Provision for acquired impaired loans		2,965			(935	)		—			76			5			—			2,111
Provision for acquired non-impaired loans and leases		(1,117	)		(86	)		9			3			2			355			(834	)
Provision for originated loans		1,202			41			314			689			1			1,824			4,071
Total provision	$	3,050		$	(980	)	$	323		$	768		$	8		$	2,179		$	5,348
Charge-offs for acquired impaired loans		(3,251	)		(461	)		—			(74	)		(9	)		—			(3,795	)
Charge-offs for acquired non-impaired loans and leases		—			(171	)		—			(3	)		(1	)		(454	)		(629	)
Charge-offs for originated loans and leases		(1,011	)		—			(95	)		—			—			(1,480	)		(2,586	)
Total charge-offs	$	(4,262	)	$	(632	)	$	(95	)	$	(77	)	$	(10	)	$	(1,934	)	$	(7,010	)
Recoveries for acquired impaired loans		—			—			—			—			—			—			—
Recoveries for acquired non-impaired loans and leases		—			—			—			—			—			143			143
Recoveries for originated loans and leases		—			—			—			—			—			388			388
Total recoveries	$	—		$	—		$	—		$	—		$	—		$	531		$	531
Net charge-offs		4,262			632			95			77			10			1,403			6,479
Acquired impaired loans		448			494			—			638			26			—			1,606
Acquired non-impaired loans and leases		74			326			9			49			328			203			989
Originated loans and leases		546			549			451			1,407			1			952			3,906
Balance at September 30, 2016	$	1,068		$	1,369		$	460		$	2,094		$	355		$	1,155		$	6,501
Ending ALLL balance
Acquired impaired loans	$	399		$	496		$	47		$	638		$	26		$	—		$	1,606
Acquired non-impaired loans and leases and originated loans individually evaluated for impairment		—			339			—			192			328			—			859
Acquired non-impaired loans and leases and originated loans and leases collectively evaluated for impairment		669			534			413			1,264			1			1,155			4,036
Loans and leases ending balance
Acquired impaired loans	$	187,359		$	185,979		$	7,539		$	6,512		$	590		$	—		$	387,979
Acquired non-impaired loans and leases and originated loans individually evaluated for impairment		6,374			2,553			—			192			328			—			9,447
Acquired non-impaired loans and leases and originated loans and leases collectively evaluated for impairment		377,090			438,446			104,369			244,566			1,055			154,557			1,320,083
Total loans and leases at September 30, 2016, gross	$	570,823		$	626,978		$	111,908		$	251,270		$	1,973		$	154,557		$	1,717,509
Ratio of net charge-offs to average loans and leases outstanding during the period
Acquired impaired loans		0.28	%		0.04	%		0.00	%		0.01	%		0.00	%		0.00	%		0.33	%
Acquired non-impaired loans and leases		0.00	%		0.01	%		0.00	%		0.00	%		0.00	%		0.03	%		0.04	%
Originated loans and leases		0.09	%		0.00	%		0.01	%		0.00	%		0.00	%		0.09	%		0.19	%
Loans and leases ending balance as a percentage of total loans and leases, gross
Acquired impaired loans		10.91	%		10.83	%		0.44	%		0.38	%		0.03	%		0.00	%		22.59	%
Acquired non-impaired loans and leases and originated loans individually evaluated for impairment		0.37	%		0.15	%		0.00	%		0.01	%		0.02	%		0.00	%		0.55	%
Acquired non-impaired loans and leases and originated loans and leases collectively evaluated for impairment		21.96	%		25.53	%		6.08	%		14.24	%		0.06	%		9.00	%		76.86	%

73

Non-Performing Assets

Non-performing loans and leases include loans and leases 90 days past due and still accruing, loans and leases accounted for on a non-accrual basis and accruing restructured loans. Non-performing assets consist of non-performing loans and leases plus other real estate owned. Non-accrual loans and leases as of September 30, 2017 and December 31, 2016 totaled $15.1 million and $6.8 million, respectively. The increase of non-performing assets from December 31, 2016 to September 30, 2017 was primarily due to an increase in non-accrual loans of $8.3 million, primarily in the government guaranteed loan portfolio, partially offset by a decrease in other real estate owned of $2.7 million.

Total OREO held by us was $13.9 million as of September 30, 2017, a decrease of $2.7 million from December 31, 2016.  The decrease in OREO resulted from dispositions of $8.0 million and valuation adjustments of $367,000, offset by additions to OREO through loan foreclosures totaling $5.7 million.  

The following table sets forth the amounts of non-performing loans and leases, non-performing assets, and OREO at the dates indicated (dollars in thousands):

	September 30, 2017			December 31, 2016
Non-accrual loans and leases(1)(2)(3)	$	15,121		$	6,784
Past due loans and leases 90 days or more and still    accruing interest		—			—
Accruing troubled debt restructured loans		1,631			602
Total non-performing loans and leases		16,752			7,386
Other real estate owned		13,859			16,570
Total non-performing assets	$	30,611		$	23,956
Total non-performing loans as a percentage of total loans    and leases		0.76	%		0.34	%
Total non-performing assets as a percentage of    total assets		0.93	%		0.73	%
Allowance for loan and lease losses as a percentage of    non-performing loans and leases		95.39	%		147.89	%

(1) Includes $656,000 and $552,000 of non-accrual restructured loans at September 30, 2017 and December 31, 2016.

(2) For the nine months ended September 30, 2017, $977,000 in interest income would have been recorded had non-accrual loans been current; the amount of interest we recorded on these loans was $186,000.

(3) For the nine months ended September 30, 2017, $49,000 in interest income would have been recorded had troubled debt restructurings included within non-accrual loans been current.

Acquired impaired loans (accounted for under ASC 310-30) that are delinquent and/or on non-accrual status continue to accrue income provided the respective pool in which those assets reside maintains a discount and recognizes accretion income. The aforementioned loans are characterized as performing loans based on contractual delinquency. If the pool no longer has a discount and accretion income can no longer be recognized, any loan within that pool on non-accrual status will be classified as non-accrual for presentation purposes.

Total non-accrual loans increased by $8.3 million between December 31, 2016 and September 30, 2017 due to additional non-accrual loans primarily from the government guaranteed loan portfolio. The government guaranteed portion on non-accrual loans totaled $4.1 million at September 30, 2017.

74

Total accruing loans past due decreased from $14.1 million at December 31, 2016 to $7.5 million at September 30, 2017. The following table summarizes the recorded investment, unpaid principal balance, related allowance, average recorded investment, and interest income recognized for loans and leases considered impaired as of the periods indicated (dollars in thousands):

	September 30, 2017
	Unpaid Principal Balance of Impaired Loans		Impaired Non-ASC 310-30 Loans with a Specific Allowance		Impaired Non-ASC 310-30 Loans with no Specific Allowance Recorded		Specific Allowance Allocated to Impaired Loans		Average Recorded Investment in Impaired Loans		Interest Income Recognized on Impaired Loans
Commercial real estate	$	15,670	$	5,387	$	9,541	$	1,186	$	11,648	$	706
Residential real estate		2,976		367		1,581		176		2,142		37
Construction, land development, and other land		565		—		565		—		288		2
Commercial and industrial		6,586		2,610		3,465		1,585		4,064		753
Installment and other		310		2		—		2		213		11
Total impaired loans held in portfolio,    net	$	26,107	$	8,366	$	15,152	$	2,949	$	18,355	$	1,509

	December 31, 2016
	Unpaid Principal Balance of Impaired Loans		Impaired Non-ASC 310-30 Loans with a Specific Allowance		Impaired Non-ASC 310-30 Loans with no Specific Allowance Recorded		Specific Allowance Allocated to Impaired Loans		Average Recorded Investment in Impaired Loans		Interest Income Recognized on Impaired Loans
Commercial real estate	$	9,502	$	—	$	8,916	$	—	$	8,975	$	305
Residential real estate		2,527		496		804		293		1,346		46
Commercial and industrial		1,393		861		521		396		1,430		(2	)
Installment and other		361		328		—		328		328		16
Total impaired loans held in    portfolio, net	$	13,783	$	1,685	$	10,241	$	1,017	$	12,079	$	365

Deposits

Total deposits at September 30, 2017 were $2.5 billion, representing an increase of $30.5 million, or 1.2%, compared to December 31, 2016.  Non-interest bearing deposits were $753.7 million or 29.9% of total deposits, at September 30, 2017, an increase of $29.2 million or 4.0% compared to $724.5 million at December 31, 2016 or 29.1% of total deposits.  Interest bearing transaction accounts increased $51.4 million for the first nine months of 2017.  Time deposits decreased $50.0 million, or 6.4%, from $776.5 million at December 31, 2016 to $726.5 million at September 30, 2017. Core deposits remained stable at 86.2% of total deposits at September 30, 2017.

The increase in non-interest bearing deposits was driven by new deposit relationships.  Our cost of deposits was 33 basis points during the third quarter of 2017 compared to 19 basis points during the third quarter of 2016, and 30 basis points during the second quarter of 2017.  These increases are primarily attributed to an increase in interest rates on our time deposits. We had no brokered time deposits as of September 30, 2017 compared to $30.8 million at December 31, 2016.

As the time deposits we acquired as part of the Ridgestone acquisition mature, the acquisition accounting benefit to our cost of deposits declines. We anticipate a further decline in the fair value accounting adjustment benefit on our time deposits in the fourth quarter of 2017, although to a lesser extent than the impact in the third quarter 2017.

We gather deposits primarily through each of our 56 branch locations in the Chicago metropolitan area and one branch in Brookfield, Wisconsin. Through our branch network, online, mobile and direct banking channels, we offer a variety of deposit products including demand deposit accounts, interest-bearing products, savings accounts, and certificates of deposit.

75

We offer competitive online, mobile and direct banking channels. Small businesses are a significant source of low cost deposits as they value convenience, flexibility and access to local decision makers that are responsive to their needs.

The following table shows the average balance amounts and the average rates paid on our deposits for the periods indicated (dollars in thousands):

	For the Three Months Ended September 30, 2017					For the Three Months Ended September 30, 2016
	Average Balance		Average Rate			Average Balance		Average Rate
Non-interest-bearing deposits	$	748,523		0.00	%	$	653,642		0.00	%
Interest-bearing checking accounts		186,447		0.06	%		185,583		0.06	%
Money market demand accounts		388,365		0.28	%		406,531		0.26	%
Other savings		441,096		0.07	%		442,269		0.07	%
Time deposits (below $100,000)		394,984		0.77	%		288,682		0.47	%
Time deposits ($100,000 and above)		363,534		1.05	%		218,888		0.64	%
Total	$	2,522,949		0.33	%	$	2,195,595		0.19	%

	For the Nine Months Ended September 30, 2017					For the Nine Months Ended September 30, 2016
	Average Balance		Average Rate			Average Balance		Average Rate
Non-interest-bearing deposits		736,982		0.00	%		650,803		0.00	%
Interest-bearing checking accounts		185,409		0.06	%		187,159		0.07	%
Money market demand accounts		376,751		0.25	%		399,240		0.25	%
Other savings		445,082		0.07	%		441,773		0.07	%
Time deposits (below $100,000)		400,927		0.70	%		304,697		0.46	%
Time deposits ($100,000 and above)		381,745		0.84	%		221,819		0.70	%
Total	$	2,526,896		0.29	%	$	2,205,491		0.20	%

The following table shows time deposits and other time deposits of $100,000 or more by time remaining until maturity:

	At September 30, 2017
	Time Deposits
Three months or less	$	89,480
Over three months through six months		33,170
Over six months through 12 months		172,639
Over 12 months		53,275
Total	$	348,564

Borrowed Funds

In addition to deposits, we also utilize FHLB advances as a supplementary funding source to finance our operations. The Bank’s advances from the FHLB are collateralized by residential, multi-family real estate loans and securities. At September 30, 2017 and December 31, 2016, our bank had borrowing capacity from the FHLB of $913.0 million and $961.8 million, respectively, subject to the availability of collateral. During the nine months ended September 30, 2017, outstanding FHLB advances decreased to $234.6 million, from $313.7 million at December 31, 2016.

76

The following table sets forth certain information regarding our short-term borrowings at the dates and for the periods indicated (dollars in thousands):

	Nine MonthsEnded September 30,
	2017			2016
Federal Home Loan Bank advances:
Average balance outstanding	$	249,630		$	124,277
Maximum outstanding at any month-end period during    the year		374,487			190,000
Balance outstanding at end of period		234,559			183,000
Weighted average interest rate during period		1.22	%		0.40	%
Weighted average interest rate at end of period		1.32	%		0.41	%
Line of credit:
Average balance outstanding	$	12,287		n/a
Maximum outstanding at any month-end period during    the year		20,650		n/a
Balance outstanding at end of period		—		n/a
Weighted average interest rate during period		3.92	%	n/a
Weighted average interest rate at end of period		4.25	%	n/a

The following table shows the scheduled maturities of our Bank’s FHLB advances and weighted average interest rates at September 30, 2017 (dollars in thousands):

Scheduled Maturities	Amount		Weighted Average Rates
2017	$	225,000		1.24	%
2018		9,559		3.21	%
Total	$	234,559		1.32	%

Customer Repurchase Agreements (Sweeps)

Securities sold under agreements to repurchase represent a demand deposit product offered to customers that sweep balances in excess of the FDIC insurance limit into overnight repurchase agreements. We pledge securities as collateral for the repurchase agreements.  Securities sold under agreements to repurchase totaled $30.8 million at September 30, 2017, an increase of $13.6 million compared to December 31, 2016.

Liquidity

We manage liquidity based upon factors that include the amount of core deposits as a percentage of total deposits, the level of diversification of our funding sources, the amount of non-deposit funding used to fund assets, the availability of unused funding sources, off-balance sheet obligations, the availability of assets to be readily converted into cash without undue loss, the amount of cash and liquid securities we hold and the re-pricing characteristics and maturities of our assets when compared to the re-pricing characteristics of our liabilities, the ability to securitize and sell certain pools of assets and other factors.

Our liquidity needs are primarily met by cash and investment securities positions, growth in deposits, cash flow from amortizing loan portfolios, and borrowings from the FHLB. For additional information regarding our operating, investing, and financing cash flows, see “Consolidated Statements of Cash Flows” in our Unaudited Interim Condensed Consolidated Financial Statements included elsewhere in this report.

As of September 30, 2017, we held $62.2 million in cash and cash equivalents. We maintain an investment securities portfolio of various holdings, types and maturities. We had securities available for sale of $584.7 million and securities held-to-maturity of $121.5 million as of September 30, 2017, including total unpledged securities of $480.9 million.

77

As of September 30, 2017, Byline Bank had maximum borrowing capacity from the FHLB of $1.1 billion and from the Federal Reserve Bank of $135.3 million. As of September 30, 2017, Byline Bank had open advances of $234.5 million and open letters of credit of $300,000, leaving us with available aggregate borrowing capacity of $1.0 billion. In addition, Byline Bank had uncommitted federal funds lines available of $40.0 million.

As of December 31, 2016, Byline Bank had maximum borrowing capacity from the FHLB of $961.8 million and from the Federal Reserve Bank of $110.6 million. As of December 31, 2016, Byline Bank had open advances of $313.5 million and open letters of credit of $400,000, leaving us with available aggregate borrowing capacity of $758.5 million. In addition, Byline Bank had an uncommitted federal funds line available of $20.0 million.

On October 13, 2016, we entered into a $30.0 million revolving credit agreement with The PrivateBank and Trust Company, now known as CIBC Bank USA (“CIBC”). As of December 31, 2016, this revolving line of credit had an outstanding balance of $20.7 million. On April 13, 2017, the revolving line of credit was amended to a non-revolving line of credit as long as the outstanding balance exceeds $5.0 million. When the outstanding balance reaches $5.0 million, the line of credit will be converted to a revolving line of credit with credit availability up to $5.0 million until maturity on October 12, 2017. On October 12, 2017 we amended the credit agreement, which extended the maturity date to October 11, 2018.  The amended revolving line of credit bears interest at either LIBOR Rate plus 250 basis points or the Prime Rate minus 25 basis points, based on our election. As of September 30, 2017, the Company had no balance outstanding on the line of credit.  We repaid the amount outstanding on the line of credit with a portion of the proceeds from our initial public offering during July 2017.

There are regulatory limitations that affect the ability of Byline Bank to pay dividends to the Company. See Note 21 of Byline’s Consolidated Financial Statements as of December 31, 2016 and 2015, included in our prospectus in connection with our initial public offering that we filed with the SEC on July 3, 2017, for additional information. Management believes that such limitations will not impact our ability to meet our ongoing short-term cash obligations.

Capital Resources

Stockholders’ equity at September 30, 2017 was $459.5 million compared to $382.7 million at December 31, 2016, an increase of $76.9 million, or 20.1%. The increase was primarily driven by the issuance of common stock, net of issuance costs of $76.8 million, in connection with our initial public offering on June 30, 2017 as well as retained earnings, offset by the repurchase of our Series A Preferred Stock totaling $25.5 million.  

The Company and Byline Bank are subject to various regulatory capital requirements administered by federal banking regulators. Failure to meet minimum capital requirements can initiate certain mandatory and possibly additional discretionary actions by federal banking regulators that, if undertaken, could have a direct material effect on our financial statements.

Under applicable bank regulatory capital requirements, each of the Company and Byline Bank must meet specific capital guidelines that involve quantitative measures of their assets, liabilities and certain off-balance sheet items as calculated under regulatory accounting practices. Byline Bank must also meet certain specific capital guidelines under the prompt corrective action framework. The capital amounts and classification are subject to qualitative judgments by the federal banking regulators about components, risk weightings and other factors. Quantitative measures established by regulation to ensure capital adequacy require the Company and Byline Bank to maintain minimum amounts and ratios of CET1 Capital, Tier 1 capital and total capital to risk-weighted assets and of Tier 1 capital to average consolidated assets, (referred to as the “leverage ratio”), as defined under these capital requirements.

As of September 30, 2017, Byline Bank exceeded all applicable regulatory capital requirements and was considered “well-capitalized”. There have been no conditions or events since September 30, 2017 that management believes have changed Byline Bank’s classifications.

78

The regulatory capital ratios for the Company and Byline Bank to meet the minimum capital adequacy standards and for Byline Bank to be considered well capitalized under the prompt corrective action framework and the Company’s and Byline Bank’s actual capital amounts and ratios are set forth in the following tables as of the periods indicated (dollars in thousands).

	Actual					Minimum Capital Required					Required for the Bank to be Considered Well Capitalized
September 30, 2017	Amount		Ratio			Amount		Ratio			Amount		Ratio
Total capital to risk weighted assets:
Company	$	399,542		16.08	%	$	198,807		8.00	%	N/A		N/A
Bank		356,132		14.30	%		199,306		8.00	%	$	249,133		10.00	%
Tier 1 capital to risk weighted assets:
Company	$	381,934		15.37	%	$	149,105		6.00	%	N/A		N/A
Bank		338,524		13.59	%		149,480		6.00	%	$	199,306		8.00	%
Common Equity Tier 1 (CET1) to risk weighted    assets:
Company	$	346,052		13.93	%	$	111,829		4.50	%	N/A		N/A
Bank		338,524		13.59	%		112,110		4.50	%	$	161,937		6.50	%
Tier 1 capital to average assets:
Company	$	381,934		11.95	%	$	127,796		4.00	%	N/A		N/A
Bank		338,524		10.57	%		128,135		4.00	%	$	160,169		5.00	%

	Actual					Minimum Capital Required					Required for the Bank to be Considered Well Capitalized
December 31, 2016	Amount		Ratio			Amount		Ratio			Amount		Ratio
Total capital to risk weighted assets:
Company	$	316,314		13.28	%	$	190,257		8.00	%	N/A		N/A
Bank		325,465		13.61	%		191,267		8.00	%	$	239,084		10.00	%
Tier 1 capital to risk weighted assets:
Company	$	304,324		12.78	%	$	142,895		6.00	%	N/A		N/A
Bank		313,474		13.11	%		143,450		6.00	%	$	191,267		8.00	%
Common Equity Tier 1 (CET1) to risk weighted    assets:
Company	$	266,760		11.20	%	$	107,171		4.50	%	N/A		N/A
Bank		313,474		13.11	%		107,588		4.50	%	$	155,404		6.50	%
Tier 1 capital to average assets:
Company	$	304,324		10.07	%	$	120,850		4.00	%	N/A		N/A
Bank		313,474		10.35	%		121,169		4.00	%	$	151,461		5.00	%

79

The Company and Byline Bank must maintain a capital conservation buffer consisting of CET1 capital greater than 2.5% of risk-weighted assets above the required minimum risk-based capital levels in order to avoid limitations on paying dividends, repurchasing shares, and paying discretionary bonuses. The capital conservation buffer requirement began to be phased in on January 1, 2016 when a buffer greater than 0.625% of risk-weighted assets was required, which amount increases each year until the buffer requirement is fully implemented on January 1, 2019. As of January 1, 2017 the capital conservation buffer requirement was 1.25%.  The conservation buffers for the Company and Byline Bank exceed the fully phased in minimum capital requirement as of September 30, 2017.

Provisions of state and federal banking regulations may limit, by statute, the amount of dividends that may be paid to the Company by Byline Bank without prior approval of Byline Bank’s regulatory agencies. The Company is economically dependent on the cash dividends received from Byline Bank. These dividends represent the primary cash flow from operating activities used to service obligations. For the nine months ended September 30, 2017, the Company received $2.2 million in cash dividends from Byline Bank to pay the line of credit interest, the trust preferred securities interest and preferred dividends.  There were no cash dividends received by the Company from Byline Bank for the year ended December 31, 2016.

Contractual Obligations

FHLB advances are fully described in Note 12 of our Unaudited Interim Condensed Consolidated Financial Statements, included elsewhere in this report. Operating lease obligations are in place for facilities and land on which banking facilities are located. See Note 15 of our Interim Unaudited Condensed Consolidated Financial Statements for additional information.

Off-Balance Sheet Items and Other Financing Arrangements

We are a party to financial instruments with off-balance sheet risk in the normal course of business to meet the financing needs of our customers. These financial instruments include commitments to extend credit, commercial letters of credit and standby letters of credit. Those instruments involve, to varying degrees, elements of credit and interest rate risk in excess of the amount recognized in the consolidated statements of financial condition. The contractual or notional amounts of those instruments reflect the extent of involvement we have in particular classes of financial instruments.

Commitments to extend credit are agreements to lend to a customer as long as there is no violation of any condition established in the contract. Commitments generally have fixed expiration dates or other termination clauses and may require payment of a fee. Since many of the commitments are expected to expire without being drawn upon, the total commitment amount does not necessarily represent future cash requirements. We evaluate each customer’s creditworthiness on a case-by-case basis. The amount of collateral obtained, if deemed necessary by Byline Bank upon extension of credit, is based on management’s credit evaluation of the counterparty. Collateral is primarily obtained in the form of commercial and residential real estate (including income producing commercial properties).

Standby letters of credit are conditional commitments issued by Byline Bank to guarantee to a third-party the performance of a customer. Those guarantees are primarily issued to support public and private borrowing arrangements, bond financing and similar transactions. The credit risk involved in issuing letters of credit is essentially the same as that involved in extending loan facilities to customers.

Commitments to make loans are generally made for periods of 90 days or less. The fixed rate loan commitments have interest rates ranging from 3.23% to 19.50% and maturities up to 2020. Variable rate loan commitments have interest rates ranging from 2.45% to 8.25% and maturities up to 2040.

Our exposure to credit loss in the event of non-performance by the other party to the financial instrument for commitments to extend credit and standby letters of credit is represented by the contractual or notional amount of those instruments. We use the same credit policies in making commitments and conditional obligations as for funded instruments. We do not anticipate any material losses as a result of the commitments and standby letters of credit.

80

The following table summarizes commitments as of the dates presented (dollars in thousands).

	September 30, 2017				December 31, 2016
	Fixed Rate		Variable Rate		Fixed Rate		Variable Rate
Commitments to extend credit	$	46,427	$	425,115	$	37,731	$	332,928
Standby letters of credit		1,050		3,655		1,060		4,135
Total	$	47,477	$	428,770	$	38,791	$	337,063

During the nine months ended September 30, 2017 and for the year ended December 31, 2016, we entered into interest rate swaps that are used to manage differences in the amount, timing, and duration of our known or expected cash receipts and its known or expected cash payments principally related to certain variable rate borrowings. We also entered into interest rate swaps with certain qualified borrowers to facilitate the borrowers’ risk management strategies and concurrently entered into mirror-image derivatives with a third party counterparty.

We recognize derivative financial instruments at fair value regardless of the purpose or intent for holding the instrument. We record derivative assets and derivative liabilities on the Consolidated Statements of Financial Condition within other assets and other liabilities, respectively. Because the derivative assets and liabilities recorded on the balance sheet at September 30, 2017 do not represent the amounts that may ultimately be paid under these contracts, these assets and liabilities are listed in the table below (dollars in thousands):

	September 30, 2017
			Fair Value
	Notional		Asset		Liability
Interest rate contracts—pay fixed, receive floating	$	250,000	$	3,265	$	545
Other interest rate swaps—pay fixed, receive floating		81,712		648		645

Non-GAAP Financial Measures

This report contains certain financial information determined by methods other than in accordance with accounting principles generally accepted in the United States of America (“GAAP”). These measures include net interest margin excluding accretion income, non-interest income to total revenues, pre-tax pre-provision return on average assets, tangible book value per share, and tangible common equity to tangible assets. Management believes that these non-GAAP financial measures provide useful information to management and investors that is supplementary to the Company’s financial condition, results of operations and cash flows computed in accordance with GAAP; however, management acknowledges that our non-GAAP financial measures have a number of limitations. As such, these disclosures should not be viewed as a substitute for results determined in accordance with GAAP financial measures that we and other companies use. Management also uses these measures for peer comparison. See “Reconciliation of Non-GAAP Financial Measures” in the following schedule for a reconciliation of the non-GAAP financial measures to the comparable GAAP financial measures.

Management uses the net interest margin excluding accretion income to assess the impact of acquisition accounting adjustment on the net interest margin. Management uses this to better assess the impact of acquisition accounting adjustment on net interest margin, as the effect of the loan discount accretion over the life of the loan may fluctuate based on the size of the acquisition, the decrease of acquired loan balances, or changes in cash flows.  

Non-interest income to total revenues is non-interest income divided by net interest income plus non-interest income. Management believes that it is standard practice in the industry to present non-interest income as a percentage of total revenue. Accordingly, management believes providing these measures may be useful for peer comparison.

Pre-tax pre-provision return on average assets is pre-tax income plus the provision for loan and lease losses, divided by average assets. Management believes this metric is important due to the tax benefit resulting from the reversal of the net deferred tax asset valuation allowance and demonstrates profitability excluding the tax benefit and excludes the provision for loan and lease losses.

Tangible book value per share is calculated as tangible common equity, which is stockholders’ equity reduced by preferred stock and goodwill and other intangible assets, divided by total shares of common stock outstanding. Management

81

believes this metric is important due to the relative changes in the book value per share exclusive of changes in intangible assets.

Tangible common equity to tangible assets is calculated as tangible common equity divided by tangible assets,  which is total assets reduced by goodwill and other intangible assets. Management believes this measure is important to investors and analysts interested in relative changes in the ratio of total stockholders’ equity to total assets, each exclusive of changes in intangible assets.

Reconciliations of Non-GAAP Financial Measures

	As of or For the Three Months Ended September 30,						As of or For the Nine Months Ended September 30,
(dollars in thousands, except share and per share data)	2017			2016			2017			2016
Net interest margin:
Reported net interest margin		4.18	%		3.37	%		4.07	%		3.46	%
Effect of accretion income on acquired loans		(0.29	)%		(0.19	)%		(0.28	)%		(0.08	)%
Net interest margin excluding accretion		3.89	%		3.18	%		3.79	%		3.38	%
Total revenues:
Net interest income	$	31,412		$	20,865		$	90,761		$	62,366
Add: Non-interest income		11,918			4,776			37,419			15,262
Total revenues	$	43,330		$	25,641		$	128,180		$	77,628
Non-interest income to total revenues:
Non-interest income	$	11,918		$	4,776		$	37,419		$	15,262
Total revenues		43,330			25,641			128,180			77,628
Non-interest income to total revenues		27.51	%		18.63	%		29.19	%		19.66	%
Pre-tax pre-provision net income:
Pre-tax income	$	8,365		$	1,574		$	29,709		$	2,592
Add: Provision for loan and lease losses		3,900			1,683			9,306			5,348
Pre-tax pre-provision net income	$	12,265		$	3,257		$	39,015		$	7,940
Pre-tax pre-provision return on average assets:
Total average assets	$	3,307,186		$	2,674,900		$	3,301,941		$	2,625,086
Pre-tax pre-provision net income		12,265			3,257			39,015			7,940
Pre-tax pre-provision return on average assets		1.47	%		0.48	%		1.58	%		0.40	%
Tangible common equity:
Total stockholders' equity	$	459,533		$	251,104		$	459,533		$	251,104
Less: Preferred stock		10,438			15,003			10,438			15,003
Less: Goodwill		51,975			25,688			51,975			25,688
Less: Core deposit intangibles and other intangibles		17,522			20,100			17,522			20,100
Tangible common equity	$	379,598		$	190,313		$	379,598		$	190,313
Tangible assets:
Total assets	$	3,305,442		$	2,747,929		$	3,305,442		$	2,747,929
Less: Goodwill		51,975			25,688			51,975			25,688
Less: Core deposit intangibles and other intangibles		17,522			20,100			17,522			20,100
Tangible assets	$	3,235,945		$	2,702,141		$	3,235,945		$	2,702,141
Tangible book value per share:
Tangible common equity	$	379,598		$	190,313		$	379,598		$	190,313
Shares of common stock outstanding		29,305,400			20,410,850			29,305,400			20,410,850
Tangible book value per share	$	12.95		$	9.32		$	12.95		$	9.32
Tangible common equity to tangible assets:
Tangible common equity	$	379,598		$	190,313		$	379,598		$	190,313
Tangible assets		3,235,945			2,702,141			3,235,945			2,702,141
Tangible common equity to tangible assets		11.73	%		7.04	%		11.73	%		7.04	%

82

Forward-Looking Statements

Statements contained in this Quarterly Report on Form 10-Q and in other documents we file with or furnish to the SEC that are not historical facts may constitute forward-looking statements within the meaning of the federal securities laws. Forward-looking statements include, without limitation, statements concerning plans, estimates, calculations, forecasts and projections with respect to the anticipated future performance of the Company and our business. These statements are often, but not always, made through the use of words or phrases such as ‘‘may’’, ‘‘might’’, ‘‘should’’, ‘‘could’’, ‘‘predict’’, ‘‘potential’’, ‘‘believe’’, ‘‘expect’’, ‘‘continue’’, ‘‘will’’, ‘‘anticipate’’, ‘‘seek’’, ‘‘estimate’’, ‘‘intend’’, ‘‘plan’’, ‘‘projection’’, ‘‘would’’, ‘‘annualized’’, “target” and ‘‘outlook’’, or the negative version of those words or other comparable words or phrases of a future or forward-looking nature. Forward-looking statements represent management’s current beliefs and expectations regarding future events, such as our anticipated future financial results, credit quality, liquidity, revenues, expenses, or other financial items, and the impact of business plans and strategies or legislative or regulatory actions.

Our ability to predict results or the actual effects of future plans, strategies or events is inherently uncertain. Factors which could cause actual results or conditions to differ materially from those reflected in forward-looking statements include:

• uncertainty regarding geopolitical developments and the U.S. and global economic outlook that may continue to impact market conditions or affect demand for certain banking products and services;

• unforeseen credit quality problems or changing economic conditions that could result in charge-offs greater than we have anticipated in our allowance for loan and lease losses or changes in the value of our investments;

• commercial real estate market conditions in the Chicago metropolitan area and southern Wisconsin;

• deterioration in the financial condition of our borrowers resulting in significant increases in our loan and lease losses and provisions for those losses and other related adverse impacts to our results of operations and financial condition;

• estimates of fair value of certain of our assets and liabilities, which could change in value significantly from period to period;

• competitive pressures in the financial services industry relating to both pricing and loan structures, which may impact our growth rate;

• unanticipated developments in pending or prospective loan and/or lease transactions or greater-than-expected paydowns or payoffs of existing loans;

• inaccurate assumptions in our analytical and forecasting models used to manage our loan and lease portfolio;

• unanticipated changes in monetary policies of the Federal Reserve or significant adjustments in the pace of, or market expectations for, future interest rate changes;

• availability of sufficient and cost-effective sources of liquidity or funding as and when needed;

• our ability to retain or the loss of key personnel or an inability to recruit appropriate talent cost-effectively;

• adverse effects on our information technology systems resulting from failures, human error or cyberattack, including the potential impact of disruptions or security breaches at our third-party service providers, any of which could result in an information or security breach, the disclosure or misuse of confidential or proprietary information, significant legal and financial losses and reputational harm;

• greater-than-anticipated costs to support the growth of our business, including investments in technology, process improvements or other infrastructure enhancements, or greater-than-anticipated compliance or regulatory costs and burdens;

83

• the impact of possible future acquisitions, if any, including the costs and burdens of integration efforts;

• the ability of the Company to receive dividends from its subsidiaries;

• changes in SBA rules, regulations and loan products, including specifically the Section 7(a) program, changes in SBA standard operating procedures or changes to the status of Byline Bank as an SBA Preferred Lender;

• changes in accounting principles, policies and guidelines applicable to bank holding companies and banking generally; or

• the impact of a possible change in the Federal income tax rate on our deferred tax assets and provision for income tax expense.

These factors should be considered in evaluating forward-looking statements, and you should not place undue reliance on any forward-looking statements, which speak only as of the date they are made. You should also consider the risks, assumptions and uncertainties set forth in the “Risk Factors” section of this Form 10-Q and in our prospectus in connection with our initial public offering that we filed with the SEC on July 3, 2017, and the “Management’s Discussion and Analysis of Financial Condition and Results of Operations” section of this Form 10-Q, as well as those set forth in our subsequent periodic and current reports filed with the SEC. We assume no obligation to update any of these statements in light of new information, future events or otherwise unless required under the federal securities laws.

84

Item 3. Quantitative and Qualitative Disclosures about Market Risk.

Our primary market risk is interest rate risk, which is defined as the risk of loss of net interest income or net interest margin because of changes in interest rates.

We seek to measure and manage the potential impact of interest rate risk. Interest rate risk occurs when interest-earning assets and interest-bearing liabilities mature or re-price at different times, on a different basis or in unequal amounts. Interest rate risk also arises when our assets, liabilities and off-balance sheet contracts each respond differently to changes in interest rates, including as a result of explicit and implicit provisions in agreements related to such assets and liabilities and in off-balance sheet contracts that alter the applicable interest rate and cash flow characteristics as interest rates change. The two primary examples of such provisions that we are exposed to are the duration and rate sensitivity associated with indeterminate-maturity deposits (e.g., non-interest-bearing checking accounts, negotiable order of withdrawal (“NOW”) accounts, savings accounts and money market deposits accounts (“MMDAs”) and the rate of prepayment associated with fixed-rate lending and mortgage-backed securities. Interest rates may also affect loan demand, credit losses, mortgage origination volume and other items affecting earnings.

We are also exposed to interest rate risk through the retained portion of the SBA loans we make and the related servicing rights. Our SBA loan portfolio is comprised primarily of SBA 7(a) loans, virtually all of which are quarterly or monthly adjustable with the prime rate. The SBA portfolio reacts differently in a rising rate environment than our other non-guaranteed portfolios. Generally, when interest rates rise, the prepayments in the SBA portfolio tend to increase.

Our management of interest rate risk is overseen by our bank’s asset liability committee, and is chaired by Byline Bank’s Treasurer, based on a risk management infrastructure approved by our board of directors that outlines reporting and measurement requirements. In particular, this infrastructure sets limits and management targets, calculated monthly, for various metrics, including our economic value sensitivity, our economic value of equity and net interest income simulations involving parallel shifts in interest rate curves, steepening and flattening yield curves, and various prepayment and deposit duration assumptions. Our risk management infrastructure also requires a periodic review of all key assumptions used, such as identifying appropriate interest rate scenarios, setting loan prepayment rates based on historical analysis, non-interest-bearing and interest-bearing demand deposit durations based on historical analysis and the targeted investment term of capital.

We manage the interest rate risk associated with our interest-bearing liabilities by managing the interest rates and tenors associated with our borrowings from the FHLB and deposits from our customers that we rely on for funding. In particular, from time to time we use special offers on deposits to alter the interest rates and tenors associated with our interest-bearing liabilities. We manage the interest rate risk associated with our interest-earning assets by managing the interest rates and tenors associated with our investment and loan portfolios, from time to time purchasing and selling investment securities and selling residential mortgage loans in the secondary market.

We utilize interest rate swaps to hedge our interest rate exposure on commercial loans when it meets our client and Byline Bank needs. Typically, customer interest rate swaps are for terms of more than 5 years. As of September 30, 2017, we had a notional amount of $331.7 million of interest rate swaps outstanding which includes customer swaps and those on Byline Bank’s balance sheet. The overall effectiveness of our hedging strategies is subject to market conditions, the quality of our execution, the accuracy of our valuation assumptions, the associated counterparty credit risk and changes in interest rates.

We do not engage in speculative trading activities relating to interest rates, foreign exchange rates, commodity prices, equities or credit.

We are also subject to credit risk. Credit risk is the risk that borrowers or counterparties will be unable or unwilling to repay their obligations in accordance with the underlying contractual terms. We manage and control credit risk in the loan and lease portfolio by adhering to well-defined underwriting criteria and account administration standards established by management. Written credit policies document underwriting standards, approval levels, exposure limits and other limits or standards deemed necessary and prudent. Portfolio diversification at the obligor, industry, product and/or geographic location levels is actively managed to mitigate concentration risk. In addition, credit risk management also includes an independent credit review process that assesses compliance with commercial, real estate and other credit policies, risk ratings and other critical credit information. In addition to implementing risk management practices that are based upon established and sound

85

lending practices, we adhere to sound credit principles. We understand and evaluate our customers’ borrowing needs and capacity to repay, in conjunction with their character and history.

Evaluation of Interest Rate Risk

We use a net interest income simulation model to measure and evaluate potential changes in our net interest income. We run various hypothetical interest rate scenarios at least monthly and compare these results against a scenario with no changes in interest rates. Our net interest income simulation model incorporates various assumptions, which we believe are reasonable but which may have a significant impact on results such as: (1) the timing of changes in interest rates, (2) shifts or rotations in the yield curve, (3) re-pricing characteristics for market-rate-sensitive instruments on and off balance sheet, (4) differing sensitivities of financial instruments due to differing underlying rate indices, (5) the effect of interest rate limitations in our assets, such as floors and caps, (6) the effect of our interest rate swaps and (7) overall growth and repayment rates and product mix of assets and liabilities. Because of limitations inherent in any approach used to measure interest rate risk, simulation results are not intended as a forecast of the actual effect of a change in market interest rates on our results but rather as a means to better plan and execute appropriate asset-liability management strategies and manage our interest rate risk.

Potential changes to our net interest income in hypothetical rising and declining rate scenarios calculated as of September 30, 2017 is presented in the following table. The projections assume (1) immediate, parallel shifts downward of the yield curve of 100 basis points and immediate, parallel shifts upward of the yield curve of 100, 200, 300 and 400 basis points and (2) gradual shifts downward of 100 basis points over 12 months and gradual shifts upward of 100 and 200 basis points over 12 months. In the current interest rate environment, a downward shift of the yield curve of 200, 300 and 400 basis points does not provide us with meaningful results. In a downward parallel shift of the yield curve, interest rates at the short-end of the yield curve are not modeled to decline any further than 0%. For the dynamic balance sheet and rate shift scenarios, we assume interest rates follow a forward yield curve and then ramp it up by 1/12th of the total change in rates each month for twelve months.

	Estimated Increase (Decrease) in Net Interest Income
	Twelve Months Ending			Twelve Months Ending
Change in Market Interest Rates as of September 30, 2017	September 30, 2018			September 30, 2019
Immediate Shifts
+400 basis points		12.2	%		11.1	%
+300 basis points		10.4	%		9.7	%
+200 basis points		7.8	%		7.5	%
+100 basis points		4.0	%		4.0	%
-100 basis points		(6.4	)%		(7.9	)%
Dynamic Balance Sheet and Rate Shifts
+200 basis points		6.9	%
+100 basis points		3.6	%
-100 basis points		(5.4	)%

The results of this simulation analysis are hypothetical, and a variety of factors might cause actual results to differ substantially from what is depicted. For example, if the timing and magnitude of interest rate changes differ from those projected, our net interest income might vary significantly. Non-parallel yield curve shifts such as a flattening or steepening of the yield curve or changes in interest rate spreads, would also cause our net interest income to be different from that depicted. An increasing interest rate environment could reduce projected net interest income if deposits and other short-term liabilities re-price faster than expected or faster than our assets re-price. Actual results could differ from those projected if we grow assets and liabilities faster or slower than estimated, if we experience a net outflow of deposit liabilities or if our mix of assets and liabilities otherwise changes. Actual results could also differ from those projected if we experience substantially different repayment speeds in our loan portfolio than those assumed in the simulation model. Finally, these simulation results do not contemplate all the actions that we may undertake in response to potential or actual changes in interest rates, such as changes to our loan, investment, deposit, funding or hedging strategies.

86

Item 4. Controls and Procedures.

The Company’s management, including our President and Chief Executive Officer and our Chief Financial Officer, have evaluated the effectiveness of our “disclosure controls and procedures” (as defined in Rules 13a-15(e) and 15d-15(e) under the Securities Exchange Act of 1934 (the “Exchange Act”)), as of the end of the period covered by this report.  Based on such evaluation, our President and Chief Executive Officer and our Chief Financial Officer have concluded that, as of September 30, 2017, the Company’s disclosure controls and procedures were effective to provide reasonable assurance that the information required to be disclosed by the Company in the reports it files or submits under the Exchange Act is recorded, processed, summarized and reported within the time periods specified in the rules and forms of the SEC and is accumulated and communicated to the Company’s management, including our President and Chief Executive Officer and our Chief Financial Officer, as appropriate, to allow timely decisions regarding required disclosure.

Changes in Internal Control Over Financial Reporting

There was no change in our internal control over financial reporting during the quarter ended September 30, 2017, that has materially affected, or is reasonably likely to materially affect, our internal control over financial reporting.

The design of any system of controls and procedures is based in part upon certain assumptions about the likelihood of future events. There can be no assurance that any design will succeed in achieving its stated goals under all potential future conditions, regardless of how remote.

PART II-OTHER INFORMATION

Item 1. Legal Proceedings.

We operate in a highly regulated environment.  From time to time we are a party to various litigation matters incidental to the conduct of our business. We are not presently party to any legal proceedings the resolution of which we believe would have a material adverse effect on our business, prospects, financial condition, liquidity, results of operation, cash flows or capital levels.

Item 1A. Risk Factors.

There have been no material changes from the risk factors previously disclosed in the “Risk Factors” section included in our prospectus dated June 29, 2017 that was filed with the SEC on July 3, 2017 pursuant to Rule 424(b)(4) under the Securities Act.

Item 2. Unregistered Sales of Equity Securities and Use of Proceeds.

Unregistered Sales of Equity Securities

None.

Use of Proceeds from Registered Securities

On June 29, 2017, the Company sold 4,630,194 shares of its common stock in its initial public offering, including 855,000 shares of common stock pursuant to the underwriters’ exercise of their option to purchase additional shares to cover over-allotments. The aggregate offering price for the shares sold by the Company was $88.0 million, and after deducting $6.2 million of underwriting discounts and $5.0 million of offering expenses paid to third parties, the Company received total net proceeds of $76.8 million. In addition, certain selling stockholders participated in the offering and sold an aggregate of 1,924,806 shares of our common stock at an aggregate offering price of $36.6 million. All of the shares were sold pursuant to our Registration Statement on Form S-1, as amended (File No. 333-218362) (the “Registration Statement”), which was declared effective by the SEC on June 29, 2017 and registered shares of our common stock with a maximum aggregate offering price of $137.7 million. Merrill Lynch, Pierce, Fenner & Smith Incorporated and Keefe, Bruyette & Woods, Inc. acted as joint book-running managers for the offering, and Piper Jaffray & Co., Sandler O’Neill + Partners, L.P. and Stephens Inc. acted as co-managers. Our common stock is currently traded on the New York Stock Exchange under the symbol “BY”.

87

There has been no material change in the planned use of proceeds from our initial public offering as described in our prospectus dated June 29, 2017 that was filed with the SEC on July 3, 2017 pursuant to Rule 424(b)(4) under the Securities Act. From the effective date of the Registration Statement through the date of the filing of this report, the Company used $25.5 million to repurchase all of its outstanding Noncumulative Perpetual Preferred Stock, Series A, on July 14, 2017 and $16.2 million to pay down its line of credit on July 6, 2017.

Item 3. Defaults Upon Senior Securities.

None.

Item 4. Mine Safety Disclosures.

Not applicable.

Item 5. Other Information.

None.

Item 6. Exhibits.

Exhibit No.	Description of Exhibit
3.1	Amended and Restated Certificate of Incorporation of Byline Bancorp, Inc. (incorporated herein by reference to Exhibit 3.1 to the Company’s Registration Statement on Form S-1, as amended (File No. 333- 218362) filed on June 19, 2017)
3.2	Amended and Restated Bylaws of Byline Bancorp, Inc. (incorporated herein by reference to Exhibit 3.2 to the Company’s Registration Statement on Form S-1, as amended (File No. 333- 218362) filed on June 19, 2017)
3.3	Certificate of Designations of Noncumulative Perpetual Preferred Stock, Series A (incorporated herein by reference to Exhibit 3.3 to the Company’s Registration Statement on Form S-1, as amended (File No. 333- 218362) filed on June 19, 2017)
3.4	Certificate of Designations of 7.50% Fixed-to-Floating Noncumulative Perpetual Preferred Stock, Series B (incorporated herein by reference to Exhibit 3.4 to the Company’s Registration Statement on Form S-1, as amended (File No. 333- 218362) filed on June 19, 2017)
4.1	Certain instruments defining the rights of holders of long-term debt securities of the registrant and its subsidiaries are omitted pursuant to Item 601(b)(4)(iii) of Regulation S-K. The registrant hereby undertakes to furnish to the SEC, upon request, copies of any such instruments.
10.1	Form of Repurchase Agreement for Noncumulative Perpetual Preferred Stock, Series A (incorporated herein by reference to Exhibit 10.1 to the Company’s Form 8-K (File No. 001-38139) filed on July 17, 2017)
31.1	Certification of the Chief Executive Officer Pursuant to Rules 13a-14(a) and 15d-14(a) of the Securities Exchange Act of 1934, and Section 302 of the Sarbanes-Oxley Act of 2002
31.2	Certification of the Chief Financial Officer Pursuant to Rules 13a-14(a) and 15d-14(a) of the Securities Exchange Act of 1934, and Section 302 of the Sarbanes-Oxley Act of 2002
32.1(a)	Certification of Chief Executive Officer and Chief Financial Officer pursuant to 18 U.S.C. Section 1350, as adopted pursuant to Section 906 of the Sarbanes-Oxley Act of 2002

88

101 Financial information from the Company’s Quarterly Report on Form 10-Q for the quarterly period ended September 30, 2017, formatted in XBRL interactive data files pursuant to Rule 405 of Regulation S-T: (i) Consolidated Statements of Condition; (ii) Consolidated Statements of Operations; (iii) Consolidated Statements of Comprehensive Income (Loss); (iv) Consolidated Statements of Changes in Stockholders’ Equity; (v) Consolidated Statements of Cash Flows; and (vi) Notes to Consolidated Financial Statements

(a) This exhibit shall not be deemed “filed” for purposes of Section 18 of the Exchange Act, or  otherwise subject to the liability of that section, and shall not be deemed to be incorporated by reference into any filing under the Securities Act or the Exchange Act.

89

SIGNATURES

Pursuant to the requirements of the Securities Exchange Act of 1934, the Registrant has duly caused this report to be signed on its behalf by the undersigned thereunto duly authorized.

	Byline Bancorp, Inc.
Date:  November 14, 2017	By:	/s/	Alberto J. Paracchini
			Alberto J. Paracchini
			President and Chief Executive Officer
			(Principal Executive Officer)
Date:  November 14, 2017	By:	/s/	Lindsay Corby
			Lindsay Corby
			Executive Vice President and Chief Financial Officer
			(Principal Financial and Accounting Officer)

90

EX-31.1

EXHIBIT 31.1

Certification of Chief Executive Officer
Pursuant to Rules 13a-14(a) and 15d-14(a) of the Securities Exchange Act of 1934
and Section 302 of the Sarbanes-Oxley Act of 2002

I, Alberto J. Paracchini, certify that:

1.I have reviewed this quarterly report on Form 10-Q (the “Report”) of Byline Bancorp, Inc. (the “Registrant”):

2.Based on my knowledge, this Report does not contain any untrue statement of a material  act or omit to state a material fact necessary to make the statements made, in light of the circumstances under which such statements were made, not misleading with respect to the period covered by this Report;

3. Based on my knowledge, the financial statements, and other financial information included in this Report, fairly present in all material respects the financial condition, results of operations and cash flows of the Registrant as of, and for, the periods presented in this Report;

4.The Registrant’s other certifying officer and I are responsible for establishing and maintaining disclosure controls and procedures (as defined in Exchange Act Rules 13a-15(e) and 15d-15(e)) for the Registrant and have:

a)  Designed such disclosure controls and procedures, or caused such disclosure controls and procedures to be designed under our supervision, to ensure that material information relating to the Registrant, including its consolidated subsidiaries, is made known to us by others within those entities, particularly during the period in which this Report is being prepared;

b) [Paragraph omitted in accordance with Exchange Act Rule 13a-14(a)];

c)  Evaluated the effectiveness of the Registrant’s disclosure controls and procedures and presented in this Report our conclusions about the effectiveness of the disclosure controls and procedures, as of the end of the period covered by this Report based on such evaluation; and

d)  Disclosed in this Report any change in the Registrant’s internal control over financial reporting that occurred during the Registrant’s most recent fiscal quarter (the Registrant’s fourth fiscal quarter in the case of an annual report) that has materially affected, or is reasonably likely to materially affect, the Registrant’s internal control over financial reporting; and

5. The Registrant’s other certifying officer and I have disclosed, based on our most recent evaluation of internal control over financial reporting, to the Registrant’s auditors and the audit committee of the Registrant’s board of directors (or persons performing the equivalent functions):

a)  All significant deficiencies and material weaknesses in the design or operation of internal control over financial reporting which are reasonably likely to adversely affect the Registrant’s ability to record, process, summarize and report financial information; and

b)  Any fraud, whether or not material, that involves management or other employees who have a significant role in the Registrant’s internal control over financial reporting.

Date:   November 14, 2017	/s/ Alberto J. Paracchini
	Alberto J. Paracchini
	President and Chief Executive Officer
	(Principal Executive Officer)

EX-31.2

EXHIBIT 31.2

Certification of Chief Financial Officer
Pursuant to Rules 13a-14(a) and 15d-14(a) of the Securities Exchange Act of 1934
and Section 302 of the Sarbanes-Oxley Act of 2002

I, Lindsay Corby, certify that:

1.I have reviewed this quarterly report on Form 10-Q (the “Report”) of Byline Bancorp, Inc. (the “Registrant”):

2.Based on my knowledge, this Report does not contain any untrue statement of a material  act or omit to state a material fact necessary to make the statements made, in light of the circumstances under which such statements were made, not misleading with respect to the period covered by this Report;

3. Based on my knowledge, the financial statements, and other financial information included in this Report, fairly present in all material respects the financial condition, results of operations and cash flows of the Registrant as of, and for, the periods presented in this Report;

4.The Registrant’s other certifying officer and I are responsible for establishing and maintaining disclosure controls and procedures (as defined in Exchange Act Rules 13a-15(e) and 15d-15(e)) for the Registrant and have:

a)  Designed such disclosure controls and procedures, or caused such disclosure controls and procedures to be designed under our supervision, to ensure that material information relating to the Registrant, including its consolidated subsidiaries, is made known to us by others within those entities, particularly during the period in which this Report is being prepared;

b) [Paragraph omitted in accordance with Exchange Act Rule 13a-14(a)];

c)  Evaluated the effectiveness of the Registrant’s disclosure controls and procedures and presented in this Report our conclusions about the effectiveness of the disclosure controls and procedures, as of the end of the period covered by this Report, based on such evaluation; and

d)  Disclosed in this Report any change in the Registrant’s internal control over financial reporting that occurred during the Registrant’s most recent fiscal quarter (the Registrant’s fourth fiscal quarter in the case of an annual report) that has materially affected, or is reasonably likely to materially affect, the Registrant’s internal control over financial reporting; and

5. The Registrant’s other certifying officer and I have disclosed, based on our most recent evaluation of internal control over financial reporting, to the Registrant’s auditors and the audit committee of the Registrant’s board of directors (or persons performing the equivalent functions):

a)  All significant deficiencies and material weaknesses in the design or operation of internal control over financial reporting which are reasonably likely to adversely affect the Registrant’s ability to record, process, summarize and report financial information; and

b)  Any fraud, whether or not material, that involves management or other employees who have a significant role in the Registrant’s internal control over financial reporting.

Date:   November 14, 2017	/s/ Lindsay Corby
	Lindsay Corby
	Executive Vice President and Chief Financial Officer
	(Principal Financial Officer)

EX-32.1

EXHIBIT 32.1(a)

CERTIFICATIONS PURSUANT TO

18 U.S.C. SECTION 1350,

AS ADOPTED PURSUANT TO

SECTION 906 OF THE SARBANES-OXLEY ACT OF 2002

In connection with the Quarterly Report of Byline Bancorp, Inc. (the “Company”) on Form 10-Q for the period ended September 30, 2017 as filed with the Securities and Exchange Commission on the date hereof (the “Report”), the undersigned, the Chief Executive Officer and Chief Financial Officer of the Company, each hereby certify, pursuant to 18 U.S.C. Section 1350, as adopted pursuant to Section 906 of the Sarbanes-Oxley Act of 2002, that, to his or her knowledge:

1.The Report fully complies with the requirements of Sections 13(a) or 15(d) of the Securities Exchange Act of 1934; and

2.The information contained in the Report fairly presents, in all material respects, the financial condition and results of operations of the Company.

/s/	Alberto J. Paracchini
	Alberto J. Paracchini
	President and Chief Executive Officer
	(Principal Executive Officer)
	November 14, 2017
/s/	Lindsay Corby
	Lindsay Corby
	Executive Vice President & Chief Financial Officer
	(Principal Financial Officer)
	November 14, 2017

XML

Document And Entity Information - shares	9 Months Ended
	Sep. 30, 2017	Nov. 14, 2017
Document And Entity Information [Abstract]
Document Type	10-Q
Amendment Flag	false
Document Period End Date	Sep. 30, 2017
Document Fiscal Year Focus	2017
Document Fiscal Period Focus	Q3
Trading Symbol	BY
Entity Registrant Name	Byline Bancorp, Inc.
Entity Central Index Key	0001702750
Current Fiscal Year End Date	--12-31
Entity Filer Category	Non-accelerated Filer
Entity Common Stock, Shares Outstanding		29,312,600

XML

CONSOLIDATED STATEMENTS OF FINANCIAL CONDITION - USD ($) $ in Thousands	Sep. 30, 2017	Dec. 31, 2016
ASSETS
Cash and due from banks	$ 16,193	$ 17,735
Interest bearing deposits with other banks	46,043	28,798
Cash and cash equivalents	62,236	46,533
Securities available-for-sale, at fair value	584,684	608,560
Securities held-to-maturity, at amortized cost (fair value September 30, 2017—$122,266, December 31, 2016—$138,082)	121,453	138,846
Restricted stock, at cost	10,628	14,993
Loans held for sale	2,087	23,976
Loans and leases:
Loans and leases	2,216,499	2,148,011
Allowance for loan and lease losses	(15,980)	(10,923)
Net loans and leases	2,200,519	2,137,088
Servicing assets, at fair value	21,669	21,091
Accrued interest receivable	7,183	6,866
Premises and equipment, net	96,334	102,074
Assets held for sale	12,938	14,748
Other real estate owned, net	13,859	16,570
Goodwill	51,975	51,975
Other intangible assets, net	17,522	19,826
Bank-owned life insurance	5,680	6,557
Deferred tax assets, net	60,350	67,760
Due from counterparty	21,084
Other assets	15,241	18,367
Total assets	3,305,442	3,295,830
LIABILITIES
Non-interest bearing demand deposits	753,662	724,457
Interest bearing deposits:
NOW, savings accounts, and money market accounts	1,040,774	989,421
Time deposits	726,493	776,516
Total deposits	2,520,929	2,490,394
Accrued interest payable	1,184	2,427
Line of credit		20,650
Federal Home Loan Bank advances	234,559	313,715
Securities sold under agreements to repurchase	30,807	17,249
Junior subordinated debentures issued to capital trusts, net	27,482	26,926
Accrued expenses and other liabilities	30,948	41,811
Total liabilities	2,845,909	2,913,172
STOCKHOLDERS’ EQUITY
Preferred stock	10,438	25,441
Common stock, voting $0.01 par value at September 30, 2017 and no par value at December 31, 2016; 150,000,000 shares authorized at September 30, 2017 and December 31, 2016; 29,305,400 shares issued and outstanding at September 30, 2017 and 24,616,706 issued and outstanding at December 31, 2016	292
Additional paid-in capital	391,040	313,552
Retained earnings	62,311	50,933
Accumulated other comprehensive loss, net of tax	(4,548)	(7,268)
Total stockholders’ equity	459,533	382,658
Total liabilities and stockholders’ equity	$ 3,305,442	$ 3,295,830

XML

CONSOLIDATED STATEMENTS OF FINANCIAL CONDITION (Parenthetical) $ in Thousands	Dec. 31, 2016 USD ($) $ / shares shares
Statement Of Financial Position [Abstract]
Securities held-to-maturity, fair value | $	$ 138,082
Common stock, voting no par value | $ / shares	$ 0
Common stock, voting shares authorized	150,000,000
Common stock, voting shares issued	24,616,706
Common stock, voting shares outstanding	24,616,706

XML

CONSOLIDATED STATEMENTS OF OPERATIONS - USD ($) $ in Thousands	3 Months Ended		9 Months Ended
	Sep. 30, 2017	Sep. 30, 2016	Sep. 30, 2017	Sep. 30, 2016
INTEREST AND DIVIDEND INCOME
Interest and fees on loans and leases	$ 30,933	$ 19,081	$ 88,510	$ 56,334
Interest on taxable securities	3,720	3,312	11,213	10,492
Interest on tax-exempt securities	174	152	458	509
Other interest and dividend income	217	112	666	254
Total interest and dividend income	35,044	22,657	100,847	67,589
INTEREST EXPENSE
Deposits	2,112	1,063	5,518	3,281
Federal Home Loan Bank advances	850	200	2,282	371
Subordinated debentures and other borrowings	670	529	2,286	1,571
Total interest expense	3,632	1,792	10,086	5,223
Net interest income	31,412	20,865	90,761	62,366
PROVISION FOR LOAN AND LEASE LOSSES	3,900	1,683	9,306	5,348
Net interest income after provision for loan and lease losses	27,512	19,182	81,455	57,018
NON-INTEREST INCOME
Fees and service charges on deposits	1,418	1,465	3,985	4,227
Servicing fees	959		2,954
ATM and interchange fees	1,495	1,470	4,342	4,392
Net gains on sales of securities available-for-sale		802	8	3,231
Net gains (losses) on sales of loans	7,499	(60)	24,026	(39)
Fees on mortgage loan sales, net		46	2	101
Other non-interest income	547	1,053	2,102	3,350
Total non-interest income	11,918	4,776	37,419	15,262
NON-INTEREST EXPENSE
Salaries and employee benefits	16,323	11,266	50,151	34,206
Occupancy expense, net	3,301	3,358	10,525	10,511
Equipment expense	630	516	1,809	1,519
Loan and lease related expenses	891	443	2,569	1,090
Legal, audit and other professional fees	1,608	1,065	4,369	3,785
Data processing	2,399	1,990	7,255	5,760
Net loss recognized on other real estate owned and other related expenses	565	292	136	1,386
Regulatory assessments	326	502	894	1,930
Other intangible assets amortization expense	769	747	2,307	2,242
Advertising and promotions	196	156	803	454
Telecommunications	351	370	1,165	1,284
Other non-interest expense	3,706	1,679	7,182	5,521
Total non-interest expense	31,065	22,384	89,165	69,688
INCOME BEFORE PROVISION FOR INCOME TAXES	8,365	1,574	29,709	2,592
PROVISION (BENEFIT) FOR INCOME TAXES	(1,390)	9	7,248	(222)
NET INCOME	9,755	1,565	22,461	2,814
Dividends on preferred shares	195		11,081
INCOME AVAILABLE TO COMMON STOCKHOLDERS	$ 9,560	$ 1,565	$ 11,380	$ 2,814
EARNINGS PER COMMON SHARE
Basic	$ 0.33	$ 0.08	$ 0.43	$ 0.15
Diluted	$ 0.32	$ 0.08	$ 0.43	$ 0.15
Weighted average common shares outstanding for basic earnings per common share	29,246,900	19,497,811	26,194,025	18,838,354
Diluted weighted average common shares outstanding for diluted earnings per common share	29,752,331	19,763,434	26,697,841	19,103,977

XML

CONSOLIDATED STATEMENTS OF COMPREHENSIVE INCOME (LOSS) AND ACCUMULATED OTHER COMPREHENSIVE INCOME (LOSS) - USD ($) $ in Thousands	3 Months Ended		9 Months Ended
	Sep. 30, 2017	Sep. 30, 2016	Sep. 30, 2017	Sep. 30, 2016
Net income	$ 9,755	$ 1,565	$ 22,461	$ 2,814
Securities available-for-sale
Unrealized holding gains (losses) arising during the period	1,473	(953)	4,920	12,465
Reclassification adjustments for net gains included in net income		(802)	(8)	(3,231)
Tax effect	303		(1,587)
Net of tax	1,776	(1,755)	3,325	9,234
Cash flow hedges
Unrealized holding gains (losses) arising during the period	17	398	(1,408)	207
Reclassification adjustments for losses included in net income	159	4	426	4
Tax effect	(88)		377
Net of tax	88	402	(605)	211
Beginning balance			382,658	188,274
Total other comprehensive income (loss)	1,864	(1,353)	2,720	9,445
Ending balance	459,533	251,104	459,533	251,104
Comprehensive income	11,619	212	25,181	12,259
Gains (Losses) on Cash Flow Hedges
Cash flow hedges
Beginning balance			2,233
Total other comprehensive income (loss)			(605)	211
Ending balance	1,628	211	1,628	211
Unrealized Gains (Losses) on Available-for-Sale Securities
Cash flow hedges
Beginning balance			(9,501)	(5,707)
Total other comprehensive income (loss)			3,325	9,234
Ending balance	(6,176)	3,527	(6,176)	3,527
Total Accumulated Other Comprehensive Income (Loss)
Cash flow hedges
Beginning balance			(7,268)	(5,707)
Total other comprehensive income (loss)			2,720	9,445
Ending balance	$ (4,548)	$ 3,738	$ (4,548)	$ 3,738

XML

CONSOLIDATED STATEMENTS OF CHANGES IN STOCKHOLDERS EQUITY - USD ($) $ in Thousands	Total	Preferred Stock	Common Stock	Additional Paid-In Capital	Retained Earnings (Accumulated Deficit)	Accumulated Other Comprehensive Income (Loss)
Beginning balance at Dec. 31, 2015	$ 188,274	$ 15,003		$ 194,774	$ (15,796)	$ (5,707)
Beginning balance, shares at Dec. 31, 2015		15,003	17,332,775
Net income	2,814				2,814
Other comprehensive income, net of tax	9,445					9,445
Issuance of common stock, net of issuance cost	50,018			50,018
Issuance of common stock, net of issuance cost, shares			3,078,075
Share-based compensation expense	553			553
Ending balance at Sep. 30, 2016	251,104	$ 15,003		245,345	(12,982)	3,738
Ending balance, shares at Sep. 30, 2016		15,003	20,410,850
Beginning balance at Dec. 31, 2016	382,658	$ 25,441		313,552	50,933	(7,268)
Beginning balance, shares at Dec. 31, 2016		25,441	24,616,706
Net income	22,461				22,461
Other comprehensive income, net of tax	2,720					2,720
Issuance of common stock in connection with merger			$ 246	(246)
Repurchase of preferred stock	(15,003)	$ (15,003)
Repurchase of preferred stock, shares		(15,003)
Issuance of common stock, net of issuance cost	76,829		$ 46	76,783
Issuance of common stock, net of issuance cost, shares			4,630,194
Issuance of common stock in connection with restricted stock awards, shares			58,900
Forfeiture of restricted stock awards, shares			(400)
Cash dividends declared on preferred stock	(11,081)				(11,081)
Cash paid in lieu of fractional shares	(2)				(2)
Share-based compensation expense	951			951
Ending balance at Sep. 30, 2017	$ 459,533	$ 10,438	$ 292	$ 391,040	$ 62,311	$ (4,548)
Ending balance, shares at Sep. 30, 2017		10,438	29,305,400

XML

CONSOLIDATED STATEMENTS OF CASH FLOWS - USD ($) $ in Thousands	9 Months Ended
	Sep. 30, 2017	Sep. 30, 2016
CASH FLOWS FROM OPERATING ACTIVITIES
Net income	$ 22,461	$ 2,814
Adjustments to reconcile net income to net cash from operating activities:
PROVISION FOR LOAN AND LEASE LOSSES	9,306	5,348
Impairment loss on assets held for sale	951	408
Depreciation and amortization of premises and equipment	3,919	3,814
Net amortization of securities	3,544	5,673
Net gains on sales of securities available-for-sale	(8)	(3,231)
Net gains on sales of assets held for sale	(167)	(967)
Net (gains) losses on sales of loans	(24,026)	39
Originations of mortgage loans held for sale		(4,045)
Proceeds from mortgage loans sold	151	4,512
Originations of government guaranteed loans	(202,176)
Proceeds from government guaranteed loans sold	228,852
Accretion of premiums and discounts on acquired loans, net	(24,746)	(24,479)
Net change in servicing assets	(578)
Net valuation adjustments on other real estate owned	367	904
Net gains on sales of other real estate owned	(1,538)	(1,134)
Other intangible assets amortization expense	2,307	2,242
Amortization of time deposit premium	(759)	(66)
Amortization of Federal Home Loan Bank advances premium	(156)
Accretion of junior subordinated debentures discount	556	660
Share-based compensation expense	951	553
Deferred tax provision	6,196
Increase in cash surrender value of bank owned life insurance	(209)	(184)
Gain on death benefit of bank owned life insurance	(313)
Changes in assets and liabilities:
Accrued interest receivable	(345)	(659)
Other assets	530	(436)
Accrued interest payable	(1,243)	(588)
Accrued expenses and other liabilities	(11,382)	(3,497)
Net cash provided by (used in) operating activities	12,445	(12,319)
CASH FLOWS FROM INVESTING ACTIVITIES
Purchases of securities available-for-sale	(34,814)	(526,084)
Proceeds from maturities and calls of securities available-for-sale	7,672	84,272
Proceeds from paydowns of securities available-for-sale	53,171	81,522
Proceeds from sales of securities available-for-sale	8	507,362
Purchases of securities held-to-maturity		(59,436)
Proceeds from maturities and calls of securities held-to-maturity	655
Proceeds from paydowns of securities held-to-maturity	15,597	21,881
Purchases of Federal Home Loan Bank stock	(9,855)	(4,642)
Federal Home Loan Bank stock repurchases	14,220	1,000
Proceeds from other loans sold	9,984
Net change in loans and leases	(63,502)	(357,862)
Purchases of premises and equipment	(2,253)	(4,515)
Proceeds from sales of premises and equipment		88
Proceeds from sales of assets held for sale	4,398	2,126
Proceeds from sales of other real estate owned	9,583	13,945
Proceeds from bank owned life insurance death benefit	1,399
Net cash provided by (used in) investing activities	6,263	(240,343)
CASH FLOWS FROM FINANCING ACTIVITIES
Net increase in deposits	31,294	62,285
Proceeds from Federal Home Loan Bank advances	1,993,000	4,967,000
Repayments of Federal Home Loan Bank advances	(2,072,000)	(4,822,000)
Repayments of line of credit	(20,650)
Net increase in securities sold under agreements to repurchase	13,558	1,435
Dividends paid on preferred stock	(11,081)
Cash paid in lieu of fractional shares	(2)
Proceeds from issuance of common stock	76,829	50,018
Proceeds from issuance of preferred stock	1,050
Repurchase of preferred stock	(15,003)
Net cash provided by (used in) financing activities	(3,005)	258,738
NET INCREASE IN CASH AND CASH EQUIVALENTS	15,703	6,076
CASH AND CASH EQUIVALENTS, beginning of period	46,533	44,884
CASH AND CASH EQUIVALENTS, end of period	62,236	50,960
SUPPLEMENTAL DISCLOSURES OF CASH FLOW INFORMATION:
Cash paid during the period for interest	11,689	5,217
Cash payments (refunds) during the period for taxes	2,121	(250)
SUPPLEMENTAL DISCLOSURES OF NON-CASH INVESTING AND FINANCING ACTIVITIES:
Change in fair value of available-for-sale securities, net of tax	3,325	9,234
Change in fair value of cash flow hedges, net of tax	(605)	211
Delayed payments of mortgage-backed securities	389	447
Transfers of loans to loans held for sale	10,061	1,477
Transfers of loans to other real estate owned	5,701	3,721
Internally financed sale of other real estate owned		1,447
Transfers of land and premises to assets held for sale	3,372	$ 10,486
Transfers of premises and equipment to other assets	702
Due from counterparty	$ 21,084

XML

Basis of Presentation

9 Months Ended

Sep. 30, 2017

Organization Consolidation And Presentation Of Financial Statements [Abstract]

Basis of Presentation

Note 1—Basis of Presentation

These unaudited interim condensed consolidated financial statements include the accounts of BylineBancorp, Inc., a Delaware corporation(the“Company,”“we,” “us,”“our”),a bank holding companywhose principalactivityistheownershipand managementof its Illinois state chartered subsidiarybank, BylineBank (the “Bank”), based in Chicago, Illinois.

These unaudited interim condensed consolidated financial statements have been prepared in accordance with accounting principles generally accepted in the United States of America (“GAAP”) for interim financial information and in accordance with the instructions to Form 10-Q and Article 10 of Regulation S-X as promulgated by the Securities and Exchange Commission (“SEC”).  In preparing these financial statements, the Company has evaluated events and transactions subsequent to September 30, 2017 for potential recognition or disclosure. In the opinion of management, all adjustments (consisting of normal recurring accruals) considered necessary for a fair presentation of the financial position and results of operations for the periods presented have been included.  Certain information in footnote disclosures normally included in financial statements prepared in accordance with GAAP has been condensed or omitted pursuant to the rules and regulations of the SEC and the accounting standards for interim financial statements. These financial statements should be read in conjunction with the consolidated financial statements and notes thereto included in the Company’s Consolidated Financial Statements for the years ended December 31, 2016 and 2015.

In accordance with the Financial Accounting Standards Board (“FASB”) Accounting Standards Codification (“ASC”) Topic 855, “Subsequent Events,” the Company’s management has evaluated subsequent events for potential recognition or disclosure through the date of the issuance of these consolidated financial statements. No subsequent events were identified that would have required a change to the consolidated financial statements or disclosure in the notes to the consolidated financial statements.

Certain prior period amounts have been reclassified to conform to current period presentation. These reclassifications did not result in any changes to previously reported net income or stockholders’ equity.

XML

Recently Issued Accounting Pronouncements

9 Months Ended

Sep. 30, 2017

Accounting Changes And Error Corrections [Abstract]

Recently Issued Accounting Pronouncements

Note 2—Recently Issued Accounting Pronouncements

The following reflect recent accounting pronouncements that have been adopted or are pending adoption by the Company. As the Company qualifies as an emerging growth company and has elected the extended transition period for complying with new or revised accounting pronouncements, it is not subject to new or revised accounting standards applicable to public companies during the extended transition period. The accounting pronouncements pending adoption below reflect effective dates for the Company as an emerging growth company with the extended transition period.

Revenue from Contracts with Customers In May 2014, FASB issued Accounting Standards Update (“ASU”) No. 2014-09, deferred by ASU No. 2015-14 and clarifying standards, Revenue from Contracts with Customers, which creates Topic 606 and supersedes Topic 605, Revenue Recognition. The core principle of Topic 606 is that an entity recognizes revenue to depict the transfer of promised goods or services to customers in an amount that reflects the consideration to which the entity expects to be entitled in exchange for those goods or services. In general, the new guidance requires companies to use more judgment and make more estimates than under current guidance, including identifying performance obligations in the contract, estimating the amount of variable consideration to include in the transaction price and allocating the transaction price to each separate performance obligation. Under the terms of ASU No. 2015-14 the standard is effective for interim and annual periods beginning after December 15, 2017. Early application is permitted only as of annual reporting periods beginning after December 15, 2016, including interim reporting periods within that reporting period. For financial reporting purposes, the standard allows for either full retrospective adoption, meaning the standard is applied to all of the periods presented, or modified retrospective adoption, meaning the standard is applied only to the most current period presented in the financial statements with the cumulative effect of initially applying the standard recognized at the date of initial application. The Company is currently evaluating the provisions of ASU No. 2014-09 to determine the potential impact the standard will have on the Company’s Consolidated Financial Statements. As a financial institution, the Company’s largest component of revenue, interest income, is excluded from the scope of this ASU. The Company is currently evaluating which, if any, of its sources of non-interest income will be impacted by this ASU. Assuming the Company remains an emerging growth company, the Company expects to adopt this new guidance on January 1, 2019, with a cumulative effect adjustment to opening retained earnings, if such adjustment is deemed to be significant. In April 2016, FASB issued ASU No. 2016-10, Identifying Performance Obligations and Licensing. The amendments in this ASU do not change the core principle of the guidance in Topic 606. Rather, the amendments in this ASU clarify the following two aspects of Topic 606: (1) identifying performance obligations and (2) licensing implementation guidance, while retaining the related principles for those areas. The amendments in this ASU affect the guidance in ASU 2014-09, discussed above, which is not yet effective. The effective date and transition requirements for the amendments in this ASU are the same as the effective date and transition requirements in Topic 606, Revenues from Contracts with Customers. The Company is evaluating the provisions of this ASU in conjunction with ASU No. 2014-09 to determine the potential impact Topic 606 and its amendments will have on the Company’s Consolidated Financial Statements.

In May 2016, FASB issued ASU No. 2016-12, Narrow-Scope Improvements and Practical Expedients, amending ASC Topic 606, Revenue from Contracts with Customers. The amendments in this ASU do not change the core principle of the guidance in Topic 606. Rather, the amendments in this ASU affect only several narrow aspects of Topic 606. The amendments in this ASU affect the guidance in ASU 2014-09, discussed above, which is not yet effective. The effective date and transition requirements for the amendments in this ASU are the same as the effective date and transition requirements in Topic 606. The Company is evaluating the provisions of this ASU in conjunction with ASU No. 2014-09 to determine the potential impact Topic 606 and its amendments will have on the Company’s Consolidated Financial Statements.

Recognition and Measurement of Financial Assets and Financial Liabilities In January 2016, FASB issued ASU No. 2016-01, Recognition and Measurement of Financial Assets and Financial Liabilities. The amendments in this ASU require equity securities to be measured at fair value with changes in the fair value recognized through net income. The amendments allow equity investments that do not have readily determinable fair values to be remeasured at fair value under certain circumstances and require enhanced disclosures about those investments. The amendments simplify the impairment assessment of equity investments without readily determinable fair values. The amendments also eliminate the requirement to disclose the method(s) and significant assumptions used to estimate the fair value that is required to be disclosed for financial instruments measured at amortized cost on the balance sheet. The amendments in this ASU require separate presentation in other comprehensive income of the portion of the total change in the fair value of a liability resulting from a change in the instrument-specific credit risk when the entity has elected to measure the liability at fair value in accordance with the fair value option for financial instruments. This amendment excludes from net income gains or losses that the entity may not realize because those financial liabilities are not usually transferred or settled at their fair values before maturity. The amendments in this ASU require separate presentation of financial assets and financial liabilities by measurement category and form of financial asset (that is, securities or loans and receivables) on the balance sheet or in the accompanying notes to the financial statements. The amendments in this ASU are effective for fiscal years beginning after December 15, 2017, including interim periods within those fiscal years. The Company is currently evaluating the provisions of ASU No. 2016-01 to determine the potential impact the new standard will have on the Company’s Consolidated Financial Statements. Assuming the Company remains an emerging growth company, the new authoritative guidance will be effective for reporting periods beginning January 1, 2019 and is not expected to have a significant impact on the Company’s Consolidated Financial Statements.

Leases (Topic 842) In February 2016, FASB issued ASU No. 2016-02, Leases. The amendments in this ASU require lessees to recognize the following for all leases (with the exception of short-term) at the commencement date; a lease liability, which is a lessee’s obligation to make lease payments arising from a lease, measured on a discounted basis; and a right-of-use asset, which is an asset that represents the lessee’s right to use, or control the use of, a specified asset for the lease term. The amendments in this ASU leave lessor accounting largely unchanged, although certain targeted improvements were made to align lessor accounting with the lessee accounting model. This ASU simplifies the accounting for sale and leaseback transactions primarily because lessees must recognize lease assets and lease liabilities. Lessees will no longer be provided with a source of off-balance sheet financing. The amendments in this ASU are effective for fiscal years beginning after December 15, 2018, including interim periods within those fiscal years. Early application is permitted upon issuance. Lessees (for capital and operating leases) and lessors (for sales-type, direct financing, and operating leases) must apply a modified retrospective transition approach for leases existing at, or entered into after, the beginning of the earliest comparative period presented in the financial statements. The modified retrospective approach would not require any transition accounting for leases that expired before the earliest comparative period presented. Lessees and lessors may not apply a full retrospective transition approach. The Company is evaluating the new guidance and its impact on the Company’s Consolidated Statements of Operations and Consolidated Statements of Financial Condition. Assuming the Company remains an emerging growth company, the new authoritative guidance will be effective for reporting periods after January 1, 2020. The Company expects an increase in assets and liabilities as a result of recognizing additional lease contracts where the Company is lessee.

Derivatives and Hedging (Topic 815) In March 2016, FASB issued ASU No. 2016-05, Effect of Derivative Contract Novations on Existing Hedge Accounting Relationships. The amendments in this ASU clarify that a change in the counterparty to a derivative instrument that has been designated as the hedging instrument under Topic 815 (Derivatives and Hedging) does not, in and of itself, require dedesignation of that hedging relationship provided that all other hedge accounting criteria continue to be met. The amendments in this ASU are effective for financial statements issued for fiscal years beginning after December 15, 2016, and interim periods within those fiscal years. An entity has an option to apply the amendments in this ASU on either a prospective basis or a modified retrospective basis. Early adoption is permitted, including adoption in an interim period. This ASU became effective for the Company on January 1, 2017 and did not have a material impact on the Company’s Consolidated Financial Statements.

In March 2016, FASB issued ASU No. 2016-06, Contingent Put and Call Options in Debt Instruments. The amendments in this ASU clarify the requirements for assessing whether contingent call (put) options that can accelerate the payment of principal on debt instruments are clearly and closely related to their debt hosts. To determine how to account for debt instruments with embedded features, including contingent put and call options, an entity is required to assess whether the embedded derivatives must be bifurcated from the host contract and accounted for separately. Part of this assessment consists of evaluating whether the embedded derivative features are clearly and closely related to the debt host. Under existing guidance, for contingently exercisable options to be considered clearly and closely related to a debt host, they must be indexed only to interest rates or credit risk. ASU 2016-06 addresses inconsistent interpretations of whether an event that triggers an entity’s ability to exercise the embedded contingent option must be indexed to interest rates or credit risk for that  option to qualify as clearly and closely related. Diversity in practice has developed because the existing four-step decision sequence in ASC 815 focuses only on whether the payoff was indexed to something other than an interest rate or credit risk. As a result, entities have been uncertain whether they should (1) determine whether the embedded features are clearly and closely related to the debt host solely on the basis of the four-step decision sequence or (2) first apply the four-step decision sequence and then also evaluate whether the event triggering the exercisability of the contingent put or call option is indexed only to an interest rate or credit risk. This ASU clarifies that in assessing whether an embedded contingent put or call option is clearly and closely related to the debt host, an entity is required to perform only the four-step decision sequence in ASC 815 as amended by this ASU. The entity does not have to separately assess whether the event that triggers its ability to exercise the contingent option is itself indexed only to interest rates or credit risk. The amendments in this ASU are effective for financial statements issued for fiscal years beginning after December 15, 2016, and interim periods within those fiscal years. This ASU became effective for the Company on January 1, 2017 and did not have a material impact on the Company’s Consolidated Financial Statements.

In August 2017, FASB issued ASU No. 2017-12, Targeted Improvements to Accounting for Hedging Activities. The amendments in this ASU better align an entity’s risk management activities and financial reporting for hedging relationships through changes to both the designation and measurement guidance for qualifying hedging relationships and the presentation of hedge results. The new authoritative guidance will be effective for reporting periods after January 1, 2019 with early adoption permitted. The Company is evaluating the new guidance and its impact on the Company’s Consolidated Statements of Operations and Consolidated Statements of Financial Condition.

Compensation—Stock Compensation (Topic 718) In March 2016, FASB issued ASU No. 2016-09, Improvements to Employee Share-Based Payment Accounting. FASB issued this ASU as part of its Simplification Initiative. The areas for simplification in this ASU involve several aspects of the accounting for share-based payment transactions, including the income tax consequences, classification of awards as either equity or liabilities, and classification on the statement of cash flows. Amendments in this ASU relate to the timing of when excess tax benefits are recognized, minimum statutory withholding requirements, forfeitures, and intrinsic value should be applied using a modified retrospective transition method by means of a cumulative-effect adjustment to equity as of the beginning of the period in which the guidance is adopted. Amendments related to the presentation of employee taxes paid on the statement of cash flows when an employer withholds shares to meet the minimum statutory withholding requirement should be applied retrospectively. Amendments in this ASU require recognition of excess tax benefits and tax deficiencies in the income statement and the practical expedient for estimating expected term should be applied prospectively.

An entity may elect to apply the amendments in this ASU related to the presentation of excess tax benefits on the statement of cash flows using either a prospective transition method or a retrospective transition method. The amendments in this ASU are effective for annual periods beginning after December 15, 2016, and interim periods within those annual periods. This ASU became effective for the Company on January 1, 2017 and did not have a material impact on the Company’s Consolidated Financial Statements.

In May 2017, the FASB issued ASU 2017-09, Scope of Modification Accounting. The new standard provides guidance about which changes to the terms or conditions of a share-based payment award require an entity to apply modification accounting in Topic 718. This pronouncement is effective for annual reporting periods beginning after December 15, 2017 but early adoption is permitted. The Company is currently evaluating the impact of adopting this guidance.

Financial Instruments—Credit Losses (Topic 326) In June 2016, FASB issued ASU No. 2016-13, Measurement of Credit Losses on Financial Instruments. Current GAAP requires an “incurred loss” methodology for recognizing credit losses that delays recognition until it is probable a loss has been incurred. The main objective of this ASU is to provide financial statement users with more decision-useful information about the expected credit losses on financial instruments and other commitments to extend credit held by a reporting entity at each reporting date. The amendments in this ASU replace the incurred loss impairment methodology in current GAAP with a methodology that reflects expected credit losses and requires consideration of a broader range of reasonable and supportable information to inform credit loss estimates. The amendments in this ASU require a financial asset (or group of financial assets) measured at amortized cost basis to be presented at the net amount expected to be collected. The allowance for credit losses is a valuation account that is deducted from the amortized cost basis of the financial asset(s) to present the net carrying value at the amount expected to be collected on the financial asset. The measurement of expected credit losses will be based on relevant information about past events, including historical experience, current conditions, and reasonable and supportable forecasts that affect the collectability of the reported amount. The amendments in this ASU broaden the information that an entity must consider in developing its expected credit loss estimate for assets measured either collectively or individually. The use of forecasted information incorporates more timely information in the estimate of expected credit loss, which will be more decision useful to users of the financial statements. The amendments in this ASU will be effective for fiscal years beginning after December 15, 2019, including interim periods  within those fiscal years. Assuming the Company remains an emerging growth company, the new authoritative guidance will be effective for reporting periods after January 1, 2021. The Company is still evaluating the effects this ASU will have on the Company’s Consolidated Financial Statements. While the Company has not quantified the impact of this ASU, it does expect changing from the current incurred loss model to an expected loss model will result in an earlier recognition of losses.

Statement of Cash Flows (Topic 230) In August 2016, FASB issued ASU No. 2016-15, Classification of Certain Cash Receipts and Cash Payments. There is diversity in practice in how certain cash receipts and cash payments are presented and classified in the statement of cash flows under Topic 230 and other Topics. This ASU addresses eight specific cash flow issues with the objective of reducing the existing diversity in practice. Those eight issues are (1) debt prepayment or debt extinguishment costs, (2) settlement of zero-coupon debt instruments or other debt instruments with coupon interest rates that are insignificant in relation to the effective interest rate of the borrowing, (3) contingent consideration payments made after a business combination, (4) proceeds from the settlement of insurance claims, (5) proceeds from the settlement of corporate-owned life insurance policies, including bank-owned life insurance policies, (6) distributions received from equity method investees, (7) beneficial interests in securitization transactions, and (8) separately identifiable cash flows and application of the predominance principle. Current GAAP either is unclear or does not include specific guidance on these eight cash flow classification issues. These amendments provide guidance for each of the eight issues, thereby reducing current and potential future diversity in practice. The amendments in this ASU are effective for fiscal years beginning after December 15, 2017, and interim periods within those fiscal years. Early adoption is permitted, including adoption in an interim period. Assuming the Company remains an emerging growth company, the new authoritative guidance will be effective for reporting periods after January 1, 2019. The Company is currently evaluating the provisions of ASU No. 2016-15 to determine the potential impact the new standard will have on the Company’s Consolidated Financial Statements.

In November 2016, the FASB issued ASU No. 2016-18, Statement of Cash Flows (230), Restricted Cash. The ASU will require that a statement of cash flows explain the change during the period in the total of cash, cash equivalents, and amounts generally described as restricted cash or restricted cash equivalents. Therefore, amounts generally described as restricted cash and restricted cash equivalents should be included with cash and cash equivalents when reconciling the beginning-of-period and end-of-period total amounts shown on the statement of cash flows. The amendments in this update apply to all entities that have restricted cash or restricted cash equivalents and are required to present a statement of cash flows under Topic 230. Theamendment is effective for annual reporting periods beginning after December 15, 2017, and interim periods within those fiscal years. Early adoption of the update is permitted. Assuming the Company remains an emerging growth company, the new authoritative guidance will be effective for reporting periods after January 1, 2019. The Company does not expect this ASU to have a material impact on the Company’s Consolidated Financial Statements.

Income Taxes (Topic 740) In October 2016, the FASB issued ASU No. 2016-16, Income Taxes,Intra-Entity Transfers of Assets Other Than Inventory. The ASU was issued to improve the accounting for income tax consequences of intra-entity transfers of assets other than inventory. Current GAAP prohibits the recognition of current and deferred income taxes for an intra-entity asset transfer until the asset has been sold to an outside party; this update clarifies that an entity should recognize the income tax consequences of an intra-entity transfer of assets other than inventory when the transfer occurs. The amendment is effective for annual reporting periods beginning after December 15, 2017, and interim periods within those fiscal years. Early adoption of the update is permitted. Assuming the Company remains an emerging growth company, the new authoritative guidance will be effective for reporting periods after January 1, 2019. The Company does not expect this ASU to have a material impact on the Company’s Consolidated Financial Statements.

Consolidation (Topic 810) In October 2016, the FASB issued ASU No. 2016-17, Consolidation, Interests Held through Related Parties That Are under Common Control. The ASU was issued to amend the consolidation guidance on how a reporting entity that is the single decision maker of a variable interest entity (“VIE”) should treat indirect interests in the entity held through related parties that are under common control with the reporting entity when determining whether it is the primary beneficiary of that VIE. The primary beneficiary of a VIE is the reporting entity that has a controlling financial interest in a VIE and, therefore, consolidates the VIE. A reporting entity has an indirect interest in a VIE if it has a direct interest in a related party that, in turn, has a direct interest in the VIE. The amendment is effective for annual reporting periods beginning after December 15, 2016, and interim periods within those fiscal years. Early adoption of the update is permitted. The Company adopted this new authoritative guidance on January 1, 2017 and it did not have an impact on the Company’s Consolidated Financial Statements.

Business Combinations (Topic 805) In January 2017, the FASB issued ASU No. 2017-01, Clarifying the Definition of a Business. The guidance clarifies the definition of a business to assist entities with evaluating whether transactions should be accounted for as acquisitions or disposals of assets or businesses. This guidance is effective for annual and interim periods beginning after December 15, 2017. Early adoption is permitted. Assuming the Company remains an emerging growth company, the new authoritative guidance will be effective for reporting periods after January 1, 2019. The Company does not expect a material impact of this ASU on the Company’s Consolidated Financial Statements.

Intangibles—Goodwill and Other (Topic 350) In January 2017, FASB issued ASU No. 2017-04, Simplifying the Test for Goodwill Impairment. The amendments in this ASU are intended to reduce the cost and complexity of the goodwill impairment test by eliminating step two from the impairment test. The amendments modify the concept of impairment from the condition that exists when the carrying amount of goodwill exceeds its implied fair value to the condition that exists when the carrying amount of a reporting unit exceeds its fair value. Under the amendments in this ASU, an entity will perform its annual, or interim, goodwill impairment test by comparing the fair value of the reporting unit with its carrying amount. An impairment charge should be recognized for the amount which the carrying amount exceeds the reporting unit’s fair value; however, the loss recognized should not exceed the total amount of goodwill allocated to that reporting unit. The amendments in this ASU are effective for the Company’s annual or any interim goodwill impairment test in fiscal years beginning after December 15, 2019. Early adoption is permitted for interim or annual goodwill impairment tests performed on testing dates after January 1, 2017. The Company is early adopting these amendments in 2017 and does not expect a material impact on the Company’s Consolidated Financial Statements.

Other Income (Subtopic 610-20) In February 2017, the FASB issued ASU No. 2017-05, Other Income-Gains and Losses from the Derecognition of Nonfinancial Assets.  This ASU will clarify the scope of Subtopic 610-20 and add guidance for partial sales of nonfinancial assets.   The amendments should be applied either on retrospectively to each period presented or with a modified retrospective approach.  The amendment is effective for annual periods beginning after December 15, 2018, and interim periods within annual periods beginning after December 15, 2019.  The Company is currently evaluating the provisions of ASU No. 2017-05 to determine the potential impact the new standard will have on the Company’s Consolidated Financial Statements.

Nonrefundable Fees and Other Costs (Subtopic 310-20) In March 2017, FASB issued ASU No. 2017-08, Receivables—Nonrefundable Fees and Other Costs. The amendments in the ASU shorten the amortization period for certain callable debt securities held at a premium at the earliest call date. Under current GAAP, the Company amortizes the premium as an adjustment of yield over the contractual life of the instrument. As a result, upon exercise of a call on a callable debt security held at a premium, the unamortized premium is charged to earnings. The ASU shortens the amortization period for certain callable debt securities held at a premium and requires the premium to be amortized to the earliest call date. However, the amendments do not require an accounting change for securities held at a discount; the discount continues to be amortized to maturity. The amendments are effective for annual periods beginning after December 15, 2019, and interim periods within annual periods beginning after December 15, 2020. Early adoption is permitted. The Company is required to apply the amendments on a modified retrospective basis through a cumulative-effect adjustment directly to retained earnings as of the beginning of the period of adoption. Assuming the Company remains an emerging growth company, the new authoritative guidance will be effective for reporting periods after January 1, 2020. The Company is currently evaluating the provisions of ASU No. 2017-08 to determine the potential impact the new standard will have on the Company’s Consolidated Financial Statements.

XML

Acquisition of a Business

9 Months Ended

Sep. 30, 2017

Business Combinations [Abstract]

Acquisition of a Business

Note 3—Acquisitionof a Business

On October 14, 2016, the Company acquired stock of Ridgestone Financial Services, Inc. (“Ridgestone”) and its subsidiaries under the terms of a definitive merger agreement (“Agreement”) dated June 9, 2016. Ridgestone operated two wholly-owned subsidiaries, Ridgestone Bank and RidgeStone Capital Trust I, and specialized in government guaranteed lending as a participant in the SBA and USDA lending programs. Ridgestone provided financial services through its two full-service banking offices in Brookfield, Wisconsin and Schaumburg, Illinois. In addition, Ridgestone had loan production offices located in Wisconsin (Green Bay and Wausau), Indiana (Indianapolis) and California (Newport Beach).

Under the terms of the Agreement, each Ridgestone common share was converted into the right to receive, at the election of the stockholder (subject to proration as outlined in the Agreement), either cash or Company common stock, or the combination of both. Total consideration included aggregate cash in the amount of $36.8 million and the issuance of 4,199,791 shares of the Company’s common stock valued at $16.25 per common share. The transaction resulted in goodwill of $26.3 million, which is nondeductible for tax purposes, as this acquisition was a nontaxable transaction. Goodwill represents the premium paid over the fair value of the net tangible and intangible assets acquired and reflects related synergies expected from the combined operations. Acquisition advisory expenses related to the Ridgestone acquisition of $1.1  million are reflected in non-interest expense on the Consolidated Statements of Operations for the nine months ended September 30, 2016. Stock issuance costs were not material. There were no contingent assets or liabilities arising from the acquisition.

The acquisition of Ridgestone was accounted for using the acquisition method of accounting in accordance with ASC Topic 805. Assets acquired, liabilities assumed and consideration exchanged were recorded at their respective acquisition date fair values. Determining the fair value of assets and liabilities involves significant judgment regarding methods and assumptions used to calculate estimated fair values. Fair values are preliminary and subject to refinement for up to one year after the closing date of the acquisition as additional information regarding the closing date fair values become available. Fair values are preliminary estimates due to deferred tax assets and deferred tax liabilities.

The following table presents a summary of the estimates of fair values of assets acquired and liabilities assumed as of the acquisition date:

Assets
Cash and cash equivalents	$	25,480
Securities available-for-sale		27,662
Restricted stock		931
Loans held for sale		15,363
Loans		351,820
Servicing assets		20,295
Premises and equipment		2,011
Other real estate owned		1,525
Other intangible assets		486
Bank-owned life insurance		2,352
Other assets		8,228
Total assets acquired		456,153
Liabilities
Deposits		361,370
Federal Home Loan Bank advances		9,773
Junior subordinated debentures		1,339
Accrued expenses and other liabilities		4,958
Total liabilities assumed		377,440
Net assets acquired	$	78,713
Consideration paid
Common stock (4,199,791 shares issued at $16.25 per    share)		68,247
Cash paid		36,753
Total consideration paid		105,000
Goodwill	$	26,287

The following table presents the acquired non-impaired loans as of the acquisition date:  

Fair value	$	312,166
Gross contractual amounts receivable		450,292
Estimate of contractual cash flows not expected to be    collected(1)		19,661
Estimate of contractual cash flows expected to be collected		430,631

(1) Includes interest payments not expected to be collected due to loan prepayments as well as principal and interest payments not expected to be collected due to customer default.

The discount on the acquired non-impaired loans is being accreted into income over the life of the loans on an effective yield basis.

The following table provides the pro forma information for the results of operations for the three and nine months ended September 30, 2016, as if the acquisition had occurred on January 1, 2016. The pro forma results combine the historical results of Ridgestone into the Company’s Consolidated Statements of Operations, including the impact of certain acquisition accounting adjustments, which includes loan discount accretion, intangible assets amortization, deposit premium accretion and borrowing net discount amortization. The pro forma results have been prepared for comparative purposes only and are not necessarily indicative of the results that would have been obtained had the acquisition actually occurred on January 1, 2016. No assumptions have been applied to the pro forma results of operations regarding possible revenue enhancements, provision for credit losses, expense efficiencies or asset dispositions. The acquisition-related expenses that have been recognized are included in net income in the following table.

	Three Months Ended		Nine Months Ended
	September 30, 2016		September 30, 2016
Total revenues (net interest income and non-interest income)	$	44,595	$	130,536
Net income (loss)	$	6,816	$	17,603
Earnings per share—basic	$	0.29	$	0.76
Earnings per share—diluted	$	0.28	$	0.76

The operating results of the Company include the operating results produced by the acquired assets and assumed liabilities of Ridgestone for period from January 1, 2017 through September 30, 2017. Revenues and earnings of the acquired company since the acquisition date have not been disclosed as it is not practicable as Ridgestone was merged into the Company and separate financial information is not readily available.

XML

Securities

9 Months Ended

Sep. 30, 2017

Investments Debt And Equity Securities [Abstract]

Securities

Note 4—Securities

The followingtablessummarizetheamortizedcostand fairvaluesof securitiesavailable-for-saleand securitiesheld-to-maturityas of the dates shown and thecorrespondingamountsof grossunrealized gainsand losses:

September 30, 2017	Amortized Cost		Gross Unrealized Gains		Gross Unrealized Losses			Fair Value
Available-for-sale
U.S. Treasury Notes	$	14,998	$	—	$	(73	)	$	14,925
U.S. Government agencies		54,231		—		(1,012	)		53,219
Obligations of states, municipalities, and political    subdivisions		32,619		129		(213	)		32,535
Residential mortgage-backed securities
Agency		329,782		7		(5,749	)		324,040
Non-agency		25,429		87		(46	)		25,470
Commercial mortgage-backed securities
Agency		72,190		44		(1,477	)		70,757
Non-agency		31,838		—		(581	)		31,257
Corporate securities		27,093		493		(62	)		27,524
Other securities		3,626		1,387		(56	)		4,957
Total	$	591,806	$	2,147	$	(9,269	)	$	584,684

September 30, 2017	Amortized Cost		Gross Unrealized Gains		Gross Unrealized Losses			Fair Value
Held-to-maturity
Obligations of states, municipalities, and political subdivisions	$	24,078	$	317	$	(36	)	$	24,359
Residential mortgage-backed securities
Agency		56,453		275		(82	)		56,646
Non-agency		40,922		364		(25	)		41,261
Total	$	121,453	$	956	$	(143	)	$	122,266

December 31, 2016	Amortized Cost		Gross Unrealized Gains		Gross Unrealized Losses			Fair Value
Available-for-sale
U.S. Treasury Notes	$	14,995	$	4	$	(79	)	$	14,920
U.S. Government agencies		60,180		—		(1,323	)		58,857
Obligations of states, municipalities, and political    subdivisions		16,271		60		(272	)		16,059
Residential mortgage-backed securities
Agency		376,800		—		(8,640	)		368,160
Non-agency		20,107		—		(174	)		19,933
Commercial mortgage-backed securities
Agency		78,954		—		(1,551	)		77,403
Non-agency		32,061		—		(1,009	)		31,052
Corporate securities		17,065		350		(86	)		17,329
Other securities		4,161		742		(56	)		4,847
Total	$	620,594	$	1,156	$	(13,190	)	$	608,560

December 31, 2016	Amortized Cost		Gross Unrealized Gains		Gross Unrealized Losses			Fair Value
Held-to-maturity
Obligations of states, municipalities, and political    subdivisions	$	24,878	$	105	$	(229	)	$	24,754
Residential mortgage-backed securities
Agency		67,692		35		(283	)		67,444
Non-agency		46,276		50		(442	)		45,884
Total	$	138,846	$	190	$	(954	)	$	138,082

The Company did not classify securities as trading during 2016 or during the nine months ended September 30, 2017.

Gross unrealized losses and fair values, aggregated by investment category and length of time that individual securities have been in a continuous unrealized loss position as of September 30, 2017 and December 31, 2016 are summarized as follows:

			Less than 12 Months					12 Months or Longer					Total
September 30, 2017	# of Securities		Fair Value		Unrealized Losses			Fair Value		Unrealized Losses			Fair Value		Unrealized Losses
Available-for-sale
U.S. Treasury Notes		5	$	14,925	$	(73	)	$	—	$	—		$	14,925	$	(73	)
U.S. Government agencies		9		28,418		(438	)		24,801		(574	)		53,219		(1,012	)
Obligations of states, municipalities and    political subdivisions		23		14,431		(122	)		2,082		(91	)		16,513		(213	)
Residential mortgage-backed securities
Agency		40		222,548		(3,356	)		93,293		(2,393	)		315,841		(5,749	)
Non-agency		1		4,789		(46	)		—		—			4,789		(46	)
Commercial mortgage-backed securities
Agency		7		39,378		(1,108	)		19,740		(369	)		59,118		(1,477	)
Non-agency		5		31,257		(581	)		—		—			31,257		(581	)
Corporate securities		3		4,959		(62	)		—		—			4,959		(62	)
Other securities		1		—		—			1,938		(56	)		1,938		(56	)
Total		94	$	360,705	$	(5,786	)	$	141,854	$	(3,483	)	$	502,559	$	(9,269	)

			Less than 12 Months					12 Months or Longer				Total
September 30, 2017	# of Securities		Fair Value		Unrealized Losses			Fair Value		Unrealized Losses		Fair Value		Unrealized Losses
Held-to-maturity
Obligations of states, municipalities, and    political subdivisions		7	$	4,855	$	(36	)	$	—	$	—	$	4,855	$	(36	)
Residential mortgage-backed securities
Agency		9		20,287		(82	)		—		—		20,287		(82	)
Non-agency		3		4,568		(25	)		—		—		4,568		(25	)
Total		19	$	29,710	$	(143	)	$	—	$	—	$	29,710	$	(143	)

			Less than 12 Months					12 Months or Longer					Total
December 31, 2016	# of Securities		Fair Value		Unrealized Losses			Fair Value		Unrealized Losses			Fair Value		Unrealized Losses
Available-for-sale
U.S. Treasury Notes		3	$	9,918	$	(79	)	$	—	$	—		$	9,918	$	(79	)
U.S. Government agencies		10		58,857		(1,323	)		—		—			58,857		(1,323	)
Obligations of states, municipalities and    political subdivisions		14		7,799		(259	)		115		(13	)		7,914		(272	)
Residential mortgage-backed securities
Agency		41		364,713		(8,483	)		3,447		(157	)		368,160		(8,640	)
Non-agency		2		19,933		(174	)		—		—			19,933		(174	)
Commercial mortgage-backed securities
Agency		8		70,762		(1,488	)		6,641		(63	)		77,403		(1,551	)
Non-agency		5		31,052		(1,009	)		—		—			31,052		(1,009	)
Corporate securities		4		5,097		(78	)		2,522		(8	)		7,619		(86	)
Other securities		1		—		—			1,994		(56	)		1,994		(56	)
Total		88	$	568,131	$	(12,893	)	$	14,719	$	(297	)	$	582,850	$	(13,190	)

			Less than 12 Months					12 Months or Longer				Total
December 31, 2016	# of Securities		Fair Value		Unrealized Losses			Fair Value		Unrealized Losses		Fair Value		Unrealized Losses
Held-to-maturity
Obligations of states, municipalities, and    political subdivisions		22	$	16,235	$	(229	)	$	—	$	—	$	16,235	$	(229	)
Residential mortgage-backed securities
Agency		15		52,156		(283	)		—		—		52,156		(283	)
Non-agency		5		29,245		(442	)		—		—		29,245		(442	)
Total		42	$	97,636	$	(954	)	$	—	$	—	$	97,636	$	(954	)

Certainsecuritieshave fairvalueslessthanamortizedcostand, therefore,containunrealizedlosses.At September 30, 2017, theCompany evaluatedthesecuritieswhich had an unrealizedlossfor other than temporary impairment and determined alldeclinesin valueto be temporary.Therewere 113 investmentsecuritieswith unrealizedlossesat September 30, 2017, of which only one had a continuousunrealizedlosspositionfor12 consecutivemonthsor longerthatisgreaterthan5% of amortizedcost.The Company anticipatesfullrecoveryof amortizedcostwith respectto thesesecuritiesby maturity,or sooner,in theeventof a morefavorablemarketinterestrate environment.The Company does not intendto sellthesesecuritiesand itisnot morelikelythannot thatthe Company willbe requiredto sellthembeforerecoveryof theiramortizedcostbasis,which maybe atmaturity.

The proceedsfromallsalesof securitieswere available-for-sale,and theassociatedgainsand lossesfor thethree and nine months ended September 30, 2017 and 2016 arelistedbelow:

	For the Three Months Ended					For the Nine Months Ended
	September 30,					September 30,
	2017		2016			2017		2016
Proceeds	$	—	$	107,949		$	8	$	507,362
Gross gains		—		912			8		3,341
Gross losses		—		(110	)		—		(110	)

The amountof netgainsreclassifiedfromaccumulatedothercomprehensive income (loss)intoearningsforthe nine months ended September 30, 2017 and 2016 were $8,000 and $3.2 million, respectively. There were no gains or losses reclassified from accumulated other comprehensive income (loss) into earnings for the three months ended September 30, 2017 and $802,000 for the three months ended September 30, 2016.

Securities pledged at September 30, 2017 and December 31, 2016 had carrying amounts of $226.0 million and $178.6 million,respectively.At September 30, 2017 and December 31, 2016, of thosepledged,thecarryingamountsof securitiespledgedas collateralforpublicfund depositswere $189.9 million and $93.2 million,respectively and forcustomerrepurchaseagreementsof $35.9 million and $19.9 million,respectively. There were no securities pledged foradvances from the FederalHomeLoanBank at September 30, 2017.At December 31, 2016 the carrying amount of securities pledged for advances from the Federal Home Loan Bank were $58.7 million. Othersecuritieswere pledgedforderivativepositions,lettersof creditand for purposesrequiredor permittedby law. At September 30, 2017 and December 31, 2016, therewere no holdingsof securitiesof any one issuer,otherthantheU.S.Governmentand itsagencies,in an amountgreaterthan10% of stockholders’ equity.

At September 30, 2017, theamortizedcostand fairvalueof debtsecuritiesareshown by contractual maturity.Expectedmaturitiesmaydifferfromcontractualmaturitiesifborrowershave therightto callor prepay obligationswith or withoutcallor prepaymentpenalties.Securitiesnot due ata singlematuritydateareshown separately.

	Amortized Cost		Fair Value
Available-for-sale
Due in one year or less	$	5,289	$	5,287
Due from one to five years		70,097		69,824
Due from five to ten years		42,448		42,006
Due after ten years		11,807		11,625
Mortgage-backed securities		459,239		451,524
Other securities with no defined maturity		2,926		4,418
Total	$	591,806	$	584,684
Held-to-maturity
Due from one to five years	$	524	$	528
Due from five to ten years		13,735		13,835
Due after ten years		9,819		9,996
Mortgage-backed securities		97,375		97,907
Total	$	121,453	$	122,266

XML

Loan and Lease Receivables

9 Months Ended

Sep. 30, 2017

Receivables [Abstract]

Loan and Lease Receivables

Note 5—Loanand Lease Receivables

Outstanding loan and lease receivables as of the dates shown were categorized as follows:

	September 30,			December 31,
	2017			2016
Commercial real estate	$	862,523		$	796,950
Residential real estate		582,569			610,699
Construction, land development, and other land		94,639			141,122
Commercial and industrial		503,093			439,476
Installment and other		3,208			2,917
Lease financing receivables		168,924			155,999
Total loans and leases		2,214,956			2,147,163
Net unamortized deferred fees and costs		(1,874	)		(2,119	)
Initial direct costs		3,417			2,967
Allowance for loan and lease losses		(15,980	)		(10,923	)
Net loans and leases	$	2,200,519		$	2,137,088

	September 30,			December 31,
	2017			2016
Lease financing receivables
Net minimum lease payments	$	183,035		$	168,345
Unguaranteed residual values		1,580			1,787
Unearned income		(15,691	)		(14,133	)
Total lease financing receivables		168,924			155,999
Initial direct costs		3,417			2,967
Lease financial receivables before allowance for    lease losses	$	172,341		$	158,966

At September 30, 2017 and December 31, 2016, total loans and leases included the guaranteed amount of U.S. Government guaranteed loans of $51.9 million and $34.8 million, respectively. At September 30, 2017 and December 31, 2016, installment and other loans included overdraft deposits of $483,000 and $1.0 million, respectively, which were reclassified as loans. At September 30, 2017 and December 31, 2016, loans and loans held for sale pledged as security for borrowings were $530.3 million and $507.2 million, respectively. Total loans and leases consist of originated loans and leases, acquired impaired loans and acquired non-impaired loans and leases.

The minimumannualleasepaymentsforleasefinancingreceivablesas of September 30, 2017 are summarizedas follows:

	Minimum Lease Payments
2017	$	15,345
2018		62,718
2019		48,463
2020		32,863
2021		17,699
Thereafter		5,947
Total	$	183,035

Originatedloansand leasesrepresentoriginationsfollowinga businesscombination.Acquiredimpaired loansareloansacquiredfroma businesscombinationwith evidenceof creditqualitydeteriorationand are accountedforunderASC Topic 310-30. Acquirednon-impairedloansand leasesrepresentloansand leasesacquired froma businesscombinationwithoutevidenceof creditqualitydeteriorationand areaccountedforunderASC Topic 310-20. Leasesand revolvingloansdo not qualifyto be accountedforas acquiredimpairedloansand are accountedforunderASC Topic 310-20. The followingtablessummarizethebalancesforeachrespectiveloanand leasecategoryas of September 30, 2017 and December 31, 2016:

September 30, 2017	Originated		Acquired Impaired		Acquired Non- Impaired		Total
Commercial real estate	$	463,020	$	173,106	$	225,759	$	861,885
Residential real estate		398,062		152,149		32,451		582,662
Construction, land development, and other land		85,666		5,424		3,214		94,304
Commercial and industrial		390,331		11,433		100,291		502,055
Installment and other		2,726		488		38		3,252
Lease financing receivables		134,193		—		38,148		172,341
Total loans and leases	$	1,473,998	$	342,600	$	399,901	$	2,216,499

December 31, 2016	Originated		Acquired Impaired		Acquired Non- Impaired		Total
Commercial real estate	$	338,752	$	207,303	$	250,289	$	796,344
Residential real estate		394,168		175,717		40,853		610,738
Construction, land development, and other land		119,357		6,979		14,430		140,766
Commercial and industrial		309,097		13,464		115,677		438,238
Installment and other		2,021		574		364		2,959
Lease financing receivables		118,493		—		40,473		158,966
Total loans and leases	$	1,281,888	$	404,037	$	462,086	$	2,148,011

The outstandingbalanceand carryingamountof allacquiredimpairedloansaresummarizedbelow. The balancesdo not includean allowanceforloanand leaselossesof $3.8 million and $1.6 million,at September 30, 2017 and December 31, 2016, respectively.

	September 30, 2017				December 31, 2016
	Outstanding Balance		Carrying Value		Outstanding Balance		Carrying Value
Commercial real estate	$	245,182	$	173,106	$	278,893	$	207,303
Residential real estate		215,135		152,149		236,384		175,717
Construction, land development, and other land		13,511		5,424		15,292		6,979
Commercial and industrial		20,255		11,433		23,164		13,464
Installment and other		1,842		488		1,976		574
Total acquired impaired loans	$	495,925	$	342,600	$	555,709	$	404,037

The following table summarizes the changes in accretable yield for acquired impaired loans for the three and nine months ended September 30, 2017 and 2016:

	Three Months Ended						Nine Months Ended
	September 30,						September 30,
	2017			2016			2017			2016
Beginning balance	$	37,619		$	35,663		$	36,868		$	43,915
Accretion to interest income		(8,165	)		(5,859	)		(24,768	)		(20,071	)
Reclassification from nonaccretable difference		6,901			1,777			24,255			7,737
Ending balance	$	36,355		$	31,581		$	36,355		$	31,581

Acquired non-impaired loans and leases—The unpaidprincipalbalanceand carryingvalueforacquirednon-impairedloansand leasesat September 30, 2017 and December 31, 2016 were as follows:

	September 30, 2017				December 31, 2016
	Unpaid Principal Balance		Carrying Value		Unpaid Principal Balance		Carrying Value
Commercial real estate	$	232,016	$	225,759	$	259,055	$	250,289
Residential real estate		32,984		32,451		41,282		40,853
Construction, land development, and other land		3,277		3,214		14,619		14,430
Commercial and industrial		111,167		100,291		125,806		115,677
Installment and other		352		38		402		364
Lease financing receivables		39,053		38,148		40,205		40,473
Total acquired non-impaired loans and leases	$	418,849	$	399,901	$	481,369	$	462,086

XML

Allowance for Loan and Lease Losses and Reserve for Unfunded Commitments

9 Months Ended

Sep. 30, 2017

Receivables [Abstract]

Allowance for Loan and Lease Losses and Reserve for Unfunded Commitments

Note 6—Allowance forLoanand Lease Losses and ReserveforUnfundedCommitments

Loans and leasesconsideredforinclusionin theallowanceforloanand leaselossesincludeacquired non-impairedloansand leases,thoseacquiredimpairedloanswith creditdeteriorationafteracquisition,and originatedloansand leases.Although allacquiredloansand leasesareincludedin the followingtable,only thosewith creditdeteriorationsubsequentto acquisitiondateareactuallyincludedin the allowanceforloanand leaselosses.

The followingtablessummarizethebalanceand activitywithintheallowanceforloanand leaselosses, thecomponentsof theallowanceforloanand leaselossesin termsof loansand leasesindividuallyand collectivelyevaluatedforimpairment,and correspondingloanand leasebalancesby typefor the three and nine months ended September 30, 2017 and 2016 are as follows:

September 30, 2017	Commercial Real Estate			Residential Real Estate			Construction, Land Development, and Other Land			Commercial and Industrial			Installment and Other			Lease Financing Receivables			Total
Allowance for loan and lease losses
Three months ended
Beginning balance	$	3,668		$	1,835		$	327		$	5,689		$	344		$	2,106		$	13,969
Provisions		1,577			52			(111	)		1,440			13			929			3,900
Charge-offs		(186	)		(161	)		—			(763	)		(327	)		(862	)		(2,299	)
Recoveries		—			—			—			—			—			410			410
Ending balance	$	5,059		$	1,726		$	216		$	6,366		$	30		$	2,583		$	15,980
Nine months ended
Beginning balance	$	1,945		$	2,483		$	742		$	4,196		$	334		$	1,223		$	10,923
Provisions		3,591			(400	)		(526	)		3,932			23			2,686			9,306
Charge-offs		(477	)		(357	)		—			(1,762	)		(327	)		(2,399	)		(5,322	)
Recoveries		—			—			—			—			—			1,073			1,073
Ending balance	$	5,059		$	1,726		$	216		$	6,366		$	30		$	2,583		$	15,980
Ending balance:
Individually evaluated for    impairment	$	1,186		$	176		$	—		$	1,585		$	2		$	—		$	2,949
Collectively evaluated for    impairment		1,844			1,237			155			3,389			10			2,583			9,218
Loans acquired with deteriorated    credit quality		2,029			313			61			1,392			18			—			3,813
Total allowance for loan and lease    losses	$	5,059		$	1,726		$	216		$	6,366		$	30		$	2,583		$	15,980

September 30, 2017	Commercial Real Estate		Residential Real Estate		Construction, Land Development, and Other Land		Commercial and Industrial		Installment and Other		Lease Financing Receivables		Total
Loans and leases ending balance:
Individually evaluated for    impairment	$	14,928	$	1,948	$	565	$	6,075	$	2	$	—	$	23,518
Collectively evaluated for    impairment		673,851		428,565		88,315		484,547		2,762		172,341		1,850,381
Loans acquired with deteriorated    credit quality		173,106		152,149		5,424		11,433		488		—		342,600
Total loans and leases	$	861,885	$	582,662	$	94,304	$	502,055	$	3,252	$	172,341	$	2,216,499

September 30, 2016	Commercial Real Estate			Residential Real Estate			Construction, Land Development, and Other Land			Commercial and Industrial			Installment and Other			Lease Financing Receivables			Total
Allowance for loan and lease losses
Three months ended
Beginning balance	$	2,119		$	1,303		$	489		$	1,472		$	367		$	740		$	6,490
Provisions		27			41			66			624			(3	)		928			1,683
Charge-offs		(1,078	)		25			(95	)		(2	)		(9	)		(671	)		(1,830	)
Recoveries		—			—			—			—			—			158			158
Ending balance	$	1,068		$	1,369		$	460		$	2,094		$	355		$	1,155		$	6,501
Nine months ended
Beginning balance	$	2,280		$	2,981		$	232		$	1,403		$	357		$	379		$	7,632
Provisions		3,050			(980	)		323			768			8			2,179			5,348
Charge-offs		(4,262	)		(632	)		(95	)		(77	)		(10	)		(1,934	)		(7,010	)
Recoveries		—			—			—			—			—			531			531
Ending balance	$	1,068		$	1,369		$	460		$	2,094		$	355		$	1,155		$	6,501
Ending balance:
Individually evaluated for    impairment	$	—		$	339		$	—		$	192		$	328		$	—		$	859
Collectively evaluated for    impairment		669			534			413			1,264			1			1,155			4,036
Loans acquired with deteriorated    credit quality		399			496			47			638			26			—			1,606
Total allowance for loan and lease    losses	$	1,068		$	1,369		$	460		$	2,094		$	355		$	1,155		$	6,501

September 30, 2016	Commercial Real Estate		Residential Real Estate		Construction, Land Development, and Other Land		Commercial and Industrial		Installment and Other		Lease Financing Receivables		Total
Loans and leases ending balance:
Individually evaluated for    impairment	$	6,374	$	2,553	$	—	$	192	$	328	$	—	$	9,447
Collectively evaluated for    impairment		377,090		438,446		104,369		244,566		1,055		154,557		1,320,083
Loans acquired with deteriorated    credit quality		187,359		185,979		7,539		6,512		590		—		387,979
Total loans and leases	$	570,823	$	626,978	$	111,908	$	251,270	$	1,973	$	154,557	$	1,717,509

The Company increased the allowance for loan and lease losses by $2.0 million and $5.1 million for the three and nine months ended September 30, 2017, respectively. The Company increased theallowanceforloanand lease lossesby $11,000 for the three months ended September 30, 2016 and decreased the allowance for loan and lease losses by $1.1 million forthe nine months ended September 30, 2016. For acquired impaired loans, the Company increased the allowance for loan and lease losses by $559,000 and $2.2 million for the three and nine months ended September 30, 2017, respectively. The Company increased the allowance for loan and lease losses for acquired impaired loans by $8,000 for the three months ended September 30, 2016 and decreased the allowance for loan and lease losses for acquired impaired loans by $1.7 million for the nine months ended September 30, 2016.

The followingtablessummarizetherecordedinvestment,unpaidprincipalbalance, and relatedallowanceforloansand leasesconsideredimpaired as of September 30, 2017 and December 31, 2016, which excludes acquired impaired loans:

September 30, 2017	Recorded Investment		Unpaid Principal Balance		Related Allowance
With no related allowance recorded
Commercial real estate	$	9,541	$	10,149	$	—
Residential real estate		1,581		2,589		—
Construction, land development and other land		565		565		—
Commercial and industrial		3,465		3,652		—
With an allowance recorded
Commercial real estate		5,387		5,521		1,186
Residential real estate		367		387		176
Commercial and industrial		2,610		2,934		1,585
Installment and other		2		310		2
Total impaired loans	$	23,518	$	26,107	$	2,949

December 31, 2016	Recorded Investment		Unpaid Principal Balance		Related Allowance
With no related allowance recorded
Commercial real estate	$	8,916	$	9,502	$	—
Residential real estate		804		1,999		—
Commercial and Industrial		521		524		—
With an allowance recorded
Residential real estate		496		528		293
Commercial and industrial		861		869		396
Installment and other		328		361		328
Total impaired loans	$	11,926	$	13,783	$	1,017

The following tables summarize the average recorded investment and interest income recognized for loans and leases considered impaired, which excludes acquired impaired loans, for the periods ended as follows:

September 30, 2017	Average Recorded Investment		Interest Income Recognized
With no related allowance recorded
Commercial real estate	$	10,605	$	419
Residential real estate		1,698		33
Construction, land development and other land		269		2
Commercial and Industrial		2,391		253
With an allowance recorded
Commercial real estate		1,043		287
Residential real estate		444		4
Construction, land development and other land		19		—
Commercial and industrial		1,673		500
Installment and other		213		11
Total impaired loans	$	18,355	$	1,509

September 30, 2016	Average Recorded Investment		Interest Income Recognized
With no related allowance recorded
Commercial real estate	$	4,129	$	128
Residential real estate		2,479		65
Construction, land development and other land		96		—
Commercial and industrial		12		—
With an allowance recorded
Commercial real estate		2,099		—
Residential real estate		727		7
Construction, land development and other land		156		—
Commercial and industrial		171		2
Installment and other		328		11
Total impaired loans	$	8,337	$	192

For purposesof thesetables,theunpaidprincipalbalancerepresentstheoutstandingcontractualbalance. Impairedloansincludeloansthatareindividuallyevaluatedforimpairmentas wellas troubleddebt restructuringsforallloancategories.The sumof non-accrualloansand loanspastdue 90 days stillon accrual willdifferfromthetotalimpairedloanamount.

The followingtablessummarizetheriskratingcategoriesof theloansand leasesconsideredfor inclusionin theallowanceforloanand leaselossescalculation,excludingacquiredimpairedloans,as of September 30, 2017 and December 31, 2016:

September 30, 2017	Commercial Real Estate		Residential Real Estate		Construction, Land Development, and Other Land		Commercial and Industrial		Installment and Other		Lease Financing Receivables		Total
Pass	$	617,061	$	421,109	$	73,781	$	400,838	$	2,761	$	170,410	$	1,685,960
Watch		44,273		4,871		11,947		71,752		3		214		133,060
Special Mention		11,958		2,513		2,587		10,104		—		894		28,056
Substandard		15,487		2,020		565		7,928		—		639		26,639
Doubtful		—		—		—		—		—		184		184
Loss		—		—		—		—		—		—		—
Total	$	688,779	$	430,513	$	88,880	$	490,622	$	2,764	$	172,341	$	1,873,899

December 31, 2016	Commercial Real Estate		Residential Real Estate		Construction, Land Development, and Other Land		Commercial and Industrial		Installment and Other		Lease Financing Receivables		Total
Pass	$	536,499	$	419,880	$	129,732	$	369,136	$	2,052	$	157,296	$	1,614,595
Watch		38,707		10,885		2,897		52,872		4		324		105,689
Special Mention		5,377		3,116		1,158		1,258		1		512		11,422
Substandard		8,458		1,140		—		1,508		328		739		12,173
Doubtful		—		—		—		—		—		95		95
Loss		—		—		—		—		—		—		—
Total	$	589,041	$	435,021	$	133,787	$	424,774	$	2,385	$	158,966	$	1,743,974

The following tables summarize contractual delinquency information for acquired non-impaired and originated loans and leases by category at September 30, 2017 and December 31, 2016:

September 30, 2017	30-59 Days Past Due		60-89 Days Past Due		Greater than 90 Days and Accruing		Non- accrual		Total Past Due		Current		Total
Commercial real estate	$	350	$	596	$	—	$	8,672	$	9,618	$	679,161	$	688,779
Residential real estate		—		220		—		1,852		2,072		428,441		430,513
Construction, land development, and    other land		—		—		—		565		565		88,315		88,880
Commercial and industrial		2,245		416		—		3,537		6,198		484,424		490,622
Installment and other		2		—		—		—		2		2,762		2,764
Lease financing receivables		995		328		—		495		1,818		170,523		172,341
Total	$	3,592	$	1,560	$	—	$	15,121	$	20,273	$	1,853,626	$	1,873,899

December 31, 2016	30-59 Days Past Due		60-89 Days Past Due		Greater than 90 Days and Accruing		Non- accrual		Total Past Due		Current		Total
Commercial real estate	$	2,944	$	648	$	—	$	3,935	$	7,527	$	581,514	$	589,041
Residential real estate		243		—		—		1,118		1,361		433,660		435,021
Construction, land development, and    other land		1,363		—		—		—		1,363		132,424		133,787
Commercial and industrial		6,066		374		—		958		7,398		417,376		424,774
Installment and other		—		—		—		328		328		2,057		2,385
Lease financing receivables		2,070		390		—		445		2,905		156,061		158,966
Total	$	12,686	$	1,412	$	—	$	6,784	$	20,882	$	1,723,092	$	1,743,974

At September 30, 2017 and December 31, 2016, theCompany had a recordedinvestmentin troubleddebt restructuringsof $2.3 million and $1.2 million,respectively.The restructuringswere granteddue to borrower financialdifficultyand providefora modificationof loanrepaymentterms.The Company has not allocatedany specificallowancefortheseloansat September 30, 2017 and December 31, 2016. In addition,therewere no commitments outstandingon troubleddebtrestructurings.

Loans modifiedas troubleddebtrestructuringsthatoccurredduringthe three and nine months ended September 30, 2017 and year ended December 31, 2016 did not resultin any charge-offsor permanentreductionsof therecordedinvestmentsin theloans. There were $867,000 and $2.1 million of loans modified as troubled debt restructurings during the three and nine months ended September 30, 2017. Troubleddebtrestructuringsthatsubsequentlydefaultedwithintwelvemonthsof therestructuredateduringthe year ended December 31, 2016 had a recordedinvestmentof $477,000. No troubleddebtrestructuringssubsequentlydefaultedwithintwelvemonthsof therestructuredateduringthe three and nine months ended September 30, 2017.

At September 30, 2017 and December 31, 2016, thereserveforunfundedcommitmentswas $1.0 million and $760,000, respectively.During the nine months ended September 30, 2017 and 2016, theprovisionsforunfundedcommitments were $272,000 and $56,000, respectively.Therewere no charge-offsor recoveriesrelatedto thereservefor unfundedcommitmentsduringthe periods.

XML

Servicing Assets

9 Months Ended

Sep. 30, 2017

Transfers And Servicing [Abstract]

Servicing Assets

Note 7—ServicingAssets

As partof theRidgestoneacquisition,theCompany acquiredloanservicingassets.The Company did not hold any servicingassetsuntil the acquisition on October 14, 2016.

Loans servicedforothersarenot includedin theConsolidatedStatementsof FinancialCondition.The unpaidprincipalbalancesof theseloansservicedforotherswere as follows as of September 30, 2017 and December 31, 2016:

	September 30,		December 31,
	2017		2016
Loan portfolios serviced for:
SBA guaranteed loans	$	1,001,845	$	911,803
USDA guaranteed loans		87,589		106,125
Total	$	1,089,434	$	1,017,928

Activityforservicingassetsand therelatedchangesin fairvalue for the nine months ended September 30, 2017 is as follows:

	Nine Months Ended
	September 30, 2017
Beginning balance	$	21,091
Additions, net		4,675
Changes in fair value		(4,097	)
Ending balance	$	21,669

Loan servicing income totaled $1.0 million and $3.0 million for the three and nine months ended September 30, 2017, respectively.

The fairvalueof servicingrightsishighlysensitiveto changesin underlyingassumptions.Changes in prepaymentspeedassumptionshave themostsignificantimpacton thefairvalueof servicingrights.

Generally, as interest rates rise on variable rate loans, loan prepayments increase due to an increase in refinance activity, which may result in a decrease in the fair value of servicing assets. Measurement of fair value is limited to the condition existing and the assumptions used as of a particular point in time, and those assumptions may change over time. Refer to Note 16—Fair Value Measurement for further details.

XML

Other Real Estate Owned

9 Months Ended

Sep. 30, 2017

Banking And Thrift [Abstract]

Other Real Estate Owned

Note 8—Other Real Estate Owned

The following table presents the change in other real estate owned (“OREO”) for the nine months ended September 30, 2017 and 2016.

	Nine Months Ended September 30,
	2017			2016
Beginning balance	$	16,570		$	26,715
Net additions to OREO		5,701			3,721
Proceeds from the sales of OREO		(9,583	)		(15,392	)
Net gains on sales of OREO		1,538			1,134
Valuation adjustments		(367	)		(904	)
Ending balance	$	13,859		$	15,274

The recorded investment in residential mortgage loans secured by residential real estate properties (including purchased credit-impaired loans) for which foreclosure proceedings are in process totaled $2.0 million and $2.7 million at September 30, 2017 and December 31, 2016, respectively.

XML

Goodwill, Core Deposit Intangible and Other Intangible Assets

9 Months Ended

Sep. 30, 2017

Goodwill And Intangible Assets Disclosure [Abstract]

Goodwill, Core Deposit Intangible and Other Intangible Assets

Note 9—Goodwill, Core Deposit Intangible and Other Intangible Assets

The following table summarizes the changes in the Company’s goodwill and core deposit intangible assets for the nine months ended September 30, 2017 and 2016:

	Nine Months Ended September 30,
	2017					2016
	Goodwill		CoreDeposit Intangible			Goodwill		Core Deposit Intangible
Beginning balance	$	51,975	$	19,776		$	25,688	$	22,275
Amortization or accretion		—		(2,293	)		—		(2,228	)
Ending balance	$	51,975	$	17,483		$	25,688	$	20,047
Accumulated amortization or accretion	N/A		$	12,703		N/A		$	9,653
Weighted average remaining amortization or accretion    period	N/A		5.8 Years			N/A		6.8 Years

The Company had other intangible assets of $39,000 and $50,000 as of September 30, 2017 and December 31, 2016, respectively, related to trademark-related transactions.

The following table presents the estimated amortization expense for core deposit intangible and other intangible assets recognized at September 30, 2017:

	Estimated Amortization
2017	$	767
2018		3,060
2019		3,050
2020		3,027
2021		3,017
Thereafter		4,601
Total	$	17,522

XML

Income Taxes

9 Months Ended

Sep. 30, 2017

Income Tax Disclosure [Abstract]

Income Taxes

Note 10—IncomeTaxes

The Company uses an estimated annual effective tax rate method in computing its interim tax provision. This effective tax rate is based on forecasted annual pre-tax income, permanent tax differences and statutory tax rates.

The effective tax rates for the nine months ended September 30, 2017 and 2016 were 24.4% and (8.6)%, respectively. The Company began to recognize income tax expense in the quarter ended December 31, 2016 after the reversal of $61.9 million of the Company’s previously established valuation allowance on its net deferred tax assets.

Deferred tax assets decreased $7.4 million from $67.8 million at December 31, 2016 to $60.4 million at September 30, 2017. This decrease was primarily due to a reduction in the Company’s net operation loss carryforwards being applied to the current year tax liability.

As part of a budget package passed by the Legislature of the State of Illinois, the corporate income tax rate increased from 5.25% to 7.00% effective July 1, 2017.   As a result of the increase in the corporate income tax rate, we recorded a state income tax benefit of $4.6 million due to increased value of our deferred tax asset related to our Illinois net loss deduction.

XML

Deposits

9 Months Ended

Sep. 30, 2017

Deposits [Abstract]

Deposits

Note 11—Deposits

The composition of deposits was as follows as of September 30, 2017 and December 31, 2016:

	September 30,		December 31,
	2017		2016
Non-interest bearing demand deposits	$	753,662	$	724,457
Interest bearing checking accounts		187,232		173,929
Money market demand accounts		418,006		369,074
Other savings		435,536		446,418
Time deposits (below $100,000)		377,929		392,854
Time deposits ($100,000 and above)		348,564		383,662
Total deposits	$	2,520,929	$	2,490,394

Time deposits of $100,000 or more included $30.8 million of brokered deposits at December 31, 2016 and none at September 30, 2017. Time deposits in denominations of $250,000 or more at September 30, 2017 and December 31, 2016 were $83.4 million and $117.4 million, respectively.

XML

Federal Home Loan Bank Advances

9 Months Ended

Sep. 30, 2017

Federal Home Loan Banks [Abstract]

Federal Home Loan Bank Advances

Note 12—FederalHomeLoanBankAdvances

The followingtablesummarizestheFHLBadvancesas of September 30, 2017 and December 31, 2016, which include acquisition accounting adjustments of $72,000 and $228,000, respectively, alongwith weightedaveragecostsand scheduledmaturities:

	September 30,			December 31,
	2017			2016
Federal Home Loan Bank advances	$	234,559		$	313,715
Weighted average cost		1.32	%		0.73	%

	Scheduled Maturities
2017	$	225,000
2018		9,559
Total	$	234,559

At September 30, 2017, advances had fixed terms with interestratesrangingfrom 1.24% to 3.22% and maturitiesrangingfrom December 2017 to February2018. The Bank’sadvancesfromtheFHLBarecollateralizedby residentialrealestateloansand securities. At September 30, 2017 and December 31, 2016, the Bank had additional borrowing capacity from the FHLB of $913.0 million and $647.9 million, respectively, subject to the availability of proper collateral.  The Bank’s maximumborrowingcapacityislimitedto 35% of totalassets.

FHLBadvancesassumedfromtheRidgestoneacquisitionof $1.5 millionareputablequarterlyand are requiredto be repaidupon therequestof theFHLB.

The Company hedgesinterestrateson borrowedfundsusinginterestrateswaps throughwhich the Company receivesvariableamountsand pays fixedamounts.Referto Note 17—DerivativeInstrumentsand Hedge Activitiesforadditionalinformation.

XML

Other Borrowings

9 Months Ended

Sep. 30, 2017

Debt Disclosure [Abstract]

Other Borrowings

Note 13—Other Borrowings

The following is a summary of the Company’s other borrowings as of September 30, 2017 and December 31, 2016:

	September 30,		December 31,
	2017		2016
Securities sold under agreements to repurchase	$	30,807	$	17,249
Line of credit		—		20,650
Total	$	30,807	$	37,899

Securitiessoldunderagreementsto repurchaserepresenta demanddepositproductofferedto customers thatsweep balancesin excessof theFDICinsurancelimitintoovernightrepurchaseagreements.The Company pledgessecuritiesas collateralfortherepurchaseagreements.Referto Note 4—Securitiesforadditional discussion.

OnOctober13,2016,inconnectionwiththeRidgestoneacquisition,theCompany enteredintoa$30.0million creditagreementwithThe PrivateBank and Trust and Company, now known as CIBC Bank USA (“CIBC”), witha$300,000commitmentfeepayableat suchtime.Thelineofcreditmatured onOctober12,2017andcarriedaninterestrateequaltothePrime Rate.At September 30, 2017 and December 31, 2016,the interestratewas 4.25% and 3.75%, respectively.Asof September 30, 2017 and December 31, 2016,theCompanywasincompliancewithallfinancialcovenantsset forthinthelineofcreditagreement.  In April 2017, the revolving line of credit was amended to a non-revolving line of credit as long as the outstanding balance exceeds $5.0 million. When the outstanding balance reaches $5.0 million, the line of credit will be converted to a revolving line of credit with credit availability up to $5.0 million until maturity.  In July 2017, the Company repaid the outstanding balance, in full, under this line of credit of $16.2 million with proceeds from its initial public offering.  On October 12, 2017, the Company amended the credit agreement, which extended the maturity date to October 11, 2018. The amended revolving line of credit bears interest at either the LIBOR Rate plus 250 basis points or the Prime Rate minus 25 basis points, based on the Company’s election, which is required to be communicated to CIBC at least three business days prior to the commencement of an interest period. If the Company fails to provide timely notification, the interest rate will be Prime Rate minus 25 basis points.

The followingtablepresentsshort-termcreditlinesavailableforuse, forwhich theCompany did not have an outstandingbalanceas of September 30, 2017 and December 31, 2016:

	September 30,		December 31,
	2017		2016
Federal Reserve Bank of Chicago discount window line	$	135,278	$	110,600
Available federal funds lines		40,000		20,000

XML

Junior Subordinated Debentures

9 Months Ended

Sep. 30, 2017

Debt Disclosure [Abstract]

Junior Subordinated Debentures

Note 14—Junior Subordinated Debentures

At September 30, 2017 and December 31, 2016, theCompany’sjuniorsubordinateddebenturesby issuancewere as follows:

Name of Trust	Aggregate Principal Amount September 30, 2017			Aggregate Principal Amount December 31, 2016			Stated Maturity	Contractual Rate at September 30, 2017			Interest Rate Spread
MetropolitanStatutory Trust 1	$	35,000		$	35,000		March17, 2034		4.11	%	Three-month LIBOR + 2.79%
RidgeStone Capital Trust I		1,500			1,500		June 30, 2033		5.09	%	Five-year LIBOR + 3.50%
Total liability, at par		36,500			36,500
Discount		(9,018	)		(9,574	)
Total liability, at carrying value	$	27,482		$	26,926

In 2004, theCompany’spredecessor,MetropolitanBank Group, Inc.,issued$35.0 millionfloatingrate juniorsubordinateddebenturesto MetropolitanStatutoryTrust1, which was formedfortheissuanceof trust preferredsecurities.The debenturesbearinterestatthree-monthLondon InterbankOfferedRate (“LIBOR”) plus 2.79% (4.11%and 3.78% at September 30, 2017 and December 31, 2016, respectively).Interestispayablequarterly.The Company has therightto redeemthedebentures,in whole or in part,on any interestpaymentdateon or after March2009. Accruedinterestpayablewas $54,000 and $50,000 as of September 30, 2017 and December 31, 2016, respectively.

As part of the Ridgestone acquisition, the Company assumed the obligations to RidgeStone Capital Trust I of $1.5 million in principal amount, which was formed for the issuance of trust preferred securities. Refer to Note 3—Acquisition of a Business for additional information. Beginning on June 30, 2008, the interest rate reset to the five-year LIBOR plus 3.50% (5.09% at September 30, 2017 and December 31, 2016), which is in effect until September 30, 2018 and updated every five years. Interest is paid on a quarterly basis. The Company has the right to redeem the debentures, in whole or in part, on any interest payment date on or after June 30, 2008. There was no accrued interest payable as of September 30, 2017 or December 31, 2016.

The Trustsarenot consolidatedwith theCompany. Accordingly,theCompany reportsthesubordinated debenturesheldby theTrustsas liabilities.The Company owns allof thecommonsecuritiesof eachtrust.The juniorsubordinateddebenturesqualify,and aretreatedas, Tier1 regulatorycapitalof theCompany subjectto regulatorylimitations.The trustpreferredsecuritiesissuedby eachtrustrankequallywith thecommonsecurities in rightof payment,exceptthatifan eventof defaultundertheindenturegoverningthenoteshas occurredand is continuing,thepreferredsecuritieswillrankseniorto thecommonsecuritiesin rightof payment.

XML

Commitments and Contingent Liabilities

9 Months Ended

Sep. 30, 2017

Commitments And Contingencies Disclosure [Abstract]

Commitments and Contingent Liabilities

Note 15—Commitmentsand Contingent Liabilities

Legalcontingencies—Intheordinarycourseofbusiness,theCompanyandBankhavevarious outstandingcommitmentsandcontingentliabilitiesthatarenotrecognizedintheaccompanyingconsolidated financialstatements.Inaddition,theCompanymaybeadefendantincertainclaimsandlegalactionsarisinginthe ordinarycourseofbusiness.Intheopinionofmanagement,afterconsultationwithlegalcounsel,theultimate dispositionofthesemattersiscurrentlynotexpectedtohaveamaterialadverseeffectonthe Company’s Consolidated Statements of Financial Condition.

Operatingleasecommitments—The Company has enteredintovariousoperatingleaseagreements primarilyforfacilitiesand landon which bankingfacilitiesarelocated.Certainleaseagreementshave renewal optionsattheend of theoriginalleasetermand certainleaseagreementshave escalationclausesin therent payments.

The minimumannualrentalcommitmentsforoperatingleasessubsequentto September 30, 2017, exclusiveof taxesand othercharges,aresummarizedas follows:

	MinimumRental Commitments
2017	$	754
2018		2,849
2019		2,506
2020		2,006
2021		1,759
Thereafter		3,025
Total	$	12,899

The Company’srentalexpensesforthe nine months ended September 30, 2017 and 2016  were $3.4 millionand $2.7 million,respectively. Rental expenses for the three months ended September 30, 2017 and 2016 were $1.1 million and $950,000, respectively. For the nine months ended September 30, 2017 and 2016, theCompany received $526,000 and $551,000, respectively,in subleaseincomewhich isincludedin the ConsolidatedStatementsof Operationsas a reductionof occupancyexpense. Sublease income for the three months ended September 30, 2017 and 2016 was $166,000 and $187,000, respectively. In additionto theabove requiredleasepayments, the Company has contractualobligationsrelated primarilyto informationtechnologycontractsand othermaintenancecontracts.The amountsarenot material.

Commitmentsto extend credit—The Bank ispartyto financialinstrumentswith off-balancesheetrisk in thenormalcourseof businessto meetthefinancingneedsof itscustomers.These financialinstrumentsinclude commitmentsto extendcreditand standbylettersof credit.Those instrumentsinvolve,to varyingdegrees, elementsof creditand interestrateriskin excessof theamountrecognizedin theConsolidatedStatementsof FinancialCondition.The contractualor notionalamountsof thoseinstrumentsreflecttheextentof involvement theBank has in particularclassesof financialinstruments.

The Bank’s exposureto creditlossin theeventof non-performanceby theotherpartyto thefinancial instrumentforcommitmentsto extendcreditand standbylettersof creditisrepresentedby thecontractualor notionalamountof thoseinstruments.The Bank usesthesamecreditpoliciesin makingcommitmentsand conditionalobligationsas itdoes forfundedinstruments.The Bank does not anticipateany materiallossesas a resultof thecommitmentsand standbylettersof credit.

The followingtablesummarizesthecontractor notionalamountof outstandingloanand lease commitmentsat September 30, 2017 and December 31, 2016:

	September 30,				December 31,
	2017				2016
	Fixed Rate		Variable Rate		Fixed Rate		Variable Rate
Commitments to extend credit	$	46,427	$	425,115	$	37,731	$	332,928
Standby letters of credit		1,050		3,655		1,060		4,135
Total	$	47,477	$	428,770	$	38,791	$	337,063

Commitmentsto extendcreditareagreementsto lendto a customeras long as thereisno violationof any conditionestablishedin thecontract.Commitmentsgenerallyhave fixedexpirationdatesor other terminationclausesand mayrequirepaymentof a fee.Sincemanyof thecommitmentsareexpectedto expire withoutbeingdrawn upon, thetotalcommitmentamountdoes not necessarilyrepresentfuturecashrequirements. The Bank evaluateseachcustomer’screditworthinesson a case-by-casebasis.The amountof collateralobtained, ifdeemednecessaryby theBank upon extensionof credit,isbasedon management’screditevaluationof the counterparty.Collateralisprimarilyobtainedin theformof commercialand residentialrealestate(including incomeproducingcommercialproperties).

Standby lettersof creditareconditionalcommitmentsissuedby theBank to guaranteeto a third-party theperformanceof a customer.Those guaranteesareprimarilyissuedto supportpublicand privateborrowing arrangements,bond financingand similartransactions.The creditriskinvolvedin issuinglettersof creditis essentiallythesameas thatinvolvedin extendingloanfacilitiesto customers.

Commitmentsto makeloansaregenerallymadeforperiodsof 90 days or less.The fixedrateloan commitmentshave interestratesrangingfrom3.23% to 19.50% and maturitiesup to 2020. Variablerateloan commitmentshave interestratesrangingfrom2.45% to 8.25% and maturitiesup to 2040.

XML

Fair Value Measurement

9 Months Ended

Sep. 30, 2017

Fair Value Disclosures [Abstract]

Fair Value Measurement

Note 16—Fair Value Measurement

Fairvalueistheexchangepricethatwould be receivedforan assetor paidto transfera liability(exit price)in theprincipalor mostadvantageousmarketfortheassetor liabilityin an orderlytransactionbetween marketparticipantson themeasurementdate.In addition,theCompany has theabilityto obtainfairvaluesfor marketsthatarenot accessible.

These typesof inputscreatethefollowingfairvaluehierarchy:

Level 1—Quoted pricesin activemarketsforidenticalassetsor liabilities.

Level 2—Quoted pricesforsimilarinstrumentsin activemarkets,quotedpricesforidenticalor similar instrumentsin marketsthatarenot activeand model-derivedvaluationswhose inputsareobservableor whose significantvaluedriversareobservable.

Level 3—Unobservableinputsthataresupportedby littleor no marketactivityand thataresignificant to thefairvalueof theassetor liability.Unobservableinputsareused to measurefairvalueto theextentthat observableinputsarenot available.The Company’sown dataused to developunobservableinputsmaybe adjustedformarketconsiderationswhen reasonablyavailable.

A financialinstrument’scategorizationwithinthevaluationhierarchyisbasedupon thelowestlevelof inputthatissignificantto thefairvaluemeasurement.The Company’sassessmentof thesignificanceof a particularinputto thefairvaluemeasurementin itsentiretyrequiresjudgment,and considersfactorsspecificto assetsand liabilities.

The Company used thefollowingmethodsand significantassumptionsto estimatefairvalueforcertain assetsmeasuredand carriedatfairvalueon a recurringbasis:

Securitiesavailable-for-sale—The Company obtainsfairvaluemeasurementsfroman independent pricingservice.Managementreviewstheproceduresused by thethirdparty,includingsignificantinputsused in thefairvaluecalculations.The fairvaluemeasurementsconsiderobservabledatathatmayincludedealerquotes, marketspreads,cashflows,theU.S.Treasuryyieldcurve,livetradinglevels,tradeexecutiondata,market consensusprepaymentspeeds,creditinformationand thebond’stermsand conditions,amongotherthings.When marketquotesarenot readilyaccessibleor available,alternativeapproachesareutilized,such as matrixor model pricing.

The Company’smethodologyforpricingnon-ratedbonds focuseson threedistinctinputs:equivalent rating,yieldand otherpricingterms.To determinetheratingfora givennon-ratedmunicipalbond, theCompany referencesa publiclyissuedbond by thesameissuerifavailableas wellas otheradditionalkey metricsto supportthecreditworthiness.Typically,pricingforthesetypesof bonds would requirea higheryieldthana similarratedbond fromthesameissuer.A reductionin priceisappliedto theratingobtainedfromthe comparablebond, as theCompany believesifliquidated,a non-ratedbond would be valuedlessthana similar bond with a verifiablerating.The reductionappliedby theCompany isone notchlower(i.e.a “AA” ratingfora comparablebond would be reducedto “AA-” fortheCompany’svaluation).In 2017 and 2016, allof theratingsderivedby theCompany were “BBB”or betterwith and withoutcomparablebond proxies.The fairvaluemeasurementof municipalbonds issensitiveto theratinginput,as a higherratingtypicallyresultsin an increasedvaluation.The remainingpricinginputsused in thebond valuationareobservable.Based on theratingdetermined,the Company obtainsa correspondingcurrentmarketyieldcurveavailableto marketparticipants.Otherterms includingcoupon, maturitydate,redemptionprice,numberof coupon paymentsperyear,and accrualmethodare obtainedfromtheindividualbond termsheets.

Servicingassets—Fairvalueisbasedon a loan-by-loanbasistakingintoconsiderationtheoriginalterm to maturity,thecurrentage of theloanand theremainingtermto maturity.The valuationmethodologyutilized fortheservicingassetsbeginswith generatingfuturecashflowsforeachservicingasset,basedon theirunique characteristicsand market-basedassumptionsforprepaymentspeeds.The presentvalueof thefuturecashflows arethencalculatedutilizingmarket-baseddiscountrateassumptions.

Derivativeinstruments—Interestrateswaps arevaluedby a thirdparty,usingmodelsthatprimarily use marketobservableinputs,such as yieldcurves,and arevalidatedby comparisonwith valuationsprovidedby therespectivecounterparties.Derivativefinancialinstrumentsareincludedin otherassetsand otherliabilitiesin theConsolidatedStatementsof FinancialCondition.

The followingtablessummarizetheCompany’sfinancialassetsand liabilitiesthatwere measuredatfair valueon a recurringbasisat September 30, 2017 and December 31, 2016:

			Fair Value Measurements Using
September 30, 2017	Fair Value		Level 1		Level 2		Level 3
Financial assets
Securities available-for-sale
U.S. Treasury Notes	$	14,925	$	14,925	$	—	$	—
U.S. Government agencies		53,219		—		53,219		—
Obligations of states, municipalities, and political    subdivisions		32,535		—		31,985		550
Mortgage-backed securities; residential
Agency		324,040		—		324,040		—
Non-Agency		25,470		—		25,470		—
Mortgage-backed securities; commercial
Agency		70,757		—		70,757		—
Non-Agency		31,257		—		31,257		—
Corporate securities		27,524		—		27,524		—
Other securities		4,957		1,938		2,480		539
Servicing assets		21,669		—		—		21,669
Derivative assets		3,913		—		3,913		—
Financial liabilities
Derivative liabilities		1,190		—		1,190		—

			Fair Value Measurements Using
December 31, 2016	Fair Value		Level 1		Level 2		Level 3
Financial assets
Securities available-for-sale
U.S. Treasury Notes	$	14,920	$	14,920	$	—	$	—
U.S. Government agencies		58,857		—		58,857		—
Obligations of states, municipalities, and political    subdivisions		16,059		—		15,509		550
Mortgage-backed securities; residential
Agency		368,160		—		368,160		—
Non-Agency		19,933		—		19,933		—
Mortgage-backed securities; commercial
Agency		77,403		—		77,403		—
Non-Agency		31,052		—		31,052		—
Corporate securities		17,329		—		17,329		—
Other securities		4,847		1,938		2,379		530
Servicing assets		21,091		—		—		21,091
Derivative assets		4,317		—		4,317		—
Financial liabilities
Derivative liabilities		559		—		559		—

During 2016, theCompany acquiredtheservicingassetsand single-issuertrustpreferredsecurities includedin othersecuritiescategorizedas Level3 of thefairvaluehierarchythrougha businesscombination.

In addition,during2016, theCompany purchasedprivately-issuedmunicipalsecuritiesthatare categorizedas Level3. These municipalsecuritiesarebonds issuedforone municipalgovernmententity locatedin theChicago metropolitan area and areprivatelyplaced,non-ratedbonds withoutCommittee on Uniform Security Identification Proceduresnumbers.

The Company did not have any transfersbetweenLevel1 and Level2 of thefairvaluehierarchyduringthe nine months ended September 30, 2017 and 2016. The Company’spolicyfordeterminingtransfersbetweenlevelsoccursattheend of thereportingperiodwhen circumstancesin theunderlyingvaluationcriteriachangeand resultin transfer betweenlevels.

The following table presents additional information about financial assets measured at fair value on recurring basis for which the Company used significant unobservable inputs (Level 3):

	Nine Months Ended
	September 30,
	2017		2016		2017			2016
	Investment Securities				Servicing Assets
Balance, beginning of period	$	1,080	$	—	$	21,091		$	—
Additions, net		—		—		4,675			—
Amortization		3		—		—			—
Change in unrealized loss		6		—		—			—
Change in fair value		—		—		(4,097	)		—
Balance, end of period	$	1,089	$	—	$	21,669		$	—

The followingtablepresentsadditionalinformationabouttheunobservableinputsused in thefairvalue measurementson recurringbasisthatwere categorizedwithinLevel3 of thefairvaluehierarchyas of September 30, 2017:

Financial Instruments	Valuation Technique	Unobservable Inputs	Range of Inputs	Weighted Average Range			Impact to Valuation from an Increased or Higher Input Value
Obligations of states, municipalities,    and political obligations	Discountedcash flow	Probability of default	2.0%—2.4%		2.2	%	Decrease
Single issuer trust preferred	Discounted cash flow	Probability of default	7.5%—9.9%		8.9	%	Decrease
Servicing assets	Discounted cash flow	Prepayment speeds	1.7%—9.0%		7.6	%	Decrease
		Discount rate	9.1%—16.2%		12.8	%	Decrease
		Expected weighted average loan life	0.4—11.5 years	6.1 years			Increase

The Company used thefollowingmethodsand significantassumptionsto estimatefairvalueforcertain assetsmeasuredand carriedatfairvalueon a non-recurringbasis:

Impairedloans (excludingacquired impairedloans)—Impairedloans,otherthanthoseexistingon thedateof a businessacquisition,areprimarilycarriedatthefairvalueof theunderlyingcollateral,less estimatedcoststo sell,iftheloaniscollateraldependent.Valuationsof impairedloansthatarecollateral dependentaresupportedby thirdpartyappraisalsin accordancewith theBank’s creditpolicy.Impairedloansthatarenot collateraldependentarenot material.

Assetsheld forsale—Assetsheldforsaleconsistof formerbranchlocations,vacantland,and a house previouslypurchasedforexpansion.Assetsareconsideredheldforsalewhen managementhas approvedto sell theassetsfollowinga branchclosureor otherevents.The propertiesarebeingactivelymarketedand transferred to assetsheldforsalebasedon thelowerof carryingvalueor itsfairvalue,lessestimatedcoststo sell.

Otherrealestateowned—Certainassetsheldwithinotherrealestateowned representrealestateor othercollateralthathas been adjustedto itsestimatedfairvalue,lesscostto sell,as a resultof transferringfrom theloanportfolioatthetimeof foreclosureor repossessionand basedon management’speriodicimpairment evaluation.Fromtimeto time,non-recurringfairvalueadjustmentsto otherrealestateowned arerecordedto reflectpartialwrite-downsbasedon an observablemarketpriceor currentappraisedvalueof property.

Adjustmentsto fairvaluebasedon such non-recurringtransactionsgenerallyresultfromtheapplication of lower-of-cost-or-marketaccountingor write-downsof individualassetsdue to impairment.The following tablessummarizetheCompany’sassetsthatwere measuredatfairvalueon a non-recurringbasis,excluding acquiredimpairedloans,as of September 30, 2017 and December 31, 2016:

			Fair Value Measurements Using
September 30, 2017	Fair Value		Level 1		Level 2		Level 3
Non-recurring
Impaired loans
(excluding acquired impaired loans)
Commercial real estate	$	13,742	$	—	$	—	$	13,742
Residential real estate		1,772		—		—		1,772
Construction, land development, and other land		565		—		—		565
Commercial and industrial		4,490		—		—		4,490
Installment and other		-		—		—		-
Assets held for sale		12,938		—		—		12,938
Other real estate owned		13,859		—		—		13,859

			Fair Value Measurements Using
December 31, 2016	Fair Value		Level 1		Level 2		Level 3
Non-recurring
Impaired loans
(excluding acquired impaired loans)
Commercial real estate	$	8,916	$	—	$	—	$	8,916
Residential real estate		1,007		—		—		1,007
Construction, land development, and other land		—		—		—		—
Commercial and industrial		986		—		—		986
Installment and other		—		—		—		—
Assets held for sale		14,748		—		—		14,748
Other real estate owned		16,570		—		—		16,570

The followingtableprovidesa descriptionof thevaluationtechnique,unobservableinputsand qualitativeinformationabouttheCompany’sassetsand liabilitiesclassifiedas Level3 and measuredatfairvalue on a non-recurringbasisas of September 30, 2017:

Financial Instruments	Valuation Technique	Unobservable Inputs	Range of Inputs	Impact to Valuation from an Increased or Higher Input Value
Impaired loans (excluding    acquired impaired loans)	Appraisals	Appraisal adjustments, sales costs and other discount adjustments for market conditions	6% - 10%	Decrease
Assets held for sale	List price, contract price	Sales costs and other discount adjustments for market conditions	7%	Decrease
Other real estate owned	Appraisals	Appraisal adjustments, sales costs and other discount adjustments for market conditions	7% - 20%	Decrease

The followingmethodsand assumptionswere used by theCompany in estimatingfairvaluesof other assetsand liabilitiesfordisclosurepurposes:

Cash and cash equivalents—For theseshort-terminstruments,thecarryingamountisa reasonable estimateof fairvalue.The fairvaluefortimecertificateswith otherbanks isbasedon themarketvaluesfor comparableinvestments.

Securitiesheld-to-maturity—The Company obtainsfairvaluemeasurementsfroman independent pricingservice.Managementreviewstheproceduresused by thethirdparty,includingsignificantinputsused in thefairvaluecalculations.The fairvaluemeasurementsconsiderobservabledatathatmayincludedealerquotes, marketspreads,cashflows,theU.S.Treasuryyieldcurve,livetradinglevels,tradeexecutiondata,market consensusprepaymentspeeds,creditinformationand thebond’stermsand conditions,amongotherthings.When marketquotesarenot readilyaccessibleor available,alternativeapproachesareutilized,such as matrixor model pricing.

Restrictedstock—The fairvaluehas been determinedto approximatecost.

Loans held forsale—The fairvalueof loansheldforsalearebasedon quotedmarketprices,where available,and determinedby discountedestimatedcashflowsusinginterestratesapproximatingtheCompany’s currentoriginationratesforsimilarloansadjustedto reflecttheinherentcreditrisk.

Loanand leasereceivables,net—For certainvariablerateloansthatrepricefrequentlyand with no significantchangesin creditrisk,fairvalueisestimatedatcarryingvalue.The fairvalueof othertypesof loansis estimatedby discountingfuturecashflows,usingcurrentratesatwhich similarloanswould be madeto borrowerswith similarcreditratingsand forthesameremainingmaturities.

Depositliabilities—The fairvalueof demanddeposits,savingsaccounts,and certainmoneymarket depositsistheamountpayableon demandatthereportingdate.The fairvalueof fixed-maturitycertificatesof depositisestimatedby discountingfuturecashflows,usingratescurrentlyofferedfordepositsof similar remainingmaturities.

FederalHomeLoanBankadvances—The fairvalueof FHLBadvancesisestimatedby discounting theagreementsbasedon maturitiesusingratescurrentlyofferedforFHLBadvancesof similarremaining maturitiesadjustedforprepaymentpenaltiesthatwould be incurrediftheborrowingswere paidoffon the measurementdate.

Securitiessold under agreementsto repurchase—The carryingamountapproximatesfairvaluedue to  maturitiesof lessthanninetydays.

Junior subordinated debentures—The fairvalueof juniorsubordinateddebentures,in theformof trustpreferredsecurities,isdeterminedusingratescurrentlyavailableto theCompany fordebtwith similarterms and remainingmaturities.

Accrued interestreceivableand payable—The carryingamountapproximatesfairvalue.

Commitmentsto extend creditand commercialand standby lettersof credit—The fairvaluesof theseoff-balancesheetcommitmentsto extendcreditand commercialand standbylettersof creditarenot consideredpracticableto estimatebecauseof thelackof quotedmarketpricesand theinabilityto estimatefair valuewithoutincurringexcessivecosts.

The estimatedfairvaluesof financialinstrumentsand levelswithinthefairvaluehierarchyareas follows:

			September 30,				December 31,
	Fair Value		2017				2016
	Hierarchy Level		Carrying Amount		Estimated Fair Value		Carrying Amount		Estimated Fair Value
Financial assets
Cash and due from banks		1	$	16,193	$	16,193	$	17,735	$	17,735
Interest bearing deposits with other banks		2		46,043		46,043		28,798		28,798
Securities held-to-maturity		2		121,453		122,266		138,846		138,082
Other restricted stock		2		10,628		10,628		14,993		14,993
Loans held for sale		3		2,087		2,335		23,976		26,487
Loans and lease receivables, net		3		2,200,519		2,118,769		2,137,088		2,068,157
Accrued interest receivable		3		7,183		7,183		6,866		6,866
Financial liabilities
Non-interest bearing deposits		2		753,662		753,662		724,457		724,457
Interest bearing deposits		2		1,767,267		1,721,537		1,765,937		1,723,941
Accrued interest payable		2		1,184		1,184		2,427		2,427
Line of credit		2		-		-		20,650		20,650
Federal Home Loan Bank advances		2		234,559		234,543		313,715		313,646
Securities sold under repurchase agreement		2		30,807		30,807		17,249		17,249
Junior subordinated debentures		3		27,482		26,779		26,926		26,943

XML

Derivative Instruments and Hedge Activities

9 Months Ended

Sep. 30, 2017

Derivative Instruments And Hedging Activities Disclosure [Abstract]

Derivative Instruments and Hedge Activities

Note 17—Derivative Instruments and Hedge Activities

The Company recognizes derivative financial instruments at fair value regardless of the purpose or intent for holding the instrument. The Company records derivative assets and derivative liabilities on the Consolidated Statements of Financial Condition within accrued interest receivable and other assets and accrued interest payable and other liabilities, respectively. The following tables present the fair value of the Company’s derivative financial instruments and classification on the Consolidated Statements of Financial Condition as of September 30, 2017 and December 31, 2016:

	September 30, 2017						December 31, 2016
			Fair Value						Fair Value
	Notional Amount		Other Assets		Other Liabilities		Notional Amount		Other Assets		Other Liabilities
Derivatives designated as hedging instruments
Interest rate swaps designated as cash     flow hedges	$	250,000	$	3,265	$	545	$	100,000	$	3,719	$	—
Derivatives not designated as hedging instruments
Other interest rate swaps		81,712		648		645		51,213		598		559
Total derivatives	$	331,712	$	3,913	$	1,190	$	151,213	$	4,317	$	559

Interest rate swaps designated as cash flow hedges—Cash flow hedges of interest payments associated with certain FHLB advances had notional amounts totaling $250.0 million as of September 30, 2017. The aggregate fair value of the swaps is recorded in other assets or other liabilities with changes in fair value recorded in other comprehensive income (loss), net of taxes, to the extent effective. The amount included in accumulated other comprehensive income (loss) would be reclassified to current earnings when the hedged FHLB advances affect earnings. The Company assesses the effectiveness of each hedging relationship by comparing the changes in fair value of the derivative hedging instrument with the changes in fair value of the designated hedged transactions. The Company expects the hedges to remain highly effective during the remaining terms of the swaps and did not recognize any hedge ineffectiveness in current earnings during the three or nine months ended September 30, 2017 and 2016.

Interest expense recorded on these swap transactions totaled $159,000 and $426,000 during the three and nine months ended September 30, 2017, respectively, and is reported as a component of interest expense on FHLB advances. Interest expense recorded on swap transactions totaled $4,000 during the three and nine months ended September 30, 2016. At September 30, 2017, the Company estimates $249,000 of the unrealized gain to be reclassified as an increase to interest expense during the next twelve months.

The following table reflects the net gains (losses) recorded in accumulated other comprehensive income (loss) and the Consolidated Statements of Operations relating to the cash flow derivative instruments for the nine months ended September 30, 2017. 

	Amount of Gain Recognized in OCI (Effective Portion)			Amount of Loss Reclassified from OCI to Income as an Increase to Interest Expense			Amount of Gain (Loss) Recognized in Other Non-Interest Income (Ineffective Portion)
Interest rate swaps	$	(1,408	)	$	(426	)	$	—

Other interest rate swaps—The total combined notional amount was $81.7 million with maturities ranged from January 2020 to August 2027. The fair values of the interest rate swap agreements are reflected in other assets and other liabilities with corresponding gains or losses reflected in non-interest income. During the three and nine months ended September 30, 2017, transaction fees related to these derivative instruments were $40,000 and $219,000, respectively. During the three and nine months ended September 30, 2016, transaction fees were $191,000 and $580,000, respectively.

The following table reflects other interest rate swaps as of September 30, 2017:

Notional amounts	$	81,712
Derivative assets fair value		648
Derivative liabilities fair value		645
Weighted average pay rates		4.26	%
Weighted average receive rates		3.68	%
Weighted average maturity	6.1 years

Credit risk—Derivative instruments are inherently subject to market risk and credit risk. Market risk is associated with changes in interest rates and credit risk relates to the Company’s risk of loss when the counterparty to a derivative contract fails to perform according to the terms of the agreement. Market and credit risks are managed and monitored as part of the Company’s overall asset-liability management process. The credit risk related to derivatives entered into with certain qualified borrowers is managed through the Company’s loan underwriting process. The Company’s loan underwriting process also approves the Bank’s swap counterparty used to mirror the borrowers’ swap. The Company has a bilateral agreement with each swap counterparty that provides that fluctuations in derivative values are to be fully collateralized with either cash or securities. The credit valuation adjustment (“CVA”) is a fair value adjustment to the derivative to account for this risk. During the three and nine months ended September 30, 2017, the CVA resulted in a decrease to non-interest income of $6,000 and $36,000, respectively. During the three and nine months ended September 30, 2016, the CVA resulted in a decrease to non-interest income of $14,000 and $51,000, respectively.

The Company has agreements with its derivative counterparties that contain a cross-default provision under which if the Company defaults on any of its indebtedness, including default where repayment of the indebtedness has not been accelerated by the lender, then the Company could also be declared in default on its derivative obligations. The Company also has agreements with certain derivative counterparties that contain a provision where if the Company fails to maintain its status as a well or adequately capitalized institution, then the counterparty could terminate the derivative positions and the Company would be required to settle its obligations resulted in a net asset position.

The Company records interest rate derivatives subject to master netting agreements at their gross value and does not offset derivative asset and liabilities on the Consolidated Statements of Financial Condition. The table below summarizes the Company’s interest rate derivatives and offsetting positions as of September 30, 2017: 

	Derivative Assets Fair Value			Derivative Liabilities Fair Value
Gross amounts recognized	$	3,913		$	1,190
Less: Amounts offset in the Consolidated Statements of Financial Condition		—			—
Net amount presented in the Consolidated Statements of Financial Condition	$	3,913		$	1,190
Gross amounts not offset in the Consolidated Statements of Financial Condition
Offsetting derivative positions		(677	)		(677	)
Collateral posted		(2,949	)		(502	)
Net credit exposure	$	287		$	11

XML

Share-Based Compensation

9 Months Ended

Sep. 30, 2017

Disclosure Of Compensation Related Costs Sharebased Payments [Abstract]

Share-Based Compensation

Note 18 – Share-Based Compensation

In June 2017, the Company adopted the 2017 Omnibus Incentive Compensation Plan (the “Omnibus Plan”) in connection with our initial public offering (“IPO”).  The Omnibus Plan provides for the grant of stock options, stock appreciation rights, restricted stock, restricted stock units, dividend equivalent rights and other equity-based, equity-related or cash-based awards.  A total of 1,550,000 shares of our common stock have been reserved and are available for issuance under the Omnibus Plan.

On July 6, 2017, in conjunction with the completion of the IPO, the Company granted 58,900 restricted shares of the Company’s voting common stock, par value of $0.01 per share, to certain key employees, pursuant to the Omnibus Plan.  The restricted shares will cliff vest on the third anniversary of the grant date, subject to continued employment.  Subsequent to the grant date, 400 restricted shares were forfeited.  As of September 30, 2017, there were 1,491,500 shares available for future grants under the Omnibus Plan.

The following table discloses the changes in restricted shares for the nine months ended September 30, 2017:

	Omnibus Plan
	Number of Shares			Weighted Average Grant Date Fair Value
Beginning balance		—		$	—
Granted		58,900		$	20.18
Vested		—		$	—
Forfeited		(400	)	$	20.18
Ending balance outstanding at September 30, 2017		58,500		$	20.18

No restricted shares vested during the nine months ended September 30, 2017.  

The Company recognizes share-based compensation based on the estimated fair value of the restricted stock at the grant date. Share-based compensation expense is included in non-interest expense in the Consolidated Statements of Operations. No restricted shares were outstanding in 2016.

  The following table summarizes restricted stock compensation expense for the nine months ended September 30, 2017:

	Nine Months Ended September 30,
	2017
Total share-based compensation - restricted stock	$	94
Income tax benefit		38
Unrecognized compensation expense		1,087
Weighted-average amortization period remaining		2.8 years

In October 2017, the Company granted 7,500 restricted shares of the Company’s voting common stock, par value $0.01 per share, under the Omnibus Plan.  These restricted shares will vest ratably over four years on each anniversary of the grant date, subject to continued employment.

The Company maintained a nonqualified, share-based, stock option plan adopted prior to recapitalization (“MBG Plan”). There were no options granted or exercised under this plan during the year ended December 31, 2016 or for the nine months ended September 30, 2017.  At the time of the Company’s reincorporation in Delaware, in June 2017, the Board of Directors cancelled the MBG Plan and all outstanding options were cancelled.

In October 2014, the Company adopted the Byline Bancorp, Inc. Equity Incentive Plan (“BYB Plan”). The maximum number of shares available for grants under this Plan was 2,476,122 shares. During 2016 and 2015, the Company granted options to purchase  212,400 and 1,634,568 shares, respectively, under this plan. The Company did not grant any stock options during the nine months ended September 30, 2017.  In June 2017, the Board of Directors terminated the BYB Plan and no future grants can be made under this plan.  Options to purchase a total of 1,798,220 shares remain outstanding under the BYB Plan.

The types of stock options granted under the BYB Plan were Time Options and Performance Options. The exercise price of each option is equal to the fair value of the stock as of the date of grant. These option awards have vesting periods ranging from 1 to 5 years and have 10-year contractual terms. Stock volatility was computed as the average of the volatilities of peer group companies.  

The vesting of Time Options is conditional based on completion of service. Performance Options have conditional vesting based on either performance targets or market performance. Certain Performance Options’ performance goals will be satisfied (in whole or in part) if the Bank achieves various performance targets such as profitability, asset quality, and conditional based on market performance, as outlined in the BYB Plan. Each of the performance goals identified are measured for achievement (or failure to achieve) independent of each other. In October 2017, the Board of Directors determined that the Performance Option goals were satisfied, in whole, and these Performance Options converted to Time Options.  As a result of the previous completion of service, 414,894 performance options vested on October 3, 2017.

The fair values of the stock options were determined using the Black-Scholes-Merton model for Time Options and a Monte Carlo simulation model for Performance Options. The fair values of options under the BYB Plan were determined using the following assumptions as of the grant dates:

	Time Options Grants
	2016			2015
Risk-free interest rate	1.34% - 1.40%			1.68% - 1.85%
Expected term (years)	5.2 - 5.6			5.7 - 6.3
Expected stock price volatility		20.39	%	16.18%-16.55%
Expected dividend yield		0.00	%		0.00	%
Weighted average grant date fair value	$	3.55		$	2.25

	Performance Options Grants
	2016			2015
Risk-free interest rate	Implied forward rates			Implied forward rates
Expected term (years)	Variable			Variable
Expected stock price volatility	20.34% - 20.39%			16.18%-16.55%
Expected dividend yield		0.00	%		0.00	%
Weighted average grant date fair value	$	3.75		$	1.65

The following table discloses the activity in shares subject to options and the weighted average exercise prices, in actual dollars, for the nine months ended September 30, 2017:

	BYB Plan
	Number of Shares		Weighted Average Exercise Price		Intrinsic Value		Weighted Average Remaining Contractual Term (in Years)
Beginning balance		1,798,220	$	11.95	$	15,788		9.8
Granted		—
Expired		—
Exercised		—
Forfeited		—
Ending balance outstanding at September 30, 2017		1,798,220	$	11.95	$	16,545		7.9
Exercisable at September 30, 2017		835,263	$	11.31	$	8,310		7.7

There were no stock options exercised during the nine months ended September 30, 2017.  The total fair value of stock options vested during the nine months ended September 30, 2017 was $477,000.

The Company recognizes share-based compensation based on the estimated fair value of the option at the grant date. Forfeitures are estimated based upon industry standards. Share-based compensation expense is included in non-interest expense in the Consolidated Statements of Operations. The following table summarizes stock option compensation expense for the nine months ended September 30, 2017 and 2016:

	Nine Months Ended September 30,
	2017		2016
Total share-based compensation – stock options	$	857	$	553
Income tax benefit		348		—
Unrecognized compensation expense		1,074		1,431
Weighted-average amortization period remaining		1.2 years		2.0 years

XML

Earnings per Share

9 Months Ended

Sep. 30, 2017

Earnings Per Share [Abstract]

Earnings per Share

Note 19—Earnings per Share

A reconciliation of the numerators and denominators for earnings per common share computations is presented below. Incremental shares represent outstanding stock options for which the exercise price is less than the average market price of the Company’s common stock during the periods presented. Options to purchase 1,798,223 shares of common stock were outstanding as of September 30, 2017 and 2016. There were 58,500 restricted stock awards outstanding at September 30, 2017.  There were no restricted stock awards outstanding at September 30, 2016.

The following represent the calculation of basic and diluted earnings per share:

	Three Months Ended September 30,				Nine Months Ended September 30,
	2017		2016		2017		2016
Net income	$	9,755	$	1,565	$	22,461	$	2,814
Less: Dividends on preferred shares		195		—		11,081		—
Net income available to common stockholders	$	9,560	$	1,565	$	11,380	$	2,814
Weighted-average common stock outstanding:
Weighted-average common stock outstanding (basic)		29,246,900		19,497,811		26,194,025		18,838,354
Incremental shares		505,431		265,623		503,816		265,623
Weighted-average common stock outstanding (dilutive)		29,752,331		19,763,434		26,697,841		19,103,977
Basic earnings per common share	$	0.33	$	0.08	$	0.43	$	0.15
Diluted earnings per common share	$	0.32	$	0.08	$	0.43	$	0.15

XML

Stockholders' Equity

9 Months Ended

Sep. 30, 2017

Equity [Abstract]

Stockholders' Equity

Note 20—Stockholders’ Equity

A summary of the Company’s preferred and common stock at September 30, 2017 and December 31, 2016 is as follows:

	September 30,		December 31,
	2017		2016
Series A non-cumulative perpetual preferred stock
Par value	$	0.01	$	0.01
Shares authorized	15,003			15,003
Shares issued	—			15,003
Shares outstanding	—			15,003
Series B 7.5% fixed non-cumulative perpetual    preferred stock
Par value	$	0.01	$	0.01
Shares authorized		50,000		50,000
Shares issued		10,438		9,388
Subscription receivable		—		1,050
Shares outstanding		10,438		9,388
Common stock, voting
Par value	$	0.01	$	—
Shares authorized		150,000,000		150,000,000
Shares issued		29,305,400		24,616,706
Shares outstanding		29,305,400		24,616,706

During 2016, the Company authorized and issued Series B 7.50% fixed-to-floating non-voting, noncumulative perpetual preferred stock with a liquidation preference of $1,000 per share, plus the amount of unpaid dividends, if any, which is redeemable at the Company’s option on or after March 31, 2022. Holders of either Series A or Series B preferred stock do not have any rights to convert such stock into shares of any other class of capital stock of the Company.

On January 30, 2017, the Company issued an additional 1,050 shares of Series B preferred stock, which is reflected as a subscription receivable as of December 31, 2016. For the nine months ended September 30, 2017, the Company declared and paid dividends on the Series B preferred stock of $580,000.

On May 31, 2017, the Company filed a registration statement on Form S-1with the SEC in connection with its initial public offering (the ”Registration Statement”), which was subsequently amended on June 19, 2017. The Registration Statement was declared effective by the SEC on June 29, 2017. In connection with the IPO, the Company issued 4,630,194 shares of common stock, par value $0.01 per share, which included 855,000 shares sold pursuant to the underwriters’ exercise of their option to purchase additional shares. The securities were sold at a price to the public of $19.00 per share and began trading on the New York Stock Exchange on June 30, 2017.  On July 6, 2017, the closing date of the IPO, the Company received net proceeds of $82.7 million.

On June 14, 2017, the Company’s stockholders approved the reincorporation of the Company to a Delaware corporation. Under the terms of the merger agreement, the Company reincorporated from Illinois to Delaware by merging with and into Byline Bancorp, Inc. Delaware (“Byline Delaware”), with Byline Delaware surviving (such transaction, the “Merger”).  Each share of Company common stock issued and outstanding immediately prior to the effective time of the Merger, was converted automatically into the right to receive one fifth (0.20) of a share of common stock of Byline Delaware.  There were no fractional shares issued in connection with the Merger.   The reincorporation and share conversion are retrospectively reflected in the consolidated financial statements.

On June 16, 2017, after obtaining the necessary approval from the Federal Reserve, the Board of Directors of Byline Delaware unanimously approved the repurchase of all of the Company’s outstanding Series A preferred stock at a purchase price per share representing a liquidation value of $1,000 per share, equal to the cash value of (i) 89.469 shares of the Company’s common stock, multiplied by (ii) the initial public offering price of the common stock of $19.00 per share.  On July 14, 2017, the Company completed the repurchase of all of the Series A Preferred Stock for $25.5 million. The $10.5 million excess of the purchase price over the carrying value of the Series A was recorded as a dividend.

XML

Basis of Presentation (Policies)

9 Months Ended

Sep. 30, 2017

Accounting Policies [Abstract]

Basis of Presentation

These unaudited interim condensed consolidated financial statements include the accounts of BylineBancorp, Inc., a Delaware corporation(the“Company,”“we,” “us,”“our”),a bank holding companywhose principalactivityistheownershipand managementof its Illinois state chartered subsidiarybank, BylineBank (the “Bank”), based in Chicago, Illinois.

These unaudited interim condensed consolidated financial statements have been prepared in accordance with accounting principles generally accepted in the United States of America (“GAAP”) for interim financial information and in accordance with the instructions to Form 10-Q and Article 10 of Regulation S-X as promulgated by the Securities and Exchange Commission (“SEC”).  In preparing these financial statements, the Company has evaluated events and transactions subsequent to September 30, 2017 for potential recognition or disclosure. In the opinion of management, all adjustments (consisting of normal recurring accruals) considered necessary for a fair presentation of the financial position and results of operations for the periods presented have been included.  Certain information in footnote disclosures normally included in financial statements prepared in accordance with GAAP has been condensed or omitted pursuant to the rules and regulations of the SEC and the accounting standards for interim financial statements. These financial statements should be read in conjunction with the consolidated financial statements and notes thereto included in the Company’s Consolidated Financial Statements for the years ended December 31, 2016 and 2015.

In accordance with the Financial Accounting Standards Board (“FASB”) Accounting Standards Codification (“ASC”) Topic 855, “Subsequent Events,” the Company’s management has evaluated subsequent events for potential recognition or disclosure through the date of the issuance of these consolidated financial statements. No subsequent events were identified that would have required a change to the consolidated financial statements or disclosure in the notes to the consolidated financial statements.

Certain prior period amounts have been reclassified to conform to current period presentation. These reclassifications did not result in any changes to previously reported net income or stockholders’ equity.

Recently Issued Accounting Pronouncements

The following reflect recent accounting pronouncements that have been adopted or are pending adoption by the Company. As the Company qualifies as an emerging growth company and has elected the extended transition period for complying with new or revised accounting pronouncements, it is not subject to new or revised accounting standards applicable to public companies during the extended transition period. The accounting pronouncements pending adoption below reflect effective dates for the Company as an emerging growth company with the extended transition period.

Revenue from Contracts with Customers In May 2014, FASB issued Accounting Standards Update (“ASU”) No. 2014-09, deferred by ASU No. 2015-14 and clarifying standards, Revenue from Contracts with Customers, which creates Topic 606 and supersedes Topic 605, Revenue Recognition. The core principle of Topic 606 is that an entity recognizes revenue to depict the transfer of promised goods or services to customers in an amount that reflects the consideration to which the entity expects to be entitled in exchange for those goods or services. In general, the new guidance requires companies to use more judgment and make more estimates than under current guidance, including identifying performance obligations in the contract, estimating the amount of variable consideration to include in the transaction price and allocating the transaction price to each separate performance obligation. Under the terms of ASU No. 2015-14 the standard is effective for interim and annual periods beginning after December 15, 2017. Early application is permitted only as of annual reporting periods beginning after December 15, 2016, including interim reporting periods within that reporting period. For financial reporting purposes, the standard allows for either full retrospective adoption, meaning the standard is applied to all of the periods presented, or modified retrospective adoption, meaning the standard is applied only to the most current period presented in the financial statements with the cumulative effect of initially applying the standard recognized at the date of initial application. The Company is currently evaluating the provisions of ASU No. 2014-09 to determine the potential impact the standard will have on the Company’s Consolidated Financial Statements. As a financial institution, the Company’s largest component of revenue, interest income, is excluded from the scope of this ASU. The Company is currently evaluating which, if any, of its sources of non-interest income will be impacted by this ASU. Assuming the Company remains an emerging growth company, the Company expects to adopt this new guidance on January 1, 2019, with a cumulative effect adjustment to opening retained earnings, if such adjustment is deemed to be significant. In April 2016, FASB issued ASU No. 2016-10, Identifying Performance Obligations and Licensing. The amendments in this ASU do not change the core principle of the guidance in Topic 606. Rather, the amendments in this ASU clarify the following two aspects of Topic 606: (1) identifying performance obligations and (2) licensing implementation guidance, while retaining the related principles for those areas. The amendments in this ASU affect the guidance in ASU 2014-09, discussed above, which is not yet effective. The effective date and transition requirements for the amendments in this ASU are the same as the effective date and transition requirements in Topic 606, Revenues from Contracts with Customers. The Company is evaluating the provisions of this ASU in conjunction with ASU No. 2014-09 to determine the potential impact Topic 606 and its amendments will have on the Company’s Consolidated Financial Statements.

In May 2016, FASB issued ASU No. 2016-12, Narrow-Scope Improvements and Practical Expedients, amending ASC Topic 606, Revenue from Contracts with Customers. The amendments in this ASU do not change the core principle of the guidance in Topic 606. Rather, the amendments in this ASU affect only several narrow aspects of Topic 606. The amendments in this ASU affect the guidance in ASU 2014-09, discussed above, which is not yet effective. The effective date and transition requirements for the amendments in this ASU are the same as the effective date and transition requirements in Topic 606. The Company is evaluating the provisions of this ASU in conjunction with ASU No. 2014-09 to determine the potential impact Topic 606 and its amendments will have on the Company’s Consolidated Financial Statements.

Recognition and Measurement of Financial Assets and Financial Liabilities In January 2016, FASB issued ASU No. 2016-01, Recognition and Measurement of Financial Assets and Financial Liabilities. The amendments in this ASU require equity securities to be measured at fair value with changes in the fair value recognized through net income. The amendments allow equity investments that do not have readily determinable fair values to be remeasured at fair value under certain circumstances and require enhanced disclosures about those investments. The amendments simplify the impairment assessment of equity investments without readily determinable fair values. The amendments also eliminate the requirement to disclose the method(s) and significant assumptions used to estimate the fair value that is required to be disclosed for financial instruments measured at amortized cost on the balance sheet. The amendments in this ASU require separate presentation in other comprehensive income of the portion of the total change in the fair value of a liability resulting from a change in the instrument-specific credit risk when the entity has elected to measure the liability at fair value in accordance with the fair value option for financial instruments. This amendment excludes from net income gains or losses that the entity may not realize because those financial liabilities are not usually transferred or settled at their fair values before maturity. The amendments in this ASU require separate presentation of financial assets and financial liabilities by measurement category and form of financial asset (that is, securities or loans and receivables) on the balance sheet or in the accompanying notes to the financial statements. The amendments in this ASU are effective for fiscal years beginning after December 15, 2017, including interim periods within those fiscal years. The Company is currently evaluating the provisions of ASU No. 2016-01 to determine the potential impact the new standard will have on the Company’s Consolidated Financial Statements. Assuming the Company remains an emerging growth company, the new authoritative guidance will be effective for reporting periods beginning January 1, 2019 and is not expected to have a significant impact on the Company’s Consolidated Financial Statements.

Leases (Topic 842) In February 2016, FASB issued ASU No. 2016-02, Leases. The amendments in this ASU require lessees to recognize the following for all leases (with the exception of short-term) at the commencement date; a lease liability, which is a lessee’s obligation to make lease payments arising from a lease, measured on a discounted basis; and a right-of-use asset, which is an asset that represents the lessee’s right to use, or control the use of, a specified asset for the lease term. The amendments in this ASU leave lessor accounting largely unchanged, although certain targeted improvements were made to align lessor accounting with the lessee accounting model. This ASU simplifies the accounting for sale and leaseback transactions primarily because lessees must recognize lease assets and lease liabilities. Lessees will no longer be provided with a source of off-balance sheet financing. The amendments in this ASU are effective for fiscal years beginning after December 15, 2018, including interim periods within those fiscal years. Early application is permitted upon issuance. Lessees (for capital and operating leases) and lessors (for sales-type, direct financing, and operating leases) must apply a modified retrospective transition approach for leases existing at, or entered into after, the beginning of the earliest comparative period presented in the financial statements. The modified retrospective approach would not require any transition accounting for leases that expired before the earliest comparative period presented. Lessees and lessors may not apply a full retrospective transition approach. The Company is evaluating the new guidance and its impact on the Company’s Consolidated Statements of Operations and Consolidated Statements of Financial Condition. Assuming the Company remains an emerging growth company, the new authoritative guidance will be effective for reporting periods after January 1, 2020. The Company expects an increase in assets and liabilities as a result of recognizing additional lease contracts where the Company is lessee.

Derivatives and Hedging (Topic 815) In March 2016, FASB issued ASU No. 2016-05, Effect of Derivative Contract Novations on Existing Hedge Accounting Relationships. The amendments in this ASU clarify that a change in the counterparty to a derivative instrument that has been designated as the hedging instrument under Topic 815 (Derivatives and Hedging) does not, in and of itself, require dedesignation of that hedging relationship provided that all other hedge accounting criteria continue to be met. The amendments in this ASU are effective for financial statements issued for fiscal years beginning after December 15, 2016, and interim periods within those fiscal years. An entity has an option to apply the amendments in this ASU on either a prospective basis or a modified retrospective basis. Early adoption is permitted, including adoption in an interim period. This ASU became effective for the Company on January 1, 2017 and did not have a material impact on the Company’s Consolidated Financial Statements.

In March 2016, FASB issued ASU No. 2016-06, Contingent Put and Call Options in Debt Instruments. The amendments in this ASU clarify the requirements for assessing whether contingent call (put) options that can accelerate the payment of principal on debt instruments are clearly and closely related to their debt hosts. To determine how to account for debt instruments with embedded features, including contingent put and call options, an entity is required to assess whether the embedded derivatives must be bifurcated from the host contract and accounted for separately. Part of this assessment consists of evaluating whether the embedded derivative features are clearly and closely related to the debt host. Under existing guidance, for contingently exercisable options to be considered clearly and closely related to a debt host, they must be indexed only to interest rates or credit risk. ASU 2016-06 addresses inconsistent interpretations of whether an event that triggers an entity’s ability to exercise the embedded contingent option must be indexed to interest rates or credit risk for that  option to qualify as clearly and closely related. Diversity in practice has developed because the existing four-step decision sequence in ASC 815 focuses only on whether the payoff was indexed to something other than an interest rate or credit risk. As a result, entities have been uncertain whether they should (1) determine whether the embedded features are clearly and closely related to the debt host solely on the basis of the four-step decision sequence or (2) first apply the four-step decision sequence and then also evaluate whether the event triggering the exercisability of the contingent put or call option is indexed only to an interest rate or credit risk. This ASU clarifies that in assessing whether an embedded contingent put or call option is clearly and closely related to the debt host, an entity is required to perform only the four-step decision sequence in ASC 815 as amended by this ASU. The entity does not have to separately assess whether the event that triggers its ability to exercise the contingent option is itself indexed only to interest rates or credit risk. The amendments in this ASU are effective for financial statements issued for fiscal years beginning after December 15, 2016, and interim periods within those fiscal years. This ASU became effective for the Company on January 1, 2017 and did not have a material impact on the Company’s Consolidated Financial Statements.

In August 2017, FASB issued ASU No. 2017-12, Targeted Improvements to Accounting for Hedging Activities. The amendments in this ASU better align an entity’s risk management activities and financial reporting for hedging relationships through changes to both the designation and measurement guidance for qualifying hedging relationships and the presentation of hedge results. The new authoritative guidance will be effective for reporting periods after January 1, 2019 with early adoption permitted. The Company is evaluating the new guidance and its impact on the Company’s Consolidated Statements of Operations and Consolidated Statements of Financial Condition.

Compensation—Stock Compensation (Topic 718) In March 2016, FASB issued ASU No. 2016-09, Improvements to Employee Share-Based Payment Accounting. FASB issued this ASU as part of its Simplification Initiative. The areas for simplification in this ASU involve several aspects of the accounting for share-based payment transactions, including the income tax consequences, classification of awards as either equity or liabilities, and classification on the statement of cash flows. Amendments in this ASU relate to the timing of when excess tax benefits are recognized, minimum statutory withholding requirements, forfeitures, and intrinsic value should be applied using a modified retrospective transition method by means of a cumulative-effect adjustment to equity as of the beginning of the period in which the guidance is adopted. Amendments related to the presentation of employee taxes paid on the statement of cash flows when an employer withholds shares to meet the minimum statutory withholding requirement should be applied retrospectively. Amendments in this ASU require recognition of excess tax benefits and tax deficiencies in the income statement and the practical expedient for estimating expected term should be applied prospectively.

An entity may elect to apply the amendments in this ASU related to the presentation of excess tax benefits on the statement of cash flows using either a prospective transition method or a retrospective transition method. The amendments in this ASU are effective for annual periods beginning after December 15, 2016, and interim periods within those annual periods. This ASU became effective for the Company on January 1, 2017 and did not have a material impact on the Company’s Consolidated Financial Statements.

In May 2017, the FASB issued ASU 2017-09, Scope of Modification Accounting. The new standard provides guidance about which changes to the terms or conditions of a share-based payment award require an entity to apply modification accounting in Topic 718. This pronouncement is effective for annual reporting periods beginning after December 15, 2017 but early adoption is permitted. The Company is currently evaluating the impact of adopting this guidance.

Financial Instruments—Credit Losses (Topic 326) In June 2016, FASB issued ASU No. 2016-13, Measurement of Credit Losses on Financial Instruments. Current GAAP requires an “incurred loss” methodology for recognizing credit losses that delays recognition until it is probable a loss has been incurred. The main objective of this ASU is to provide financial statement users with more decision-useful information about the expected credit losses on financial instruments and other commitments to extend credit held by a reporting entity at each reporting date. The amendments in this ASU replace the incurred loss impairment methodology in current GAAP with a methodology that reflects expected credit losses and requires consideration of a broader range of reasonable and supportable information to inform credit loss estimates. The amendments in this ASU require a financial asset (or group of financial assets) measured at amortized cost basis to be presented at the net amount expected to be collected. The allowance for credit losses is a valuation account that is deducted from the amortized cost basis of the financial asset(s) to present the net carrying value at the amount expected to be collected on the financial asset. The measurement of expected credit losses will be based on relevant information about past events, including historical experience, current conditions, and reasonable and supportable forecasts that affect the collectability of the reported amount. The amendments in this ASU broaden the information that an entity must consider in developing its expected credit loss estimate for assets measured either collectively or individually. The use of forecasted information incorporates more timely information in the estimate of expected credit loss, which will be more decision useful to users of the financial statements. The amendments in this ASU will be effective for fiscal years beginning after December 15, 2019, including interim periods  within those fiscal years. Assuming the Company remains an emerging growth company, the new authoritative guidance will be effective for reporting periods after January 1, 2021. The Company is still evaluating the effects this ASU will have on the Company’s Consolidated Financial Statements. While the Company has not quantified the impact of this ASU, it does expect changing from the current incurred loss model to an expected loss model will result in an earlier recognition of losses.

Statement of Cash Flows (Topic 230) In August 2016, FASB issued ASU No. 2016-15, Classification of Certain Cash Receipts and Cash Payments. There is diversity in practice in how certain cash receipts and cash payments are presented and classified in the statement of cash flows under Topic 230 and other Topics. This ASU addresses eight specific cash flow issues with the objective of reducing the existing diversity in practice. Those eight issues are (1) debt prepayment or debt extinguishment costs, (2) settlement of zero-coupon debt instruments or other debt instruments with coupon interest rates that are insignificant in relation to the effective interest rate of the borrowing, (3) contingent consideration payments made after a business combination, (4) proceeds from the settlement of insurance claims, (5) proceeds from the settlement of corporate-owned life insurance policies, including bank-owned life insurance policies, (6) distributions received from equity method investees, (7) beneficial interests in securitization transactions, and (8) separately identifiable cash flows and application of the predominance principle. Current GAAP either is unclear or does not include specific guidance on these eight cash flow classification issues. These amendments provide guidance for each of the eight issues, thereby reducing current and potential future diversity in practice. The amendments in this ASU are effective for fiscal years beginning after December 15, 2017, and interim periods within those fiscal years. Early adoption is permitted, including adoption in an interim period. Assuming the Company remains an emerging growth company, the new authoritative guidance will be effective for reporting periods after January 1, 2019. The Company is currently evaluating the provisions of ASU No. 2016-15 to determine the potential impact the new standard will have on the Company’s Consolidated Financial Statements.

In November 2016, the FASB issued ASU No. 2016-18, Statement of Cash Flows (230), Restricted Cash. The ASU will require that a statement of cash flows explain the change during the period in the total of cash, cash equivalents, and amounts generally described as restricted cash or restricted cash equivalents. Therefore, amounts generally described as restricted cash and restricted cash equivalents should be included with cash and cash equivalents when reconciling the beginning-of-period and end-of-period total amounts shown on the statement of cash flows. The amendments in this update apply to all entities that have restricted cash or restricted cash equivalents and are required to present a statement of cash flows under Topic 230. Theamendment is effective for annual reporting periods beginning after December 15, 2017, and interim periods within those fiscal years. Early adoption of the update is permitted. Assuming the Company remains an emerging growth company, the new authoritative guidance will be effective for reporting periods after January 1, 2019. The Company does not expect this ASU to have a material impact on the Company’s Consolidated Financial Statements.

Income Taxes (Topic 740) In October 2016, the FASB issued ASU No. 2016-16, Income Taxes,Intra-Entity Transfers of Assets Other Than Inventory. The ASU was issued to improve the accounting for income tax consequences of intra-entity transfers of assets other than inventory. Current GAAP prohibits the recognition of current and deferred income taxes for an intra-entity asset transfer until the asset has been sold to an outside party; this update clarifies that an entity should recognize the income tax consequences of an intra-entity transfer of assets other than inventory when the transfer occurs. The amendment is effective for annual reporting periods beginning after December 15, 2017, and interim periods within those fiscal years. Early adoption of the update is permitted. Assuming the Company remains an emerging growth company, the new authoritative guidance will be effective for reporting periods after January 1, 2019. The Company does not expect this ASU to have a material impact on the Company’s Consolidated Financial Statements.

Consolidation (Topic 810) In October 2016, the FASB issued ASU No. 2016-17, Consolidation, Interests Held through Related Parties That Are under Common Control. The ASU was issued to amend the consolidation guidance on how a reporting entity that is the single decision maker of a variable interest entity (“VIE”) should treat indirect interests in the entity held through related parties that are under common control with the reporting entity when determining whether it is the primary beneficiary of that VIE. The primary beneficiary of a VIE is the reporting entity that has a controlling financial interest in a VIE and, therefore, consolidates the VIE. A reporting entity has an indirect interest in a VIE if it has a direct interest in a related party that, in turn, has a direct interest in the VIE. The amendment is effective for annual reporting periods beginning after December 15, 2016, and interim periods within those fiscal years. Early adoption of the update is permitted. The Company adopted this new authoritative guidance on January 1, 2017 and it did not have an impact on the Company’s Consolidated Financial Statements.

Business Combinations (Topic 805) In January 2017, the FASB issued ASU No. 2017-01, Clarifying the Definition of a Business. The guidance clarifies the definition of a business to assist entities with evaluating whether transactions should be accounted for as acquisitions or disposals of assets or businesses. This guidance is effective for annual and interim periods beginning after December 15, 2017. Early adoption is permitted. Assuming the Company remains an emerging growth company, the new authoritative guidance will be effective for reporting periods after January 1, 2019. The Company does not expect a material impact of this ASU on the Company’s Consolidated Financial Statements.

Intangibles—Goodwill and Other (Topic 350) In January 2017, FASB issued ASU No. 2017-04, Simplifying the Test for Goodwill Impairment. The amendments in this ASU are intended to reduce the cost and complexity of the goodwill impairment test by eliminating step two from the impairment test. The amendments modify the concept of impairment from the condition that exists when the carrying amount of goodwill exceeds its implied fair value to the condition that exists when the carrying amount of a reporting unit exceeds its fair value. Under the amendments in this ASU, an entity will perform its annual, or interim, goodwill impairment test by comparing the fair value of the reporting unit with its carrying amount. An impairment charge should be recognized for the amount which the carrying amount exceeds the reporting unit’s fair value; however, the loss recognized should not exceed the total amount of goodwill allocated to that reporting unit. The amendments in this ASU are effective for the Company’s annual or any interim goodwill impairment test in fiscal years beginning after December 15, 2019. Early adoption is permitted for interim or annual goodwill impairment tests performed on testing dates after January 1, 2017. The Company is early adopting these amendments in 2017 and does not expect a material impact on the Company’s Consolidated Financial Statements.

Other Income (Subtopic 610-20) In February 2017, the FASB issued ASU No. 2017-05, Other Income-Gains and Losses from the Derecognition of Nonfinancial Assets.  This ASU will clarify the scope of Subtopic 610-20 and add guidance for partial sales of nonfinancial assets.   The amendments should be applied either on retrospectively to each period presented or with a modified retrospective approach.  The amendment is effective for annual periods beginning after December 15, 2018, and interim periods within annual periods beginning after December 15, 2019.  The Company is currently evaluating the provisions of ASU No. 2017-05 to determine the potential impact the new standard will have on the Company’s Consolidated Financial Statements.

Nonrefundable Fees and Other Costs (Subtopic 310-20) In March 2017, FASB issued ASU No. 2017-08, Receivables—Nonrefundable Fees and Other Costs. The amendments in the ASU shorten the amortization period for certain callable debt securities held at a premium at the earliest call date. Under current GAAP, the Company amortizes the premium as an adjustment of yield over the contractual life of the instrument. As a result, upon exercise of a call on a callable debt security held at a premium, the unamortized premium is charged to earnings. The ASU shortens the amortization period for certain callable debt securities held at a premium and requires the premium to be amortized to the earliest call date. However, the amendments do not require an accounting change for securities held at a discount; the discount continues to be amortized to maturity. The amendments are effective for annual periods beginning after December 15, 2019, and interim periods within annual periods beginning after December 15, 2020. Early adoption is permitted. The Company is required to apply the amendments on a modified retrospective basis through a cumulative-effect adjustment directly to retained earnings as of the beginning of the period of adoption. Assuming the Company remains an emerging growth company, the new authoritative guidance will be effective for reporting periods after January 1, 2020. The Company is currently evaluating the provisions of ASU No. 2017-08 to determine the potential impact the new standard will have on the Company’s Consolidated Financial Statements.

XML

Acquisition of a Business (Tables)

9 Months Ended

Sep. 30, 2017

Business Combinations [Abstract]

Summary of Estimates of fair Values of Assets and Liabilities Assumed as of Acquisition Date

The following table presents a summary of the estimates of fair values of assets acquired and liabilities assumed as of the acquisition date:

Assets
Cash and cash equivalents	$	25,480
Securities available-for-sale		27,662
Restricted stock		931
Loans held for sale		15,363
Loans		351,820
Servicing assets		20,295
Premises and equipment		2,011
Other real estate owned		1,525
Other intangible assets		486
Bank-owned life insurance		2,352
Other assets		8,228
Total assets acquired		456,153
Liabilities
Deposits		361,370
Federal Home Loan Bank advances		9,773
Junior subordinated debentures		1,339
Accrued expenses and other liabilities		4,958
Total liabilities assumed		377,440
Net assets acquired	$	78,713
Consideration paid
Common stock (4,199,791 shares issued at $16.25 per    share)		68,247
Cash paid		36,753
Total consideration paid		105,000
Goodwill	$	26,287

Summary of Acquired Non-Impaired Loans as of Acquisition Date

The following table presents the acquired non-impaired loans as of the acquisition date:  

Fair value	$	312,166
Gross contractual amounts receivable		450,292
Estimate of contractual cash flows not expected to be    collected(1)		19,661
Estimate of contractual cash flows expected to be collected		430,631

(1) Includes interest payments not expected to be collected due to loan prepayments as well as principal and interest payments not expected to be collected due to customer default.

Summary of Pro Forma Information for Results of Operations

The following table provides the pro forma information for the results of operations for the three and nine months ended September 30, 2016, as if the acquisition had occurred on January 1, 2016. The pro forma results combine the historical results of Ridgestone into the Company’s Consolidated Statements of Operations, including the impact of certain acquisition accounting adjustments, which includes loan discount accretion, intangible assets amortization, deposit premium accretion and borrowing net discount amortization. The pro forma results have been prepared for comparative purposes only and are not necessarily indicative of the results that would have been obtained had the acquisition actually occurred on January 1, 2016. No assumptions have been applied to the pro forma results of operations regarding possible revenue enhancements, provision for credit losses, expense efficiencies or asset dispositions. The acquisition-related expenses that have been recognized are included in net income in the following table.

	Three Months Ended		Nine Months Ended
	September 30, 2016		September 30, 2016
Total revenues (net interest income and non-interest income)	$	44,595	$	130,536
Net income (loss)	$	6,816	$	17,603
Earnings per share—basic	$	0.29	$	0.76
Earnings per share—diluted	$	0.28	$	0.76

XML

Securities (Tables)

9 Months Ended

Sep. 30, 2017

Investments Debt And Equity Securities [Abstract]

Summary of Amortized Cost and Fair Values of Securities Available-for-sale and Held to Maturity

The followingtablessummarizetheamortizedcostand fairvaluesof securitiesavailable-for-saleand securitiesheld-to-maturityas of the dates shown and thecorrespondingamountsof grossunrealized gainsand losses:

September 30, 2017	Amortized Cost		Gross Unrealized Gains		Gross Unrealized Losses			Fair Value
Available-for-sale
U.S. Treasury Notes	$	14,998	$	—	$	(73	)	$	14,925
U.S. Government agencies		54,231		—		(1,012	)		53,219
Obligations of states, municipalities, and political    subdivisions		32,619		129		(213	)		32,535
Residential mortgage-backed securities
Agency		329,782		7		(5,749	)		324,040
Non-agency		25,429		87		(46	)		25,470
Commercial mortgage-backed securities
Agency		72,190		44		(1,477	)		70,757
Non-agency		31,838		—		(581	)		31,257
Corporate securities		27,093		493		(62	)		27,524
Other securities		3,626		1,387		(56	)		4,957
Total	$	591,806	$	2,147	$	(9,269	)	$	584,684

September 30, 2017	Amortized Cost		Gross Unrealized Gains		Gross Unrealized Losses			Fair Value
Held-to-maturity
Obligations of states, municipalities, and political subdivisions	$	24,078	$	317	$	(36	)	$	24,359
Residential mortgage-backed securities
Agency		56,453		275		(82	)		56,646
Non-agency		40,922		364		(25	)		41,261
Total	$	121,453	$	956	$	(143	)	$	122,266

December 31, 2016	Amortized Cost		Gross Unrealized Gains		Gross Unrealized Losses			Fair Value
Available-for-sale
U.S. Treasury Notes	$	14,995	$	4	$	(79	)	$	14,920
U.S. Government agencies		60,180		—		(1,323	)		58,857
Obligations of states, municipalities, and political    subdivisions		16,271		60		(272	)		16,059
Residential mortgage-backed securities
Agency		376,800		—		(8,640	)		368,160
Non-agency		20,107		—		(174	)		19,933
Commercial mortgage-backed securities
Agency		78,954		—		(1,551	)		77,403
Non-agency		32,061		—		(1,009	)		31,052
Corporate securities		17,065		350		(86	)		17,329
Other securities		4,161		742		(56	)		4,847
Total	$	620,594	$	1,156	$	(13,190	)	$	608,560

December 31, 2016	Amortized Cost		Gross Unrealized Gains		Gross Unrealized Losses			Fair Value
Held-to-maturity
Obligations of states, municipalities, and political    subdivisions	$	24,878	$	105	$	(229	)	$	24,754
Residential mortgage-backed securities
Agency		67,692		35		(283	)		67,444
Non-agency		46,276		50		(442	)		45,884
Total	$	138,846	$	190	$	(954	)	$	138,082

Summary of Gross Unrealized Losses and Fair Values, Aggregated by Investment Category and Length of Individual Securities Continuous Unrealized Loss Position Available-for-sale and Held to Maturity

Gross unrealized losses and fair values, aggregated by investment category and length of time that individual securities have been in a continuous unrealized loss position as of September 30, 2017 and December 31, 2016 are summarized as follows:

			Less than 12 Months					12 Months or Longer					Total
September 30, 2017	# of Securities		Fair Value		Unrealized Losses			Fair Value		Unrealized Losses			Fair Value		Unrealized Losses
Available-for-sale
U.S. Treasury Notes		5	$	14,925	$	(73	)	$	—	$	—		$	14,925	$	(73	)
U.S. Government agencies		9		28,418		(438	)		24,801		(574	)		53,219		(1,012	)
Obligations of states, municipalities and    political subdivisions		23		14,431		(122	)		2,082		(91	)		16,513		(213	)
Residential mortgage-backed securities
Agency		40		222,548		(3,356	)		93,293		(2,393	)		315,841		(5,749	)
Non-agency		1		4,789		(46	)		—		—			4,789		(46	)
Commercial mortgage-backed securities
Agency		7		39,378		(1,108	)		19,740		(369	)		59,118		(1,477	)
Non-agency		5		31,257		(581	)		—		—			31,257		(581	)
Corporate securities		3		4,959		(62	)		—		—			4,959		(62	)
Other securities		1		—		—			1,938		(56	)		1,938		(56	)
Total		94	$	360,705	$	(5,786	)	$	141,854	$	(3,483	)	$	502,559	$	(9,269	)

			Less than 12 Months					12 Months or Longer				Total
September 30, 2017	# of Securities		Fair Value		Unrealized Losses			Fair Value		Unrealized Losses		Fair Value		Unrealized Losses
Held-to-maturity
Obligations of states, municipalities, and    political subdivisions		7	$	4,855	$	(36	)	$	—	$	—	$	4,855	$	(36	)
Residential mortgage-backed securities
Agency		9		20,287		(82	)		—		—		20,287		(82	)
Non-agency		3		4,568		(25	)		—		—		4,568		(25	)
Total		19	$	29,710	$	(143	)	$	—	$	—	$	29,710	$	(143	)

			Less than 12 Months					12 Months or Longer					Total
December 31, 2016	# of Securities		Fair Value		Unrealized Losses			Fair Value		Unrealized Losses			Fair Value		Unrealized Losses
Available-for-sale
U.S. Treasury Notes		3	$	9,918	$	(79	)	$	—	$	—		$	9,918	$	(79	)
U.S. Government agencies		10		58,857		(1,323	)		—		—			58,857		(1,323	)
Obligations of states, municipalities and    political subdivisions		14		7,799		(259	)		115		(13	)		7,914		(272	)
Residential mortgage-backed securities
Agency		41		364,713		(8,483	)		3,447		(157	)		368,160		(8,640	)
Non-agency		2		19,933		(174	)		—		—			19,933		(174	)
Commercial mortgage-backed securities
Agency		8		70,762		(1,488	)		6,641		(63	)		77,403		(1,551	)
Non-agency		5		31,052		(1,009	)		—		—			31,052		(1,009	)
Corporate securities		4		5,097		(78	)		2,522		(8	)		7,619		(86	)
Other securities		1		—		—			1,994		(56	)		1,994		(56	)
Total		88	$	568,131	$	(12,893	)	$	14,719	$	(297	)	$	582,850	$	(13,190	)

			Less than 12 Months					12 Months or Longer				Total
December 31, 2016	# of Securities		Fair Value		Unrealized Losses			Fair Value		Unrealized Losses		Fair Value		Unrealized Losses
Held-to-maturity
Obligations of states, municipalities, and    political subdivisions		22	$	16,235	$	(229	)	$	—	$	—	$	16,235	$	(229	)
Residential mortgage-backed securities
Agency		15		52,156		(283	)		—		—		52,156		(283	)
Non-agency		5		29,245		(442	)		—		—		29,245		(442	)
Total		42	$	97,636	$	(954	)	$	—	$	—	$	97,636	$	(954	)

Summary of Proceeds From Sales of Securities Available-for-sale and Associated Gains and Losses

The proceedsfromallsalesof securitieswere available-for-sale,and theassociatedgainsand lossesfor thethree and nine months ended September 30, 2017 and 2016 arelistedbelow:

	For the Three Months Ended					For the Nine Months Ended
	September 30,					September 30,
	2017		2016			2017		2016
Proceeds	$	—	$	107,949		$	8	$	507,362
Gross gains		—		912			8		3,341
Gross losses		—		(110	)		—		(110	)

Schedule of Amortized Cost and Fair Value of Debt Securities by Contractual Maturity

At September 30, 2017, theamortizedcostand fairvalueof debtsecuritiesareshown by contractual maturity.Expectedmaturitiesmaydifferfromcontractualmaturitiesifborrowershave therightto callor prepay obligationswith or withoutcallor prepaymentpenalties.Securitiesnot due ata singlematuritydateareshown separately.

	Amortized Cost		Fair Value
Available-for-sale
Due in one year or less	$	5,289	$	5,287
Due from one to five years		70,097		69,824
Due from five to ten years		42,448		42,006
Due after ten years		11,807		11,625
Mortgage-backed securities		459,239		451,524
Other securities with no defined maturity		2,926		4,418
Total	$	591,806	$	584,684
Held-to-maturity
Due from one to five years	$	524	$	528
Due from five to ten years		13,735		13,835
Due after ten years		9,819		9,996
Mortgage-backed securities		97,375		97,907
Total	$	121,453	$	122,266

XML

Loan and Lease Receivables (Tables)

9 Months Ended

Sep. 30, 2017

Receivables [Abstract]

Schedule of Outstanding Loan and Lease Receivables

Outstanding loan and lease receivables as of the dates shown were categorized as follows:

	September 30,			December 31,
	2017			2016
Commercial real estate	$	862,523		$	796,950
Residential real estate		582,569			610,699
Construction, land development, and other land		94,639			141,122
Commercial and industrial		503,093			439,476
Installment and other		3,208			2,917
Lease financing receivables		168,924			155,999
Total loans and leases		2,214,956			2,147,163
Net unamortized deferred fees and costs		(1,874	)		(2,119	)
Initial direct costs		3,417			2,967
Allowance for loan and lease losses		(15,980	)		(10,923	)
Net loans and leases	$	2,200,519		$	2,137,088

	September 30,			December 31,
	2017			2016
Lease financing receivables
Net minimum lease payments	$	183,035		$	168,345
Unguaranteed residual values		1,580			1,787
Unearned income		(15,691	)		(14,133	)
Total lease financing receivables		168,924			155,999
Initial direct costs		3,417			2,967
Lease financial receivables before allowance for    lease losses	$	172,341		$	158,966

Summary of Minimum Annual Lease Payments for Lease Financing Receivables

The minimumannualleasepaymentsforleasefinancingreceivablesas of September 30, 2017 are summarizedas follows:

	Minimum Lease Payments
2017	$	15,345
2018		62,718
2019		48,463
2020		32,863
2021		17,699
Thereafter		5,947
Total	$	183,035

Summary of Balances for Each Respective Loan and Lease Category

The followingtablessummarizethebalancesforeachrespectiveloanand leasecategoryas of September 30, 2017 and December 31, 2016:

September 30, 2017	Originated		Acquired Impaired		Acquired Non- Impaired		Total
Commercial real estate	$	463,020	$	173,106	$	225,759	$	861,885
Residential real estate		398,062		152,149		32,451		582,662
Construction, land development, and other land		85,666		5,424		3,214		94,304
Commercial and industrial		390,331		11,433		100,291		502,055
Installment and other		2,726		488		38		3,252
Lease financing receivables		134,193		—		38,148		172,341
Total loans and leases	$	1,473,998	$	342,600	$	399,901	$	2,216,499

December 31, 2016	Originated		Acquired Impaired		Acquired Non- Impaired		Total
Commercial real estate	$	338,752	$	207,303	$	250,289	$	796,344
Residential real estate		394,168		175,717		40,853		610,738
Construction, land development, and other land		119,357		6,979		14,430		140,766
Commercial and industrial		309,097		13,464		115,677		438,238
Installment and other		2,021		574		364		2,959
Lease financing receivables		118,493		—		40,473		158,966
Total loans and leases	$	1,281,888	$	404,037	$	462,086	$	2,148,011

Summary of Outstanding Balance and Carrying Amount of All Acquired Impaired Loans

The outstandingbalanceand carryingamountof allacquiredimpairedloansaresummarizedbelow. The balancesdo not includean allowanceforloanand leaselossesof $3.8 million and $1.6 million,at September 30, 2017 and December 31, 2016, respectively.

	September 30, 2017				December 31, 2016
	Outstanding Balance		Carrying Value		Outstanding Balance		Carrying Value
Commercial real estate	$	245,182	$	173,106	$	278,893	$	207,303
Residential real estate		215,135		152,149		236,384		175,717
Construction, land development, and other land		13,511		5,424		15,292		6,979
Commercial and industrial		20,255		11,433		23,164		13,464
Installment and other		1,842		488		1,976		574
Total acquired impaired loans	$	495,925	$	342,600	$	555,709	$	404,037

Summary of Changes in Accretable Yield for Acquired Impaired Loans

The following table summarizes the changes in accretable yield for acquired impaired loans for the three and nine months ended September 30, 2017 and 2016:

	Three Months Ended						Nine Months Ended
	September 30,						September 30,
	2017			2016			2017			2016
Beginning balance	$	37,619		$	35,663		$	36,868		$	43,915
Accretion to interest income		(8,165	)		(5,859	)		(24,768	)		(20,071	)
Reclassification from nonaccretable difference		6,901			1,777			24,255			7,737
Ending balance	$	36,355		$	31,581		$	36,355		$	31,581

Schedule of Unpaid Principal Balance and Carrying Value for Acquired Non-Impaired Loans and Leases

Acquired non-impaired loans and leases—The unpaidprincipalbalanceand carryingvalueforacquirednon-impairedloansand leasesat September 30, 2017 and December 31, 2016 were as follows:

	September 30, 2017				December 31, 2016
	Unpaid Principal Balance		Carrying Value		Unpaid Principal Balance		Carrying Value
Commercial real estate	$	232,016	$	225,759	$	259,055	$	250,289
Residential real estate		32,984		32,451		41,282		40,853
Construction, land development, and other land		3,277		3,214		14,619		14,430
Commercial and industrial		111,167		100,291		125,806		115,677
Installment and other		352		38		402		364
Lease financing receivables		39,053		38,148		40,205		40,473
Total acquired non-impaired loans and leases	$	418,849	$	399,901	$	481,369	$	462,086

XML

Allowance for Loan and Lease Losses and Reserve for Unfunded Commitments (Tables)

9 Months Ended

Sep. 30, 2017

Receivables [Abstract]

Summary of Allowance for Loan and Lease Losses and Corresponding Loan and Lease Balances

The followingtablessummarizethebalanceand activitywithintheallowanceforloanand leaselosses, thecomponentsof theallowanceforloanand leaselossesin termsof loansand leasesindividuallyand collectivelyevaluatedforimpairment,and correspondingloanand leasebalancesby typefor the three and nine months ended September 30, 2017 and 2016 are as follows:

September 30, 2017	Commercial Real Estate			Residential Real Estate			Construction, Land Development, and Other Land			Commercial and Industrial			Installment and Other			Lease Financing Receivables			Total
Allowance for loan and lease losses
Three months ended
Beginning balance	$	3,668		$	1,835		$	327		$	5,689		$	344		$	2,106		$	13,969
Provisions		1,577			52			(111	)		1,440			13			929			3,900
Charge-offs		(186	)		(161	)		—			(763	)		(327	)		(862	)		(2,299	)
Recoveries		—			—			—			—			—			410			410
Ending balance	$	5,059		$	1,726		$	216		$	6,366		$	30		$	2,583		$	15,980
Nine months ended
Beginning balance	$	1,945		$	2,483		$	742		$	4,196		$	334		$	1,223		$	10,923
Provisions		3,591			(400	)		(526	)		3,932			23			2,686			9,306
Charge-offs		(477	)		(357	)		—			(1,762	)		(327	)		(2,399	)		(5,322	)
Recoveries		—			—			—			—			—			1,073			1,073
Ending balance	$	5,059		$	1,726		$	216		$	6,366		$	30		$	2,583		$	15,980
Ending balance:
Individually evaluated for    impairment	$	1,186		$	176		$	—		$	1,585		$	2		$	—		$	2,949
Collectively evaluated for    impairment		1,844			1,237			155			3,389			10			2,583			9,218
Loans acquired with deteriorated    credit quality		2,029			313			61			1,392			18			—			3,813
Total allowance for loan and lease    losses	$	5,059		$	1,726		$	216		$	6,366		$	30		$	2,583		$	15,980

September 30, 2017	Commercial Real Estate		Residential Real Estate		Construction, Land Development, and Other Land		Commercial and Industrial		Installment and Other		Lease Financing Receivables		Total
Loans and leases ending balance:
Individually evaluated for    impairment	$	14,928	$	1,948	$	565	$	6,075	$	2	$	—	$	23,518
Collectively evaluated for    impairment		673,851		428,565		88,315		484,547		2,762		172,341		1,850,381
Loans acquired with deteriorated    credit quality		173,106		152,149		5,424		11,433		488		—		342,600
Total loans and leases	$	861,885	$	582,662	$	94,304	$	502,055	$	3,252	$	172,341	$	2,216,499

September 30, 2016	Commercial Real Estate			Residential Real Estate			Construction, Land Development, and Other Land			Commercial and Industrial			Installment and Other			Lease Financing Receivables			Total
Allowance for loan and lease losses
Three months ended
Beginning balance	$	2,119		$	1,303		$	489		$	1,472		$	367		$	740		$	6,490
Provisions		27			41			66			624			(3	)		928			1,683
Charge-offs		(1,078	)		25			(95	)		(2	)		(9	)		(671	)		(1,830	)
Recoveries		—			—			—			—			—			158			158
Ending balance	$	1,068		$	1,369		$	460		$	2,094		$	355		$	1,155		$	6,501
Nine months ended
Beginning balance	$	2,280		$	2,981		$	232		$	1,403		$	357		$	379		$	7,632
Provisions		3,050			(980	)		323			768			8			2,179			5,348
Charge-offs		(4,262	)		(632	)		(95	)		(77	)		(10	)		(1,934	)		(7,010	)
Recoveries		—			—			—			—			—			531			531
Ending balance	$	1,068		$	1,369		$	460		$	2,094		$	355		$	1,155		$	6,501
Ending balance:
Individually evaluated for    impairment	$	—		$	339		$	—		$	192		$	328		$	—		$	859
Collectively evaluated for    impairment		669			534			413			1,264			1			1,155			4,036
Loans acquired with deteriorated    credit quality		399			496			47			638			26			—			1,606
Total allowance for loan and lease    losses	$	1,068		$	1,369		$	460		$	2,094		$	355		$	1,155		$	6,501

September 30, 2016	Commercial Real Estate		Residential Real Estate		Construction, Land Development, and Other Land		Commercial and Industrial		Installment and Other		Lease Financing Receivables		Total
Loans and leases ending balance:
Individually evaluated for    impairment	$	6,374	$	2,553	$	—	$	192	$	328	$	—	$	9,447
Collectively evaluated for    impairment		377,090		438,446		104,369		244,566		1,055		154,557		1,320,083
Loans acquired with deteriorated    credit quality		187,359		185,979		7,539		6,512		590		—		387,979
Total loans and leases	$	570,823	$	626,978	$	111,908	$	251,270	$	1,973	$	154,557	$	1,717,509

Summary of Recorded Investment, Unpaid Principal Balance, and Related Allowance for Loans and Leases Considered Impaired

The followingtablessummarizetherecordedinvestment,unpaidprincipalbalance, and relatedallowanceforloansand leasesconsideredimpaired as of September 30, 2017 and December 31, 2016, which excludes acquired impaired loans:

September 30, 2017	Recorded Investment		Unpaid Principal Balance		Related Allowance
With no related allowance recorded
Commercial real estate	$	9,541	$	10,149	$	—
Residential real estate		1,581		2,589		—
Construction, land development and other land		565		565		—
Commercial and industrial		3,465		3,652		—
With an allowance recorded
Commercial real estate		5,387		5,521		1,186
Residential real estate		367		387		176
Commercial and industrial		2,610		2,934		1,585
Installment and other		2		310		2
Total impaired loans	$	23,518	$	26,107	$	2,949

December 31, 2016	Recorded Investment		Unpaid Principal Balance		Related Allowance
With no related allowance recorded
Commercial real estate	$	8,916	$	9,502	$	—
Residential real estate		804		1,999		—
Commercial and Industrial		521		524		—
With an allowance recorded
Residential real estate		496		528		293
Commercial and industrial		861		869		396
Installment and other		328		361		328
Total impaired loans	$	11,926	$	13,783	$	1,017

Summary of Average Recorded Investment and Interest Income Recognized for Loans and Leases Considered Impaired

The following tables summarize the average recorded investment and interest income recognized for loans and leases considered impaired, which excludes acquired impaired loans, for the periods ended as follows:

September 30, 2017	Average Recorded Investment		Interest Income Recognized
With no related allowance recorded
Commercial real estate	$	10,605	$	419
Residential real estate		1,698		33
Construction, land development and other land		269		2
Commercial and Industrial		2,391		253
With an allowance recorded
Commercial real estate		1,043		287
Residential real estate		444		4
Construction, land development and other land		19		—
Commercial and industrial		1,673		500
Installment and other		213		11
Total impaired loans	$	18,355	$	1,509

Summary of Risk Rating Categories of Loans and Leases Considered for Inclusion in Allowance for Loan and Lease Losses Calculation

The followingtablessummarizetheriskratingcategoriesof theloansand leasesconsideredfor inclusionin theallowanceforloanand leaselossescalculation,excludingacquiredimpairedloans,as of September 30, 2017 and December 31, 2016:

September 30, 2017	Commercial Real Estate		Residential Real Estate		Construction, Land Development, and Other Land		Commercial and Industrial		Installment and Other		Lease Financing Receivables		Total
Pass	$	617,061	$	421,109	$	73,781	$	400,838	$	2,761	$	170,410	$	1,685,960
Watch		44,273		4,871		11,947		71,752		3		214		133,060
Special Mention		11,958		2,513		2,587		10,104		—		894		28,056
Substandard		15,487		2,020		565		7,928		—		639		26,639
Doubtful		—		—		—		—		—		184		184
Loss		—		—		—		—		—		—		—
Total	$	688,779	$	430,513	$	88,880	$	490,622	$	2,764	$	172,341	$	1,873,899

December 31, 2016	Commercial Real Estate		Residential Real Estate		Construction, Land Development, and Other Land		Commercial and Industrial		Installment and Other		Lease Financing Receivables		Total
Pass	$	536,499	$	419,880	$	129,732	$	369,136	$	2,052	$	157,296	$	1,614,595
Watch		38,707		10,885		2,897		52,872		4		324		105,689
Special Mention		5,377		3,116		1,158		1,258		1		512		11,422
Substandard		8,458		1,140		—		1,508		328		739		12,173
Doubtful		—		—		—		—		—		95		95
Loss		—		—		—		—		—		—		—
Total	$	589,041	$	435,021	$	133,787	$	424,774	$	2,385	$	158,966	$	1,743,974

Summary of Contractual Delinquency Information

The following tables summarize contractual delinquency information for acquired non-impaired and originated loans and leases by category at September 30, 2017 and December 31, 2016:

September 30, 2017	30-59 Days Past Due		60-89 Days Past Due		Greater than 90 Days and Accruing		Non- accrual		Total Past Due		Current		Total
Commercial real estate	$	350	$	596	$	—	$	8,672	$	9,618	$	679,161	$	688,779
Residential real estate		—		220		—		1,852		2,072		428,441		430,513
Construction, land development, and    other land		—		—		—		565		565		88,315		88,880
Commercial and industrial		2,245		416		—		3,537		6,198		484,424		490,622
Installment and other		2		—		—		—		2		2,762		2,764
Lease financing receivables		995		328		—		495		1,818		170,523		172,341
Total	$	3,592	$	1,560	$	—	$	15,121	$	20,273	$	1,853,626	$	1,873,899

December 31, 2016	30-59 Days Past Due		60-89 Days Past Due		Greater than 90 Days and Accruing		Non- accrual		Total Past Due		Current		Total
Commercial real estate	$	2,944	$	648	$	—	$	3,935	$	7,527	$	581,514	$	589,041
Residential real estate		243		—		—		1,118		1,361		433,660		435,021
Construction, land development, and    other land		1,363		—		—		—		1,363		132,424		133,787
Commercial and industrial		6,066		374		—		958		7,398		417,376		424,774
Installment and other		—		—		—		328		328		2,057		2,385
Lease financing receivables		2,070		390		—		445		2,905		156,061		158,966
Total	$	12,686	$	1,412	$	—	$	6,784	$	20,882	$	1,723,092	$	1,743,974

XML

Servicing Assets (Tables)

9 Months Ended

Sep. 30, 2017

Transfers And Servicing [Abstract]

Unpaid Principal Balances of Loans Serviced for Others

The unpaidprincipalbalancesof theseloansservicedforotherswere as follows as of September 30, 2017 and December 31, 2016:

	September 30,		December 31,
	2017		2016
Loan portfolios serviced for:
SBA guaranteed loans	$	1,001,845	$	911,803
USDA guaranteed loans		87,589		106,125
Total	$	1,089,434	$	1,017,928

Activity for Servicing Assets and Related Changes in Fair Value

Activityforservicingassetsand therelatedchangesin fairvalue for the nine months ended September 30, 2017 is as follows:

	Nine Months Ended
	September 30, 2017
Beginning balance	$	21,091
Additions, net		4,675
Changes in fair value		(4,097	)
Ending balance	$	21,669

XML

Other Real Estate Owned (Tables)

9 Months Ended

Sep. 30, 2017

Banking And Thrift [Abstract]

Change in Other Real Estate Owned

The following table presents the change in other real estate owned (“OREO”) for the nine months ended September 30, 2017 and 2016.

	Nine Months Ended September 30,
	2017			2016
Beginning balance	$	16,570		$	26,715
Net additions to OREO		5,701			3,721
Proceeds from the sales of OREO		(9,583	)		(15,392	)
Net gains on sales of OREO		1,538			1,134
Valuation adjustments		(367	)		(904	)
Ending balance	$	13,859		$	15,274

XML

Goodwill, Core Deposit Intangible and Other Intangible Assets (Tables)

9 Months Ended

Sep. 30, 2017

Goodwill And Intangible Assets Disclosure [Abstract]

Summary of Changes in Goodwill and Core Deposit Intangible Assets

The following table summarizes the changes in the Company’s goodwill and core deposit intangible assets for the nine months ended September 30, 2017 and 2016:

	Nine Months Ended September 30,
	2017					2016
	Goodwill		CoreDeposit Intangible			Goodwill		Core Deposit Intangible
Beginning balance	$	51,975	$	19,776		$	25,688	$	22,275
Amortization or accretion		—		(2,293	)		—		(2,228	)
Ending balance	$	51,975	$	17,483		$	25,688	$	20,047
Accumulated amortization or accretion	N/A		$	12,703		N/A		$	9,653
Weighted average remaining amortization or accretion    period	N/A		5.8 Years			N/A		6.8 Years

Estimated Amortization Expense for Core Deposit Intangible and Other Intangible Assets Recognized

The following table presents the estimated amortization expense for core deposit intangible and other intangible assets recognized at September 30, 2017:

	Estimated Amortization
2017	$	767
2018		3,060
2019		3,050
2020		3,027
2021		3,017
Thereafter		4,601
Total	$	17,522

XML

Deposits (Tables)

9 Months Ended

Sep. 30, 2017

Deposits [Abstract]

Schedule Of Deposits

The composition of deposits was as follows as of September 30, 2017 and December 31, 2016:

	September 30,		December 31,
	2017		2016
Non-interest bearing demand deposits	$	753,662	$	724,457
Interest bearing checking accounts		187,232		173,929
Money market demand accounts		418,006		369,074
Other savings		435,536		446,418
Time deposits (below $100,000)		377,929		392,854
Time deposits ($100,000 and above)		348,564		383,662
Total deposits	$	2,520,929	$	2,490,394

XML

Federal Home Loan Bank Advances (Tables)

9 Months Ended

Sep. 30, 2017

Federal Home Loan Banks [Abstract]

Summary of FHLB Advances Including Acquisition Accounting Adjustments Along with Weighted Average Costs and Scheduled Maturities

The followingtablesummarizestheFHLBadvancesas of September 30, 2017 and December 31, 2016, which include acquisition accounting adjustments of $72,000 and $228,000, respectively, alongwith weightedaveragecostsand scheduledmaturities:

	September 30,			December 31,
	2017			2016
Federal Home Loan Bank advances	$	234,559		$	313,715
Weighted average cost		1.32	%		0.73	%

	Scheduled Maturities
2017	$	225,000
2018		9,559
Total	$	234,559

XML

Other Borrowings (Tables)

9 Months Ended

Sep. 30, 2017

Debt Disclosure [Abstract]

Summary of Other Borrowings

The following is a summary of the Company’s other borrowings as of September 30, 2017 and December 31, 2016:

	September 30,		December 31,
	2017		2016
Securities sold under agreements to repurchase	$	30,807	$	17,249
Line of credit		—		20,650
Total	$	30,807	$	37,899

Summary of Short-term Credit Lines Available for Use

The followingtablepresentsshort-termcreditlinesavailableforuse, forwhich theCompany did not have an outstandingbalanceas of September 30, 2017 and December 31, 2016:

	September 30,		December 31,
	2017		2016
Federal Reserve Bank of Chicago discount window line	$	135,278	$	110,600
Available federal funds lines		40,000		20,000

XML

Junior Subordinated Debentures (Tables)

9 Months Ended

Sep. 30, 2017

Debt Disclosure [Abstract]

Junior Subordinated Debentures by Issuance

At September 30, 2017 and December 31, 2016, theCompany’sjuniorsubordinateddebenturesby issuancewere as follows:

Name of Trust	Aggregate Principal Amount September 30, 2017			Aggregate Principal Amount December 31, 2016			Stated Maturity	Contractual Rate at September 30, 2017			Interest Rate Spread
MetropolitanStatutory Trust 1	$	35,000		$	35,000		March17, 2034		4.11	%	Three-month LIBOR + 2.79%
RidgeStone Capital Trust I		1,500			1,500		June 30, 2033		5.09	%	Five-year LIBOR + 3.50%
Total liability, at par		36,500			36,500
Discount		(9,018	)		(9,574	)
Total liability, at carrying value	$	27,482		$	26,926

XML

Commitments and Contingent Liabilities (Tables)

9 Months Ended

Sep. 30, 2017

Commitments And Contingencies Disclosure [Abstract]

Summary of Minimum Annual Rental Commitments for Operating Leases

The minimumannualrentalcommitmentsforoperatingleasessubsequentto September 30, 2017, exclusiveof taxesand othercharges,aresummarizedas follows:

	MinimumRental Commitments
2017	$	754
2018		2,849
2019		2,506
2020		2,006
2021		1,759
Thereafter		3,025
Total	$	12,899

Summary of Contract or Notional Amount of Outstanding Loan and Lease Commitments

The followingtablesummarizesthecontractor notionalamountof outstandingloanand lease commitmentsat September 30, 2017 and December 31, 2016:

	September 30,				December 31,
	2017				2016
	Fixed Rate		Variable Rate		Fixed Rate		Variable Rate
Commitments to extend credit	$	46,427	$	425,115	$	37,731	$	332,928
Standby letters of credit		1,050		3,655		1,060		4,135
Total	$	47,477	$	428,770	$	38,791	$	337,063

XML

Fair Value Measurement (Tables)

9 Months Ended

Sep. 30, 2017

Fair Value Disclosures [Abstract]

Summary of Company's Financial Assets and Liabilities Measured at Fair Value on Recurring Basis

The followingtablessummarizetheCompany’sfinancialassetsand liabilitiesthatwere measuredatfair valueon a recurringbasisat September 30, 2017 and December 31, 2016:

			Fair Value Measurements Using
September 30, 2017	Fair Value		Level 1		Level 2		Level 3
Financial assets
Securities available-for-sale
U.S. Treasury Notes	$	14,925	$	14,925	$	—	$	—
U.S. Government agencies		53,219		—		53,219		—
Obligations of states, municipalities, and political    subdivisions		32,535		—		31,985		550
Mortgage-backed securities; residential
Agency		324,040		—		324,040		—
Non-Agency		25,470		—		25,470		—
Mortgage-backed securities; commercial
Agency		70,757		—		70,757		—
Non-Agency		31,257		—		31,257		—
Corporate securities		27,524		—		27,524		—
Other securities		4,957		1,938		2,480		539
Servicing assets		21,669		—		—		21,669
Derivative assets		3,913		—		3,913		—
Financial liabilities
Derivative liabilities		1,190		—		1,190		—

			Fair Value Measurements Using
December 31, 2016	Fair Value		Level 1		Level 2		Level 3
Financial assets
Securities available-for-sale
U.S. Treasury Notes	$	14,920	$	14,920	$	—	$	—
U.S. Government agencies		58,857		—		58,857		—
Obligations of states, municipalities, and political    subdivisions		16,059		—		15,509		550
Mortgage-backed securities; residential
Agency		368,160		—		368,160		—
Non-Agency		19,933		—		19,933		—
Mortgage-backed securities; commercial
Agency		77,403		—		77,403		—
Non-Agency		31,052		—		31,052		—
Corporate securities		17,329		—		17,329		—
Other securities		4,847		1,938		2,379		530
Servicing assets		21,091		—		—		21,091
Derivative assets		4,317		—		4,317		—
Financial liabilities
Derivative liabilities		559		—		559		—

Summary of Financial Assets Measured at Fair Value on Recurring Basis Using Significant Unobservable Inputs

The following table presents additional information about financial assets measured at fair value on recurring basis for which the Company used significant unobservable inputs (Level 3):

	Nine Months Ended
	September 30,
	2017		2016		2017			2016
	Investment Securities				Servicing Assets
Balance, beginning of period	$	1,080	$	—	$	21,091		$	—
Additions, net		—		—		4,675			—
Amortization		3		—		—			—
Change in unrealized loss		6		—		—			—
Change in fair value		—		—		(4,097	)		—
Balance, end of period	$	1,089	$	—	$	21,669		$	—

Summary of Unobservable Inputs Used in the Fair Value Measurements on Recurring Basis

The followingtablepresentsadditionalinformationabouttheunobservableinputsused in thefairvalue measurementson recurringbasisthatwere categorizedwithinLevel3 of thefairvaluehierarchyas of September 30, 2017:

Financial Instruments	Valuation Technique	Unobservable Inputs	Range of Inputs	Weighted Average Range			Impact to Valuation from an Increased or Higher Input Value
Obligations of states, municipalities,    and political obligations	Discountedcash flow	Probability of default	2.0%—2.4%		2.2	%	Decrease
Single issuer trust preferred	Discounted cash flow	Probability of default	7.5%—9.9%		8.9	%	Decrease
Servicing assets	Discounted cash flow	Prepayment speeds	1.7%—9.0%		7.6	%	Decrease
		Discount rate	9.1%—16.2%		12.8	%	Decrease
		Expected weighted average loan life	0.4—11.5 years	6.1 years			Increase

Summary of Company's Assets Measured at Fair Value on a Non-Recurring Basis

The following tablessummarizetheCompany’sassetsthatwere measuredatfairvalueon a non-recurringbasis,excluding acquiredimpairedloans,as of September 30, 2017 and December 31, 2016:

			Fair Value Measurements Using
September 30, 2017	Fair Value		Level 1		Level 2		Level 3
Non-recurring
Impaired loans
(excluding acquired impaired loans)
Commercial real estate	$	13,742	$	—	$	—	$	13,742
Residential real estate		1,772		—		—		1,772
Construction, land development, and other land		565		—		—		565
Commercial and industrial		4,490		—		—		4,490
Installment and other		-		—		—		-
Assets held for sale		12,938		—		—		12,938
Other real estate owned		13,859		—		—		13,859

			Fair Value Measurements Using
December 31, 2016	Fair Value		Level 1		Level 2		Level 3
Non-recurring
Impaired loans
(excluding acquired impaired loans)
Commercial real estate	$	8,916	$	—	$	—	$	8,916
Residential real estate		1,007		—		—		1,007
Construction, land development, and other land		—		—		—		—
Commercial and industrial		986		—		—		986
Installment and other		—		—		—		—
Assets held for sale		14,748		—		—		14,748
Other real estate owned		16,570		—		—		16,570

Summary of the Valuation Technique, Unobservable Inputs and Qualitative Information About the Company?s Assets and Liabilities

The followingtableprovidesa descriptionof thevaluationtechnique,unobservableinputsand qualitativeinformationabouttheCompany’sassetsand liabilitiesclassifiedas Level3 and measuredatfairvalue on a non-recurringbasisas of September 30, 2017:

Financial Instruments	Valuation Technique	Unobservable Inputs	Range of Inputs	Impact to Valuation from an Increased or Higher Input Value
Impaired loans (excluding    acquired impaired loans)	Appraisals	Appraisal adjustments, sales costs and other discount adjustments for market conditions	6% - 10%	Decrease
Assets held for sale	List price, contract price	Sales costs and other discount adjustments for market conditions	7%	Decrease
Other real estate owned	Appraisals	Appraisal adjustments, sales costs and other discount adjustments for market conditions	7% - 20%	Decrease

Estimated Fair Values of Financial Instruments

The estimatedfairvaluesof financialinstrumentsand levelswithinthefairvaluehierarchyareas follows:

			September 30,				December 31,
	Fair Value		2017				2016
	Hierarchy Level		Carrying Amount		Estimated Fair Value		Carrying Amount		Estimated Fair Value
Financial assets
Cash and due from banks		1	$	16,193	$	16,193	$	17,735	$	17,735
Interest bearing deposits with other banks		2		46,043		46,043		28,798		28,798
Securities held-to-maturity		2		121,453		122,266		138,846		138,082
Other restricted stock		2		10,628		10,628		14,993		14,993
Loans held for sale		3		2,087		2,335		23,976		26,487
Loans and lease receivables, net		3		2,200,519		2,118,769		2,137,088		2,068,157
Accrued interest receivable		3		7,183		7,183		6,866		6,866
Financial liabilities
Non-interest bearing deposits		2		753,662		753,662		724,457		724,457
Interest bearing deposits		2		1,767,267		1,721,537		1,765,937		1,723,941
Accrued interest payable		2		1,184		1,184		2,427		2,427
Line of credit		2		-		-		20,650		20,650
Federal Home Loan Bank advances		2		234,559		234,543		313,715		313,646
Securities sold under repurchase agreement		2		30,807		30,807		17,249		17,249
Junior subordinated debentures		3		27,482		26,779		26,926		26,943

XML

Derivative Instruments and Hedge Activities (Tables)

9 Months Ended

Sep. 30, 2017

Derivative Instruments And Hedging Activities Disclosure [Abstract]

Summary of Derivative Financial Instruments and Classification on Consolidated Statements of Financial Condition

The following tables present the fair value of the Company’s derivative financial instruments and classification on the Consolidated Statements of Financial Condition as of September 30, 2017 and December 31, 2016:

	September 30, 2017						December 31, 2016
			Fair Value						Fair Value
	Notional Amount		Other Assets		Other Liabilities		Notional Amount		Other Assets		Other Liabilities
Derivatives designated as hedging instruments
Interest rate swaps designated as cash     flow hedges	$	250,000	$	3,265	$	545	$	100,000	$	3,719	$	—
Derivatives not designated as hedging instruments
Other interest rate swaps		81,712		648		645		51,213		598		559
Total derivatives	$	331,712	$	3,913	$	1,190	$	151,213	$	4,317	$	559

Summary of Net Gains (Losses) Recorded in Accumulated Other Comprehensive Income (Loss) and Consolidated Statements of Operations Relating to Cash Flow Derivative Instruments

The following table reflects the net gains (losses) recorded in accumulated other comprehensive income (loss) and the Consolidated Statements of Operations relating to the cash flow derivative instruments for the nine months ended September 30, 2017. 

	Amount of Gain Recognized in OCI (Effective Portion)			Amount of Loss Reclassified from OCI to Income as an Increase to Interest Expense			Amount of Gain (Loss) Recognized in Other Non-Interest Income (Ineffective Portion)
Interest rate swaps	$	(1,408	)	$	(426	)	$	—

Summary of Other Interest Rate Swaps

The following table reflects other interest rate swaps as of September 30, 2017

Notional amounts	$	81,712
Derivative assets fair value		648
Derivative liabilities fair value		645
Weighted average pay rates		4.26	%
Weighted average receive rates		3.68	%
Weighted average maturity	6.1 years

Summary of Company's Interest Rate Derivative and Offsetting Positions

The Company records interest rate derivatives subject to master netting agreements at their gross value and does not offset derivative asset and liabilities on the Consolidated Statements of Financial Condition. The table below summarizes the Company’s interest rate derivatives and offsetting positions as of September 30, 2017: 

	Derivative Assets Fair Value			Derivative Liabilities Fair Value
Gross amounts recognized	$	3,913		$	1,190
Less: Amounts offset in the Consolidated Statements of Financial Condition		—			—
Net amount presented in the Consolidated Statements of Financial Condition	$	3,913		$	1,190
Gross amounts not offset in the Consolidated Statements of Financial Condition
Offsetting derivative positions		(677	)		(677	)
Collateral posted		(2,949	)		(502	)
Net credit exposure	$	287		$	11

XML

Share-Based Compensation (Tables)

9 Months Ended

Sep. 30, 2017

Share Based Compensation Arrangement By Share Based Payment Award [Line Items]

Summary of Stock Compensation Expense

The following table summarizes stock option compensation expense for the nine months ended September 30, 2017 and 2016:

	Nine Months Ended September 30,
	2017		2016
Total share-based compensation – stock options	$	857	$	553
Income tax benefit		348		—
Unrecognized compensation expense		1,074		1,431
Weighted-average amortization period remaining		1.2 years		2.0 years

Restricted Shares

Share Based Compensation Arrangement By Share Based Payment Award [Line Items]

Summary of Stock Compensation Expense

The following table summarizes restricted stock compensation expense for the nine months ended September 30, 2017:

	Nine Months Ended September 30,
	2017
Total share-based compensation - restricted stock	$	94
Income tax benefit		38
Unrecognized compensation expense		1,087
Weighted-average amortization period remaining		2.8 years

Omnibus Plan

Share Based Compensation Arrangement By Share Based Payment Award [Line Items]

Summary of Changes in Restricted Shares

The following table discloses the changes in restricted shares for the nine months ended September 30, 2017:

	Omnibus Plan
	Number of Shares			Weighted Average Grant Date Fair Value
Beginning balance		—		$	—
Granted		58,900		$	20.18
Vested		—		$	—
Forfeited		(400	)	$	20.18
Ending balance outstanding at September 30, 2017		58,500		$	20.18

BYB Plan

Share Based Compensation Arrangement By Share Based Payment Award [Line Items]

Fair Value Assumptions of Stock Options

The fair values of the stock options were determined using the Black-Scholes-Merton model for Time Options and a Monte Carlo simulation model for Performance Options. The fair values of options under the BYB Plan were determined using the following assumptions as of the grant dates:

	Time Options Grants
	2016			2015
Risk-free interest rate	1.34% - 1.40%			1.68% - 1.85%
Expected term (years)	5.2 - 5.6			5.7 - 6.3
Expected stock price volatility		20.39	%	16.18%-16.55%
Expected dividend yield		0.00	%		0.00	%
Weighted average grant date fair value	$	3.55		$	2.25

	Performance Options Grants
	2016			2015
Risk-free interest rate	Implied forward rates			Implied forward rates
Expected term (years)	Variable			Variable
Expected stock price volatility	20.34% - 20.39%			16.18%-16.55%
Expected dividend yield		0.00	%		0.00	%
Weighted average grant date fair value	$	3.75		$	1.65

Summary of Activity in shares Subjected to Options and Weighted Average Exercise Prices

The following table discloses the activity in shares subject to options and the weighted average exercise prices, in actual dollars, for the nine months ended September 30, 2017:

	BYB Plan
	Number of Shares		Weighted Average Exercise Price		Intrinsic Value		Weighted Average Remaining Contractual Term (in Years)
Beginning balance		1,798,220	$	11.95	$	15,788		9.8
Granted		—
Expired		—
Exercised		—
Forfeited		—
Ending balance outstanding at September 30, 2017		1,798,220	$	11.95	$	16,545		7.9
Exercisable at September 30, 2017		835,263	$	11.31	$	8,310		7.7

XML

Earnings per Share (Tables)

9 Months Ended

Sep. 30, 2017

Earnings Per Share [Abstract]

Schedule of Calculation of Basic and Diluted Earnings per Share

The following represent the calculation of basic and diluted earnings per share:

	Three Months Ended September 30,				Nine Months Ended September 30,
	2017		2016		2017		2016
Net income	$	9,755	$	1,565	$	22,461	$	2,814
Less: Dividends on preferred shares		195		—		11,081		—
Net income available to common stockholders	$	9,560	$	1,565	$	11,380	$	2,814
Weighted-average common stock outstanding:
Weighted-average common stock outstanding (basic)		29,246,900		19,497,811		26,194,025		18,838,354
Incremental shares		505,431		265,623		503,816		265,623
Weighted-average common stock outstanding (dilutive)		29,752,331		19,763,434		26,697,841		19,103,977
Basic earnings per common share	$	0.33	$	0.08	$	0.43	$	0.15
Diluted earnings per common share	$	0.32	$	0.08	$	0.43	$	0.15

XML

Stockholders' Equity (Tables)

9 Months Ended

Sep. 30, 2017

Equity [Abstract]

Summary of Preferred and Common Stock

A summary of the Company’s preferred and common stock at September 30, 2017 and December 31, 2016 is as follows:

	September 30,		December 31,
	2017		2016
Series A non-cumulative perpetual preferred stock
Par value	$	0.01	$	0.01
Shares authorized	15,003			15,003
Shares issued	—			15,003
Shares outstanding	—			15,003
Series B 7.5% fixed non-cumulative perpetual    preferred stock
Par value	$	0.01	$	0.01
Shares authorized		50,000		50,000
Shares issued		10,438		9,388
Subscription receivable		—		1,050
Shares outstanding		10,438		9,388
Common stock, voting
Par value	$	0.01	$	—
Shares authorized		150,000,000		150,000,000
Shares issued		29,305,400		24,616,706
Shares outstanding		29,305,400		24,616,706

XML

Acquisition of a Business - Additional Information (Details)		9 Months Ended
	Oct. 14, 2016 USD ($) Subsidiary $ / shares shares	Sep. 30, 2017 USD ($)	Sep. 30, 2016 USD ($)	Dec. 31, 2016 USD ($)	Dec. 31, 2015 USD ($)
Business Acquisition [Line Items]
Goodwill		$ 51,975,000	$ 25,688,000	$ 51,975,000	$ 25,688,000
Ridgestone
Business Acquisition [Line Items]
Business acquisition date of agreement		Oct. 14, 2016
Number of operated wholly owned subsidiaries | Subsidiary	2
Total consideration included aggregate cash	$ 36,753,000
Issuance of common shares | shares	4,199,791
Common stock issued price per share | $ / shares	$ 16.25
Goodwill	$ 26,287,000
Acquisition advisory expenses			$ 1,100,000
Contingent assets or liabilities arising from the acquisition	$ 0

XML

Acquisition of a Business - Summary of Estimates of fair Values of Assets and Liabilities Assumed as of Acquisition Date (Details) - USD ($) $ in Thousands	Oct. 14, 2016	Sep. 30, 2017	Dec. 31, 2016	Sep. 30, 2016	Dec. 31, 2015
Consideration paid
Goodwill		$ 51,975	$ 51,975	$ 25,688	$ 25,688
Ridgestone
Assets
Cash and cash equivalents	$ 25,480
Securities available-for-sale	27,662
Restricted stock	931
Loans held for sale	15,363
Loans	351,820
Servicing assets	20,295
Premises and equipment	2,011
Other real estate owned	1,525
Other intangible assets	486
Bank-owned life insurance	2,352
Other assets	8,228
Total assets acquired	456,153
Liabilities
Deposits	361,370
Federal Home Loan Bank advances	9,773
Junior subordinated debentures	1,339
Accrued expenses and other liabilities	4,958
Total liabilities assumed	377,440
Net assets acquired	78,713
Consideration paid
Common stock (4,199,791 shares issued at $16.25 per share)	68,247
Cash paid	36,753
Total consideration paid	105,000
Goodwill	$ 26,287

XML

Acquisition of a Business - Summary of Estimates of fair Values of Assets and Liabilities Assumed as of Acquisition Date (Parenthetical) (Details) - Ridgestone	Oct. 14, 2016 $ / shares shares
Business Acquisition [Line Items]
Stock issued (in shares) | shares	4,199,791
Stock issued (in dollars per share) | $ / shares	$ 16.25

XML

Acquisition of a Business - Summary of Acquired Non-Impaired Loans as of Acquisition Date (Details) $ in Thousands	Oct. 14, 2016 USD ($)
Business Combinations [Abstract]
Fair value	$ 312,166
Gross contractual amounts receivable	450,292
Estimate of contractual cash flows not expected to be collected	19,661	[1]
Estimate of contractual cash flows expected to be collected	$ 430,631

[1] Includes interest payments not expected to be collected due to loan prepayments as well as principal and interest payments not expected to be collected due to customer default.

XML

Acquisition of a Business - Summary of Pro Forma Information for Results of Operations (Details) - USD ($) $ / shares in Units, $ in Thousands	3 Months Ended	9 Months Ended
	Sep. 30, 2016	Sep. 30, 2016
Business Combinations [Abstract]
Total revenues (net interest income and non-interest income)	$ 44,595	$ 130,536
Net income (loss)	$ 6,816	$ 17,603
Earnings per share—basic	$ 0.29	$ 0.76
Earnings per share—diluted	$ 0.28	$ 0.76

XML

Securities - Summary of Amortized Cost and Fair Values of Securities Available-for-sale (Details) - USD ($) $ in Thousands	Sep. 30, 2017	Dec. 31, 2016
Schedule Of Available For Sale Securities [Line Items]
Available-for-sale Securities, Amortized Cost	$ 591,806	$ 620,594
Available-for-sale Securities, Gross Unrealized Gains	2,147	1,156
Available-for-sale Securities, Gross Unrealized Losses	(9,269)	(13,190)
Available-for-sale Securities, Fair Value	584,684	608,560
U.S. Treasury Notes
Schedule Of Available For Sale Securities [Line Items]
Available-for-sale Securities, Amortized Cost	14,998	14,995
Available-for-sale Securities, Gross Unrealized Gains		4
Available-for-sale Securities, Gross Unrealized Losses	(73)	(79)
Available-for-sale Securities, Fair Value	14,925	14,920
U.S. Government Agencies
Schedule Of Available For Sale Securities [Line Items]
Available-for-sale Securities, Amortized Cost	54,231	60,180
Available-for-sale Securities, Gross Unrealized Losses	(1,012)	(1,323)
Available-for-sale Securities, Fair Value	53,219	58,857
Obligations of States, Municipalities, and Political Subdivisions
Schedule Of Available For Sale Securities [Line Items]
Available-for-sale Securities, Amortized Cost	32,619	16,271
Available-for-sale Securities, Gross Unrealized Gains	129	60
Available-for-sale Securities, Gross Unrealized Losses	(213)	(272)
Available-for-sale Securities, Fair Value	32,535	16,059
Agency, Residential Mortgage-Backed Securities
Schedule Of Available For Sale Securities [Line Items]
Available-for-sale Securities, Amortized Cost	329,782	376,800
Available-for-sale Securities, Gross Unrealized Gains	7
Available-for-sale Securities, Gross Unrealized Losses	(5,749)	(8,640)
Available-for-sale Securities, Fair Value	324,040	368,160
Non-Agency, Residential Mortgage-Backed Securities
Schedule Of Available For Sale Securities [Line Items]
Available-for-sale Securities, Amortized Cost	25,429	20,107
Available-for-sale Securities, Gross Unrealized Gains	87
Available-for-sale Securities, Gross Unrealized Losses	(46)	(174)
Available-for-sale Securities, Fair Value	25,470	19,933
Agency, Commercial Mortgage-Backed Securities
Schedule Of Available For Sale Securities [Line Items]
Available-for-sale Securities, Amortized Cost	72,190	78,954
Available-for-sale Securities, Gross Unrealized Gains	44
Available-for-sale Securities, Gross Unrealized Losses	(1,477)	(1,551)
Available-for-sale Securities, Fair Value	70,757	77,403
Non-Agency, Commercial Mortgage-Backed Securities
Schedule Of Available For Sale Securities [Line Items]
Available-for-sale Securities, Amortized Cost	31,838	32,061
Available-for-sale Securities, Gross Unrealized Losses	(581)	(1,009)
Available-for-sale Securities, Fair Value	31,257	31,052
Corporate Securities
Schedule Of Available For Sale Securities [Line Items]
Available-for-sale Securities, Amortized Cost	27,093	17,065
Available-for-sale Securities, Gross Unrealized Gains	493	350
Available-for-sale Securities, Gross Unrealized Losses	(62)	(86)
Available-for-sale Securities, Fair Value	27,524	17,329
Other Securities
Schedule Of Available For Sale Securities [Line Items]
Available-for-sale Securities, Amortized Cost	3,626	4,161
Available-for-sale Securities, Gross Unrealized Gains	1,387	742
Available-for-sale Securities, Gross Unrealized Losses	(56)	(56)
Available-for-sale Securities, Fair Value	$ 4,957	$ 4,847

XML

Securities - Summary of Amortized Cost and Fair Values of Securities Held-to-maturity (Details) - USD ($) $ in Thousands	Sep. 30, 2017	Dec. 31, 2016
Schedule Of Held To Maturity Securities [Line Items]
Held-to-maturity Securities, Amortized Cost	$ 121,453	$ 138,846
Held-to-maturity Securities, Gross Unrealized Gains	956	190
Held-to-maturity Securities, Gross Unrealized Losses	(143)	(954)
Securities held-to-maturity, fair value	122,266	138,082
Obligations of States, Municipalities, and Political Subdivisions
Schedule Of Held To Maturity Securities [Line Items]
Held-to-maturity Securities, Amortized Cost	24,078	24,878
Held-to-maturity Securities, Gross Unrealized Gains	317	105
Held-to-maturity Securities, Gross Unrealized Losses	(36)	(229)
Securities held-to-maturity, fair value	24,359	24,754
Agency, Residential Mortgage-Backed Securities
Schedule Of Held To Maturity Securities [Line Items]
Held-to-maturity Securities, Amortized Cost	56,453	67,692
Held-to-maturity Securities, Gross Unrealized Gains	275	35
Held-to-maturity Securities, Gross Unrealized Losses	(82)	(283)
Securities held-to-maturity, fair value	56,646	67,444
Non-Agency, Residential Mortgage-Backed Securities
Schedule Of Held To Maturity Securities [Line Items]
Held-to-maturity Securities, Amortized Cost	40,922	46,276
Held-to-maturity Securities, Gross Unrealized Gains	364	50
Held-to-maturity Securities, Gross Unrealized Losses	(25)	(442)
Securities held-to-maturity, fair value	$ 41,261	$ 45,884

XML

Securities - Additional Information (Details)	3 Months Ended		9 Months Ended
	Sep. 30, 2017 USD ($) Security	Sep. 30, 2016 USD ($)	Sep. 30, 2017 USD ($) Security	Sep. 30, 2016 USD ($)	Dec. 31, 2016 USD ($)
Schedule Of Investments [Line Items]
Trading securities	$ 0		$ 0		$ 0
Investment securities with unrealized losses | Security	113		113
Investment securities with continuous unrealized loss position for twelve consecutive months or longer | Security	1		1
Net gains or (losses) reclassified from accumulated other comprehensive income (loss) into earnings	$ 0	$ 802,000	$ 8,000	$ 3,200,000
Carrying amount of securities pledged as collateral	226,000,000		226,000,000		178,600,000
Federal Home Loan Bank Advances
Schedule Of Investments [Line Items]
Carrying amount of securities pledged as collateral	0		0		58,700,000
Public Fund Deposits
Schedule Of Investments [Line Items]
Carrying amount of securities pledged as collateral	189,900,000		189,900,000		93,200,000
Customer Repurchase Agreements
Schedule Of Investments [Line Items]
Carrying amount of securities pledged as collateral	$ 35,900,000		$ 35,900,000		$ 19,900,000
Minimum
Schedule Of Investments [Line Items]
Percentage of amortized cost for which investments in unrealized loss position exceeds	5.00%		5.00%
Percentage of shareholders equity for which securities holdings exceeds for no issuer other than U.S. Government and agencies	10.00%		10.00%

XML

Securities - Summary of Gross Unrealized Losses and Fair Values, Aggregated by Investment Category and Length of Individual Securities Continuous Unrealized Loss Position Available-for-sale (Details) $ in Thousands	9 Months Ended	12 Months Ended
	Sep. 30, 2017 USD ($) Security	Dec. 31, 2016 USD ($) Security
Schedule Of Available For Sale Securities [Line Items]
Available-for-sale Securities, Continuous Unrealized Loss Position, Number of Securities | Security	94	88
Available-for-sale Securities, Continuous Unrealized Loss Position, Less than 12 Months, Fair Value	$ 360,705	$ 568,131
Available-for-sale Securities, Continuous Unrealized Loss Position, Less than 12 Months, Unrealized Losses	(5,786)	(12,893)
Available-for-sale Securities, Continuous Unrealized Loss Position, 12 Months or Longer, Fair Value	141,854	14,719
Available-for-sale Securities, Continuous Unrealized Loss Position, 12 Months or Longer, Unrealized Losses	(3,483)	(297)
Available-for-sale Securities, Continuous Unrealized Loss Position, Total Fair Value	502,559	582,850
Available-for-sale Securities, Continuous Unrealized Loss Position, Total Unrealized Losses	$ (9,269)	$ (13,190)
U.S. Treasury Notes
Schedule Of Available For Sale Securities [Line Items]
Available-for-sale Securities, Continuous Unrealized Loss Position, Number of Securities | Security	5	3
Available-for-sale Securities, Continuous Unrealized Loss Position, Less than 12 Months, Fair Value	$ 14,925	$ 9,918
Available-for-sale Securities, Continuous Unrealized Loss Position, Less than 12 Months, Unrealized Losses	(73)	(79)
Available-for-sale Securities, Continuous Unrealized Loss Position, Total Fair Value	14,925	9,918
Available-for-sale Securities, Continuous Unrealized Loss Position, Total Unrealized Losses	$ (73)	$ (79)
U.S. Government Agencies
Schedule Of Available For Sale Securities [Line Items]
Available-for-sale Securities, Continuous Unrealized Loss Position, Number of Securities | Security	9	10
Available-for-sale Securities, Continuous Unrealized Loss Position, Less than 12 Months, Fair Value	$ 28,418	$ 58,857
Available-for-sale Securities, Continuous Unrealized Loss Position, Less than 12 Months, Unrealized Losses	(438)	(1,323)
Available-for-sale Securities, Continuous Unrealized Loss Position, 12 Months or Longer, Fair Value	24,801
Available-for-sale Securities, Continuous Unrealized Loss Position, 12 Months or Longer, Unrealized Losses	(574)
Available-for-sale Securities, Continuous Unrealized Loss Position, Total Fair Value	53,219	58,857
Available-for-sale Securities, Continuous Unrealized Loss Position, Total Unrealized Losses	$ (1,012)	$ (1,323)
Obligations of States, Municipalities, and Political Subdivisions
Schedule Of Available For Sale Securities [Line Items]
Available-for-sale Securities, Continuous Unrealized Loss Position, Number of Securities | Security	23	14
Available-for-sale Securities, Continuous Unrealized Loss Position, Less than 12 Months, Fair Value	$ 14,431	$ 7,799
Available-for-sale Securities, Continuous Unrealized Loss Position, Less than 12 Months, Unrealized Losses	(122)	(259)
Available-for-sale Securities, Continuous Unrealized Loss Position, 12 Months or Longer, Fair Value	2,082	115
Available-for-sale Securities, Continuous Unrealized Loss Position, 12 Months or Longer, Unrealized Losses	(91)	(13)
Available-for-sale Securities, Continuous Unrealized Loss Position, Total Fair Value	16,513	7,914
Available-for-sale Securities, Continuous Unrealized Loss Position, Total Unrealized Losses	$ (213)	$ (272)
Agency, Residential Mortgage-Backed Securities
Schedule Of Available For Sale Securities [Line Items]
Available-for-sale Securities, Continuous Unrealized Loss Position, Number of Securities | Security	40	41
Available-for-sale Securities, Continuous Unrealized Loss Position, Less than 12 Months, Fair Value	$ 222,548	$ 364,713
Available-for-sale Securities, Continuous Unrealized Loss Position, Less than 12 Months, Unrealized Losses	(3,356)	(8,483)
Available-for-sale Securities, Continuous Unrealized Loss Position, 12 Months or Longer, Fair Value	93,293	3,447
Available-for-sale Securities, Continuous Unrealized Loss Position, 12 Months or Longer, Unrealized Losses	(2,393)	(157)
Available-for-sale Securities, Continuous Unrealized Loss Position, Total Fair Value	315,841	368,160
Available-for-sale Securities, Continuous Unrealized Loss Position, Total Unrealized Losses	$ (5,749)	$ (8,640)
Non-Agency, Residential Mortgage-Backed Securities
Schedule Of Available For Sale Securities [Line Items]
Available-for-sale Securities, Continuous Unrealized Loss Position, Number of Securities | Security	1	2
Available-for-sale Securities, Continuous Unrealized Loss Position, Less than 12 Months, Fair Value	$ 4,789	$ 19,933
Available-for-sale Securities, Continuous Unrealized Loss Position, Less than 12 Months, Unrealized Losses	(46)	(174)
Available-for-sale Securities, Continuous Unrealized Loss Position, Total Fair Value	4,789	19,933
Available-for-sale Securities, Continuous Unrealized Loss Position, Total Unrealized Losses	$ (46)	$ (174)
Agency, Commercial Mortgage-Backed Securities
Schedule Of Available For Sale Securities [Line Items]
Available-for-sale Securities, Continuous Unrealized Loss Position, Number of Securities | Security	7	8
Available-for-sale Securities, Continuous Unrealized Loss Position, Less than 12 Months, Fair Value	$ 39,378	$ 70,762
Available-for-sale Securities, Continuous Unrealized Loss Position, Less than 12 Months, Unrealized Losses	(1,108)	(1,488)
Available-for-sale Securities, Continuous Unrealized Loss Position, 12 Months or Longer, Fair Value	19,740	6,641
Available-for-sale Securities, Continuous Unrealized Loss Position, 12 Months or Longer, Unrealized Losses	(369)	(63)
Available-for-sale Securities, Continuous Unrealized Loss Position, Total Fair Value	59,118	77,403
Available-for-sale Securities, Continuous Unrealized Loss Position, Total Unrealized Losses	$ (1,477)	$ (1,551)
Non-Agency, Commercial Mortgage-Backed Securities
Schedule Of Available For Sale Securities [Line Items]
Available-for-sale Securities, Continuous Unrealized Loss Position, Number of Securities | Security	5	5
Available-for-sale Securities, Continuous Unrealized Loss Position, Less than 12 Months, Fair Value	$ 31,257	$ 31,052
Available-for-sale Securities, Continuous Unrealized Loss Position, Less than 12 Months, Unrealized Losses	(581)	(1,009)
Available-for-sale Securities, Continuous Unrealized Loss Position, Total Fair Value	31,257	31,052
Available-for-sale Securities, Continuous Unrealized Loss Position, Total Unrealized Losses	$ (581)	$ (1,009)
Corporate Securities
Schedule Of Available For Sale Securities [Line Items]
Available-for-sale Securities, Continuous Unrealized Loss Position, Number of Securities | Security	3	4
Available-for-sale Securities, Continuous Unrealized Loss Position, Less than 12 Months, Fair Value	$ 4,959	$ 5,097
Available-for-sale Securities, Continuous Unrealized Loss Position, Less than 12 Months, Unrealized Losses	(62)	(78)
Available-for-sale Securities, Continuous Unrealized Loss Position, 12 Months or Longer, Fair Value		2,522
Available-for-sale Securities, Continuous Unrealized Loss Position, 12 Months or Longer, Unrealized Losses		(8)
Available-for-sale Securities, Continuous Unrealized Loss Position, Total Fair Value	4,959	7,619
Available-for-sale Securities, Continuous Unrealized Loss Position, Total Unrealized Losses	$ (62)	$ (86)
Other Securities
Schedule Of Available For Sale Securities [Line Items]
Available-for-sale Securities, Continuous Unrealized Loss Position, Number of Securities | Security	1	1
Available-for-sale Securities, Continuous Unrealized Loss Position, 12 Months or Longer, Fair Value	$ 1,938	$ 1,994
Available-for-sale Securities, Continuous Unrealized Loss Position, 12 Months or Longer, Unrealized Losses	(56)	(56)
Available-for-sale Securities, Continuous Unrealized Loss Position, Total Fair Value	1,938	1,994
Available-for-sale Securities, Continuous Unrealized Loss Position, Total Unrealized Losses	$ (56)	$ (56)

XML

Securities - Summary of Gross Unrealized Losses and Fair Values, Aggregated by Investment Category and Length of Individual Securities Continuous Unrealized Loss Position Held-to-maturity (Details) $ in Thousands	9 Months Ended	12 Months Ended
	Sep. 30, 2017 USD ($) Security	Dec. 31, 2016 USD ($) Security
Schedule Of Held To Maturity Securities [Line Items]
Held-to-maturity Securities, Continuous Unrealized Loss Position, Number of Securities | Security	19	42
Held-to-maturity Securities, Continuous Unrealized Loss Position, Less than 12 Months, Fair Value	$ 29,710	$ 97,636
Held-to-maturity Securities, Continuous Unrealized Loss Position, Less than 12 Months, Unrealized Losses	(143)	(954)
Held-to-maturity Securities, Continuous Unrealized Loss Position, Total Fair Value	29,710	97,636
Held-to-maturity Securities, Continuous Unrealized Loss Position, Total Unrealized Losses	$ (143)	$ (954)
Obligations of States, Municipalities, and Political Subdivisions
Schedule Of Held To Maturity Securities [Line Items]
Held-to-maturity Securities, Continuous Unrealized Loss Position, Number of Securities | Security	7	22
Held-to-maturity Securities, Continuous Unrealized Loss Position, Less than 12 Months, Fair Value	$ 4,855	$ 16,235
Held-to-maturity Securities, Continuous Unrealized Loss Position, Less than 12 Months, Unrealized Losses	(36)	(229)
Held-to-maturity Securities, Continuous Unrealized Loss Position, Total Fair Value	4,855	16,235
Held-to-maturity Securities, Continuous Unrealized Loss Position, Total Unrealized Losses	$ (36)	$ (229)
Agency, Residential Mortgage-Backed Securities
Schedule Of Held To Maturity Securities [Line Items]
Held-to-maturity Securities, Continuous Unrealized Loss Position, Number of Securities | Security	9	15
Held-to-maturity Securities, Continuous Unrealized Loss Position, Less than 12 Months, Fair Value	$ 20,287	$ 52,156
Held-to-maturity Securities, Continuous Unrealized Loss Position, Less than 12 Months, Unrealized Losses	(82)	(283)
Held-to-maturity Securities, Continuous Unrealized Loss Position, Total Fair Value	20,287	52,156
Held-to-maturity Securities, Continuous Unrealized Loss Position, Total Unrealized Losses	$ (82)	$ (283)
Non-Agency, Residential Mortgage-Backed Securities
Schedule Of Held To Maturity Securities [Line Items]
Held-to-maturity Securities, Continuous Unrealized Loss Position, Number of Securities | Security	3	5
Held-to-maturity Securities, Continuous Unrealized Loss Position, Less than 12 Months, Fair Value	$ 4,568	$ 29,245
Held-to-maturity Securities, Continuous Unrealized Loss Position, Less than 12 Months, Unrealized Losses	(25)	(442)
Held-to-maturity Securities, Continuous Unrealized Loss Position, Total Fair Value	4,568	29,245
Held-to-maturity Securities, Continuous Unrealized Loss Position, Total Unrealized Losses	$ (25)	$ (442)

XML

Securities - Summary of Proceeds From Sales of Securities Available-for-sale and Associated Gains and Losses (Details) - USD ($) $ in Thousands	3 Months Ended	9 Months Ended
	Sep. 30, 2016	Sep. 30, 2017	Sep. 30, 2016
Available For Sale Securities Gross Realized Gain Loss [Abstract]
Proceeds	$ 107,949	$ 8	$ 507,362
Gross gains	912	$ 8	3,341
Gross losses	$ (110)		$ (110)

XML

Securities - Schedule of Amortized Cost and Fair Value of Debt Securities by Contractual Maturity (Details) - USD ($) $ in Thousands	Sep. 30, 2017	Dec. 31, 2016
Available-for-sale Securities Debt Maturities, Amortized Cost [Abstract]
Available-for-sale Securities, Due in one year or less, Amortized Cost	$ 5,289
Available-for-sale Securities, Due from one to five years, Amortized Cost	70,097
Available-for-sale Securities, Due from five to ten years, Amortized Cost	42,448
Available-for-sale Securities, Due after ten years, Amortized Cost	11,807
Available-for-sale Securities, Amortized Cost	591,806	$ 620,594
Held-to-maturity Securities Debt Maturities, Amortized Cost [Abstract]
Held-to-maturity Securities, Due from one to five years, Amortized Cost	524
Held-to-maturity Securities, Due from five to ten years, Amortized Cost	13,735
Held-to-maturity Securities, Due after ten years, Amortized Cost	9,819
Held-to-maturity Securities, Amortized Cost	121,453	138,846
Available-for-sale Securities Debt Maturities, Fair Value [Abstract]
Available-for-sale Securities, Due in one year or less, Fair Value	5,287
Available-for-sale Securities, Due from one to five years, Fair Value	69,824
Available-for-sale Securities, Due from five to ten years, Fair Value	42,006
Available-for-sale Securities, Due after ten years, Fair Value	11,625
Total	584,684	608,560
Held-to-maturity Securities Debt Maturities, Fair Value [Abstract]
Held-to-maturity Securities, Due from one to five years, Fair Value	528
Held-to-maturity Securities, Due from five to ten years, Fair Value	13,835
Held-to-maturity Securities, Due after ten years, Fair Value	9,996
Total	122,266	138,082
Mortgage-Backed Securities
Available-for-sale Securities Debt Maturities, Amortized Cost [Abstract]
Available-for-sale Securities, Not due at single maturity, Amortized Cost	459,239
Held-to-maturity Securities Debt Maturities, Amortized Cost [Abstract]
Held-to-maturity Securities, Mortgage-backed securities, Amortized Cost	97,375
Available-for-sale Securities Debt Maturities, Fair Value [Abstract]
Available-for-sale Securities, Not due at single maturity, Fair Value	451,524
Held-to-maturity Securities Debt Maturities, Fair Value [Abstract]
Held-to-maturity Securities, Mortgage-backed securities, Fair Value	97,907
Other Securities With No Defined Maturity
Available-for-sale Securities Debt Maturities, Amortized Cost [Abstract]
Available-for-sale Securities, Not due at single maturity, Amortized Cost	2,926
Available-for-sale Securities, Amortized Cost	3,626	4,161
Available-for-sale Securities Debt Maturities, Fair Value [Abstract]
Available-for-sale Securities, Not due at single maturity, Fair Value	4,418
Total	$ 4,957	$ 4,847

XML

Loan and Lease Receivables - Schedule of Outstanding Loan and Lease Receivables (Details) - USD ($) $ in Thousands	Sep. 30, 2017	Jun. 30, 2017	Dec. 31, 2016	Sep. 30, 2016	Jun. 30, 2016	Dec. 31, 2015
Accounts Notes And Loans Receivable [Line Items]
Total loans and leases	$ 2,214,956		$ 2,147,163
Net unamortized deferred fees and costs	(1,874)		(2,119)
Initial direct costs	3,417		2,967
Allowance for loan and lease losses	(15,980)	$ (13,969)	(10,923)	$ (6,501)	$ (6,490)	$ (7,632)
Net loans and leases	2,200,519		2,137,088
Lease financing receivables
Net minimum lease payments	183,035		168,345
Unguaranteed residual values	1,580		1,787
Unearned income	(15,691)		(14,133)
Total lease financing receivables	168,924		155,999
Initial direct costs	3,417		2,967
Lease financial receivables before allowance for lease losses	172,341		158,966
Commercial Real Estate
Accounts Notes And Loans Receivable [Line Items]
Total loans and leases	862,523		796,950
Allowance for loan and lease losses	(5,059)	(3,668)	(1,945)	(1,068)	(2,119)	(2,280)
Residential Real Estate
Accounts Notes And Loans Receivable [Line Items]
Total loans and leases	582,569		610,699
Allowance for loan and lease losses	(1,726)	(1,835)	(2,483)	(1,369)	(1,303)	(2,981)
Construction, Land Development, and Other Land
Accounts Notes And Loans Receivable [Line Items]
Total loans and leases	94,639		141,122
Allowance for loan and lease losses	(216)	(327)	(742)	(460)	(489)	(232)
Commercial and Industrial
Accounts Notes And Loans Receivable [Line Items]
Total loans and leases	503,093		439,476
Allowance for loan and lease losses	(6,366)	(5,689)	(4,196)	(2,094)	(1,472)	(1,403)
Installment and Other
Accounts Notes And Loans Receivable [Line Items]
Total loans and leases	3,208		2,917
Allowance for loan and lease losses	(30)	(344)	(334)	(355)	(367)	(357)
Lease Financing Receivables
Accounts Notes And Loans Receivable [Line Items]
Total loans and leases	168,924		155,999
Allowance for loan and lease losses	$ (2,583)	$ (2,106)	$ (1,223)	$ (1,155)	$ (740)	$ (379)

XML

Loan and Lease Receivables - Additional Information (Details) - USD ($)	Sep. 30, 2017	Jun. 30, 2017	Dec. 31, 2016	Sep. 30, 2016	Jun. 30, 2016	Dec. 31, 2015
Accounts Notes And Loans Receivable [Line Items]
Total loans and leases	$ 2,214,956,000		$ 2,147,163,000
Loans held for sale pledged as security for borrowings	530,300,000		507,200,000
Allowance for loan and lease losses	15,980,000	$ 13,969,000	10,923,000	$ 6,501,000	$ 6,490,000	$ 7,632,000
Acquired Impaired Loans
Accounts Notes And Loans Receivable [Line Items]
Allowance for loan and lease losses	3,800,000		1,600,000
Installment and Other
Accounts Notes And Loans Receivable [Line Items]
Total loans and leases	3,208,000		2,917,000
Overdraft deposits reclassified as loans	483,000		1,000,000
Allowance for loan and lease losses	30,000	$ 344,000	334,000	$ 355,000	$ 367,000	$ 357,000
U.S. Government Guaranteed Loans
Accounts Notes And Loans Receivable [Line Items]
Total loans and leases	$ 51,900,000		$ 34,800,000

XML

Loan and Lease Receivables - Summary of Minimum Annual Lease Payments for Lease Financing Receivables (Details) $ in Thousands	Sep. 30, 2017 USD ($)
Receivables [Abstract]
2017	$ 15,345
2018	62,718
2019	48,463
2020	32,863
2021	17,699
Thereafter	5,947
Total	$ 183,035

XML

Loan and Lease Receivables - Summary of Balances for Each Respective Loan and Lease Category (Details) - USD ($) $ in Thousands	Sep. 30, 2017	Dec. 31, 2016	Sep. 30, 2016
Accounts Notes And Loans Receivable [Line Items]
Total loans and leases	$ 2,216,499	$ 2,148,011	$ 1,717,509
Originated
Accounts Notes And Loans Receivable [Line Items]
Total loans and leases	1,473,998	1,281,888
Acquired Impaired
Accounts Notes And Loans Receivable [Line Items]
Total loans and leases	342,600	404,037
Acquired Non-Impaired
Accounts Notes And Loans Receivable [Line Items]
Total loans and leases	399,901	462,086
Commercial Real Estate
Accounts Notes And Loans Receivable [Line Items]
Total loans and leases	861,885	796,344	570,823
Commercial Real Estate | Originated
Accounts Notes And Loans Receivable [Line Items]
Total loans and leases	463,020	338,752
Commercial Real Estate | Acquired Impaired
Accounts Notes And Loans Receivable [Line Items]
Total loans and leases	173,106	207,303
Commercial Real Estate | Acquired Non-Impaired
Accounts Notes And Loans Receivable [Line Items]
Total loans and leases	225,759	250,289
Residential Real Estate
Accounts Notes And Loans Receivable [Line Items]
Total loans and leases	582,662	610,738	626,978
Residential Real Estate | Originated
Accounts Notes And Loans Receivable [Line Items]
Total loans and leases	398,062	394,168
Residential Real Estate | Acquired Impaired
Accounts Notes And Loans Receivable [Line Items]
Total loans and leases	152,149	175,717
Residential Real Estate | Acquired Non-Impaired
Accounts Notes And Loans Receivable [Line Items]
Total loans and leases	32,451	40,853
Construction, Land Development, and Other Land
Accounts Notes And Loans Receivable [Line Items]
Total loans and leases	94,304	140,766	111,908
Construction, Land Development, and Other Land | Originated
Accounts Notes And Loans Receivable [Line Items]
Total loans and leases	85,666	119,357
Construction, Land Development, and Other Land | Acquired Impaired
Accounts Notes And Loans Receivable [Line Items]
Total loans and leases	5,424	6,979
Construction, Land Development, and Other Land | Acquired Non-Impaired
Accounts Notes And Loans Receivable [Line Items]
Total loans and leases	3,214	14,430
Commercial and Industrial
Accounts Notes And Loans Receivable [Line Items]
Total loans and leases	502,055	438,238	251,270
Commercial and Industrial | Originated
Accounts Notes And Loans Receivable [Line Items]
Total loans and leases	390,331	309,097
Commercial and Industrial | Acquired Impaired
Accounts Notes And Loans Receivable [Line Items]
Total loans and leases	11,433	13,464
Commercial and Industrial | Acquired Non-Impaired
Accounts Notes And Loans Receivable [Line Items]
Total loans and leases	100,291	115,677
Installment and Other
Accounts Notes And Loans Receivable [Line Items]
Total loans and leases	3,252	2,959	1,973
Installment and Other | Originated
Accounts Notes And Loans Receivable [Line Items]
Total loans and leases	2,726	2,021
Installment and Other | Acquired Impaired
Accounts Notes And Loans Receivable [Line Items]
Total loans and leases	488	574
Installment and Other | Acquired Non-Impaired
Accounts Notes And Loans Receivable [Line Items]
Total loans and leases	38	364
Lease Financing Receivables
Accounts Notes And Loans Receivable [Line Items]
Total loans and leases	172,341	158,966	$ 154,557
Lease Financing Receivables | Originated
Accounts Notes And Loans Receivable [Line Items]
Total loans and leases	134,193	118,493
Lease Financing Receivables | Acquired Non-Impaired
Accounts Notes And Loans Receivable [Line Items]
Total loans and leases	$ 38,148	$ 40,473

XML

Loan and Lease Receivables - Summary of Outstanding Balance and Carrying Amount of All Acquired Impaired Loans (Details) - Acquired Impaired Loans - USD ($) $ in Thousands	Sep. 30, 2017	Dec. 31, 2016
Accounts Notes And Loans Receivable [Line Items]
Outstanding Balance	$ 495,925	$ 555,709
Carrying Value	342,600	404,037
Commercial Real Estate
Accounts Notes And Loans Receivable [Line Items]
Outstanding Balance	245,182	278,893
Carrying Value	173,106	207,303
Residential Real Estate
Accounts Notes And Loans Receivable [Line Items]
Outstanding Balance	215,135	236,384
Carrying Value	152,149	175,717
Construction, Land Development, and Other Land
Accounts Notes And Loans Receivable [Line Items]
Outstanding Balance	13,511	15,292
Carrying Value	5,424	6,979
Commercial and Industrial
Accounts Notes And Loans Receivable [Line Items]
Outstanding Balance	20,255	23,164
Carrying Value	11,433	13,464
Installment and Other
Accounts Notes And Loans Receivable [Line Items]
Outstanding Balance	1,842	1,976
Carrying Value	$ 488	$ 574

XML

Loan and Lease Receivables - Summary of Changes in Accretable Yield for Acquired Impaired Loans (Details) - USD ($) $ in Thousands	3 Months Ended		9 Months Ended
	Sep. 30, 2017	Sep. 30, 2016	Sep. 30, 2017	Sep. 30, 2016
Receivables [Abstract]
Beginning balance	$ 37,619	$ 35,663	$ 36,868	$ 43,915
Accretion to interest income	(8,165)	(5,859)	(24,768)	(20,071)
Reclassification from nonaccretable difference	6,901	1,777	24,255	7,737
Ending balance	$ 36,355	$ 31,581	$ 36,355	$ 31,581

XML

Loan and Lease Receivables - Schedule of Unpaid Principal Balance and Carrying Value for Acquired Non-impaired Loans and Leases (Details) - USD ($) $ in Thousands	Sep. 30, 2017	Dec. 31, 2016	Sep. 30, 2016
Accounts Notes And Loans Receivable [Line Items]
Loans and leases	$ 2,216,499	$ 2,148,011	$ 1,717,509
Acquired Non-impaired Loans and Leases
Accounts Notes And Loans Receivable [Line Items]
Unpaid Principal Balance	418,849	481,369
Loans and leases	399,901	462,086
Commercial Real Estate
Accounts Notes And Loans Receivable [Line Items]
Loans and leases	861,885	796,344	570,823
Commercial Real Estate | Acquired Non-impaired Loans and Leases
Accounts Notes And Loans Receivable [Line Items]
Unpaid Principal Balance	232,016	259,055
Loans and leases	225,759	250,289
Residential Real Estate
Accounts Notes And Loans Receivable [Line Items]
Loans and leases	582,662	610,738	626,978
Residential Real Estate | Acquired Non-impaired Loans and Leases
Accounts Notes And Loans Receivable [Line Items]
Unpaid Principal Balance	32,984	41,282
Loans and leases	32,451	40,853
Construction, Land Development, and Other Land
Accounts Notes And Loans Receivable [Line Items]
Loans and leases	94,304	140,766	111,908
Construction, Land Development, and Other Land | Acquired Non-impaired Loans and Leases
Accounts Notes And Loans Receivable [Line Items]
Unpaid Principal Balance	3,277	14,619
Loans and leases	3,214	14,430
Commercial and Industrial
Accounts Notes And Loans Receivable [Line Items]
Loans and leases	502,055	438,238	251,270
Commercial and Industrial | Acquired Non-impaired Loans and Leases
Accounts Notes And Loans Receivable [Line Items]
Unpaid Principal Balance	111,167	125,806
Loans and leases	100,291	115,677
Installment and Other
Accounts Notes And Loans Receivable [Line Items]
Loans and leases	3,252	2,959	1,973
Installment and Other | Acquired Non-impaired Loans and Leases
Accounts Notes And Loans Receivable [Line Items]
Unpaid Principal Balance	352	402
Loans and leases	38	364
Lease Financing Receivables
Accounts Notes And Loans Receivable [Line Items]
Loans and leases	172,341	158,966	$ 154,557
Lease Financing Receivables | Acquired Non-impaired Loans and Leases
Accounts Notes And Loans Receivable [Line Items]
Unpaid Principal Balance	39,053	40,205
Loans and leases	$ 38,148	$ 40,473

XML

Allowance for Loan and Lease Losses and Reserve for Unfunded Commitments - Summary of Allowance for Loan and Lease Losses and Corresponding Loan and Lease Balances (Details) - USD ($) $ in Thousands	3 Months Ended		9 Months Ended
	Sep. 30, 2017	Sep. 30, 2016	Sep. 30, 2017	Sep. 30, 2016	Sep. 30, 2017	Dec. 31, 2016	Sep. 30, 2016
Allowance for loan and lease losses
Beginning balance	$ 13,969	$ 6,490	$ 10,923	$ 7,632
Provisions	3,900	1,683	9,306	5,348
Charge-offs	(2,299)	(1,830)	(5,322)	(7,010)
Recoveries	410	158	1,073	531
Ending balance	15,980	6,501	15,980	6,501
Ending balance:
Individually evaluated for impairment					$ 2,949		$ 859
Collectively evaluated for impairment					9,218		4,036
Allowance for loan and lease losses	15,980	6,490	15,980	6,501	15,980	$ 10,923	6,501
Loans and leases ending balance:
Individually evaluated for impairment					23,518		9,447
Collectively evaluated for impairment					1,850,381		1,320,083
Total loans and leases					2,216,499	2,148,011	1,717,509
Receivables Acquired with Deteriorated Credit Quality
Ending balance:
Loans acquired with deteriorated credit quality					3,813		1,606
Loans and leases ending balance:
Loans acquired with deteriorated credit quality					342,600		387,979
Commercial Real Estate
Allowance for loan and lease losses
Beginning balance	3,668	2,119	1,945	2,280
Provisions	1,577	27	3,591	3,050
Charge-offs	(186)	(1,078)	(477)	(4,262)
Ending balance	5,059	1,068	5,059	1,068
Ending balance:
Individually evaluated for impairment					1,186
Collectively evaluated for impairment					1,844		669
Allowance for loan and lease losses	3,668	2,119	5,059	1,068	5,059	1,945	1,068
Loans and leases ending balance:
Individually evaluated for impairment					14,928		6,374
Collectively evaluated for impairment					673,851		377,090
Total loans and leases					861,885	796,344	570,823
Commercial Real Estate | Receivables Acquired with Deteriorated Credit Quality
Ending balance:
Loans acquired with deteriorated credit quality					2,029		399
Loans and leases ending balance:
Loans acquired with deteriorated credit quality					173,106		187,359
Residential Real Estate
Allowance for loan and lease losses
Beginning balance	1,835	1,303	2,483	2,981
Provisions	52	41	(400)	(980)
Charge-offs	(161)	25	(357)	(632)
Ending balance	1,726	1,369	1,726	1,369
Ending balance:
Individually evaluated for impairment					176		339
Collectively evaluated for impairment					1,237		534
Allowance for loan and lease losses	1,835	1,303	1,726	1,369	1,726	2,483	1,369
Loans and leases ending balance:
Individually evaluated for impairment					1,948		2,553
Collectively evaluated for impairment					428,565		438,446
Total loans and leases					582,662	610,738	626,978
Residential Real Estate | Receivables Acquired with Deteriorated Credit Quality
Ending balance:
Loans acquired with deteriorated credit quality					313		496
Loans and leases ending balance:
Loans acquired with deteriorated credit quality					152,149		185,979
Construction, Land Development, and Other Land
Allowance for loan and lease losses
Beginning balance	327	489	742	232
Provisions	(111)	66	(526)	323
Charge-offs		(95)		(95)
Ending balance	216	460	216	460
Ending balance:
Collectively evaluated for impairment					155		413
Allowance for loan and lease losses	327	489	216	460	216	742	460
Loans and leases ending balance:
Individually evaluated for impairment					565
Collectively evaluated for impairment					88,315		104,369
Total loans and leases					94,304	140,766	111,908
Construction, Land Development, and Other Land | Receivables Acquired with Deteriorated Credit Quality
Ending balance:
Loans acquired with deteriorated credit quality					61		47
Loans and leases ending balance:
Loans acquired with deteriorated credit quality					5,424		7,539
Commercial and Industrial
Allowance for loan and lease losses
Beginning balance	5,689	1,472	4,196	1,403
Provisions	1,440	624	3,932	768
Charge-offs	(763)	(2)	(1,762)	(77)
Ending balance	6,366	2,094	6,366	2,094
Ending balance:
Individually evaluated for impairment					1,585		192
Collectively evaluated for impairment					3,389		1,264
Allowance for loan and lease losses	5,689	1,472	6,366	2,094	6,366	4,196	2,094
Loans and leases ending balance:
Individually evaluated for impairment					6,075		192
Collectively evaluated for impairment					484,547		244,566
Total loans and leases					502,055	438,238	251,270
Commercial and Industrial | Receivables Acquired with Deteriorated Credit Quality
Ending balance:
Loans acquired with deteriorated credit quality					1,392		638
Loans and leases ending balance:
Loans acquired with deteriorated credit quality					11,433		6,512
Installment and Other
Allowance for loan and lease losses
Beginning balance	344	367	334	357
Provisions	13	(3)	23	8
Charge-offs	(327)	(9)	(327)	(10)
Ending balance	30	355	30	355
Ending balance:
Individually evaluated for impairment					2		328
Collectively evaluated for impairment					10		1
Allowance for loan and lease losses	344	367	30	355	30	334	355
Loans and leases ending balance:
Individually evaluated for impairment					2		328
Collectively evaluated for impairment					2,762		1,055
Total loans and leases					3,252	2,959	1,973
Installment and Other | Receivables Acquired with Deteriorated Credit Quality
Ending balance:
Loans acquired with deteriorated credit quality					18		26
Loans and leases ending balance:
Loans acquired with deteriorated credit quality					488		590
Lease Financing Receivables
Allowance for loan and lease losses
Beginning balance	2,106	740	1,223	379
Provisions	929	928	2,686	2,179
Charge-offs	(862)	(671)	(2,399)	(1,934)
Recoveries	410	158	1,073	531
Ending balance	2,583	1,155	2,583	1,155
Ending balance:
Collectively evaluated for impairment					2,583		1,155
Allowance for loan and lease losses	$ 2,106	$ 740	$ 2,583	$ 1,155	2,583	1,223	1,155
Loans and leases ending balance:
Collectively evaluated for impairment					172,341		154,557
Total loans and leases					$ 172,341	$ 158,966	$ 154,557

XML

Allowance for Loan and Lease Losses and Reserve for Unfunded Commitments - Additional Information (Details)	3 Months Ended		9 Months Ended		12 Months Ended
	Sep. 30, 2017 USD ($) Loan	Sep. 30, 2016 USD ($)	Sep. 30, 2017 USD ($) Loan	Sep. 30, 2016 USD ($)	Dec. 31, 2016 USD ($)
Loans And Leases Receivable Disclosure [Line Items]
Increase (decrease) in allowance for loan and lease losses	$ 2,000,000	$ 11,000	$ 5,100,000	$ (1,100,000)
Recorded investment in troubled debt restructurings	2,300,000		2,300,000		$ 1,200,000
Commitments outstanding on troubled debt restructurings	0		0		0
Recorded investment in troubled debt restructurings that subsequently defaulted within twelve months	$ 0		$ 0		477,000
Number of loans modified under troubled debt restructuring | Loan	867,000		2,100,000
Reserve for unfunded commitments	$ 1,000,000		$ 1,000,000		760,000
Provisions for unfunded commitments			272,000	56,000
Charge-offs or recoveries related to reserve for unfunded commitments			0		$ 0
Acquired Impaired Loans
Loans And Leases Receivable Disclosure [Line Items]
Increase (decrease) in allowance for loan and lease losses	$ 559,000	$ 8,000	$ 2,200,000	$ (1,700,000)

XML

Allowance for Loan and Lease Losses and Reserve for Unfunded Commitments - Summary of Recorded Investment, Unpaid Principal Balance, and Related Allowance for Loans and Leases Considered Impaired (Details) - Loans Excluding Acquired Impaired Loans - USD ($) $ in Thousands	Sep. 30, 2017	Dec. 31, 2016
Financing Receivable Impaired [Line Items]
Recorded Investment	$ 23,518	$ 11,926
Unpaid Principal Balance	26,107	13,783
Related Allowance	2,949	1,017
Commercial Real Estate
Financing Receivable Impaired [Line Items]
Recorded Investment, With no related allowance recorded	9,541	8,916
Recorded Investment, With an allowance recorded	5,387
Unpaid Principal Balance, With no related allowance recorded	10,149	9,502
Unpaid Principal Balance, With an allowance recorded	5,521
Related Allowance	1,186
Residential Real Estate
Financing Receivable Impaired [Line Items]
Recorded Investment, With no related allowance recorded	1,581	804
Recorded Investment, With an allowance recorded	367	496
Unpaid Principal Balance, With no related allowance recorded	2,589	1,999
Unpaid Principal Balance, With an allowance recorded	387	528
Related Allowance	176	293
Construction, Land Development, and Other Land
Financing Receivable Impaired [Line Items]
Recorded Investment, With no related allowance recorded	565
Unpaid Principal Balance, With no related allowance recorded	565
Commercial and Industrial
Financing Receivable Impaired [Line Items]
Recorded Investment, With no related allowance recorded	3,465	521
Recorded Investment, With an allowance recorded	2,610	861
Unpaid Principal Balance, With no related allowance recorded	3,652	524
Unpaid Principal Balance, With an allowance recorded	2,934	869
Related Allowance	1,585	396
Installment and Other
Financing Receivable Impaired [Line Items]
Recorded Investment, With an allowance recorded	2	328
Unpaid Principal Balance, With an allowance recorded	310	361
Related Allowance	$ 2	$ 328

XML

Allowance for Loan and Lease Losses and Reserve for Unfunded Commitments - Summary of Average Recorded Investment and Interest Income Recognized for Loans and Leases Considered Impaired (Details) - Loans Excluding Acquired Impaired Loans - USD ($) $ in Thousands	6 Months Ended	9 Months Ended
	Jun. 30, 2016	Sep. 30, 2017	Sep. 30, 2016
Financing Receivable Impaired [Line Items]
Average Recorded Investment		$ 18,355	$ 8,337
Interest Income Recognized	$ 192	1,509
Commercial Real Estate
Financing Receivable Impaired [Line Items]
Average Recorded Investment, With no related allowance recorded		10,605	4,129
Average Recorded Investment, With an allowance recorded		1,043	2,099
Interest Income Recognized, With no related allowance recorded	128	419
Interest Income Recognized, With an allowance recorded		287
Residential Real Estate
Financing Receivable Impaired [Line Items]
Average Recorded Investment, With no related allowance recorded		1,698	2,479
Average Recorded Investment, With an allowance recorded		444	727
Interest Income Recognized, With no related allowance recorded	65	33
Interest Income Recognized, With an allowance recorded	7	4
Construction, Land Development, and Other Land
Financing Receivable Impaired [Line Items]
Average Recorded Investment, With no related allowance recorded		269	96
Average Recorded Investment, With an allowance recorded		19	156
Interest Income Recognized, With no related allowance recorded		2
Commercial and Industrial
Financing Receivable Impaired [Line Items]
Average Recorded Investment, With no related allowance recorded		2,391	12
Average Recorded Investment, With an allowance recorded		1,673	171
Interest Income Recognized, With no related allowance recorded		253
Interest Income Recognized, With an allowance recorded	2	500
Installment and Other
Financing Receivable Impaired [Line Items]
Average Recorded Investment, With an allowance recorded		213	$ 328
Interest Income Recognized, With an allowance recorded	$ 11	$ 11

XML

Allowance for Loan and Lease Losses and Reserve for Unfunded Commitments - Summary of Risk Rating Categories of Loans and Leases Considered for Inclusion in Allowance for Loan and Lease Losses Calculation (Details) - USD ($) $ in Thousands	Sep. 30, 2017	Dec. 31, 2016	Sep. 30, 2016
Financing Receivable Recorded Investment [Line Items]
Total loans and leases	$ 2,216,499	$ 2,148,011	$ 1,717,509
Commercial Real Estate
Financing Receivable Recorded Investment [Line Items]
Total loans and leases	861,885	796,344	570,823
Residential Real Estate
Financing Receivable Recorded Investment [Line Items]
Total loans and leases	582,662	610,738	626,978
Construction, Land Development, and Other Land
Financing Receivable Recorded Investment [Line Items]
Total loans and leases	94,304	140,766	111,908
Commercial and Industrial
Financing Receivable Recorded Investment [Line Items]
Total loans and leases	502,055	438,238	251,270
Installment and Other
Financing Receivable Recorded Investment [Line Items]
Total loans and leases	3,252	2,959	1,973
Lease Financing Receivables
Financing Receivable Recorded Investment [Line Items]
Total loans and leases	172,341	158,966	$ 154,557
Loans Excluding Acquired Impaired Loans
Financing Receivable Recorded Investment [Line Items]
Total loans and leases	1,873,899	1,743,974
Loans Excluding Acquired Impaired Loans | Commercial Real Estate
Financing Receivable Recorded Investment [Line Items]
Total loans and leases	688,779	589,041
Loans Excluding Acquired Impaired Loans | Residential Real Estate
Financing Receivable Recorded Investment [Line Items]
Total loans and leases	430,513	435,021
Loans Excluding Acquired Impaired Loans | Construction, Land Development, and Other Land
Financing Receivable Recorded Investment [Line Items]
Total loans and leases	88,880	133,787
Loans Excluding Acquired Impaired Loans | Commercial and Industrial
Financing Receivable Recorded Investment [Line Items]
Total loans and leases	490,622	424,774
Loans Excluding Acquired Impaired Loans | Installment and Other
Financing Receivable Recorded Investment [Line Items]
Total loans and leases	2,764	2,385
Loans Excluding Acquired Impaired Loans | Lease Financing Receivables
Financing Receivable Recorded Investment [Line Items]
Total loans and leases	172,341	158,966
Loans Excluding Acquired Impaired Loans | Pass
Financing Receivable Recorded Investment [Line Items]
Total loans and leases	1,685,960	1,614,595
Loans Excluding Acquired Impaired Loans | Pass | Commercial Real Estate
Financing Receivable Recorded Investment [Line Items]
Total loans and leases	617,061	536,499
Loans Excluding Acquired Impaired Loans | Pass | Residential Real Estate
Financing Receivable Recorded Investment [Line Items]
Total loans and leases	421,109	419,880
Loans Excluding Acquired Impaired Loans | Pass | Construction, Land Development, and Other Land
Financing Receivable Recorded Investment [Line Items]
Total loans and leases	73,781	129,732
Loans Excluding Acquired Impaired Loans | Pass | Commercial and Industrial
Financing Receivable Recorded Investment [Line Items]
Total loans and leases	400,838	369,136
Loans Excluding Acquired Impaired Loans | Pass | Installment and Other
Financing Receivable Recorded Investment [Line Items]
Total loans and leases	2,761	2,052
Loans Excluding Acquired Impaired Loans | Pass | Lease Financing Receivables
Financing Receivable Recorded Investment [Line Items]
Total loans and leases	170,410	157,296
Loans Excluding Acquired Impaired Loans | Watch
Financing Receivable Recorded Investment [Line Items]
Total loans and leases	133,060	105,689
Loans Excluding Acquired Impaired Loans | Watch | Commercial Real Estate
Financing Receivable Recorded Investment [Line Items]
Total loans and leases	44,273	38,707
Loans Excluding Acquired Impaired Loans | Watch | Residential Real Estate
Financing Receivable Recorded Investment [Line Items]
Total loans and leases	4,871	10,885
Loans Excluding Acquired Impaired Loans | Watch | Construction, Land Development, and Other Land
Financing Receivable Recorded Investment [Line Items]
Total loans and leases	11,947	2,897
Loans Excluding Acquired Impaired Loans | Watch | Commercial and Industrial
Financing Receivable Recorded Investment [Line Items]
Total loans and leases	71,752	52,872
Loans Excluding Acquired Impaired Loans | Watch | Installment and Other
Financing Receivable Recorded Investment [Line Items]
Total loans and leases	3	4
Loans Excluding Acquired Impaired Loans | Watch | Lease Financing Receivables
Financing Receivable Recorded Investment [Line Items]
Total loans and leases	214	324
Loans Excluding Acquired Impaired Loans | Special Mention
Financing Receivable Recorded Investment [Line Items]
Total loans and leases	28,056	11,422
Loans Excluding Acquired Impaired Loans | Special Mention | Commercial Real Estate
Financing Receivable Recorded Investment [Line Items]
Total loans and leases	11,958	5,377
Loans Excluding Acquired Impaired Loans | Special Mention | Residential Real Estate
Financing Receivable Recorded Investment [Line Items]
Total loans and leases	2,513	3,116
Loans Excluding Acquired Impaired Loans | Special Mention | Construction, Land Development, and Other Land
Financing Receivable Recorded Investment [Line Items]
Total loans and leases	2,587	1,158
Loans Excluding Acquired Impaired Loans | Special Mention | Commercial and Industrial
Financing Receivable Recorded Investment [Line Items]
Total loans and leases	10,104	1,258
Loans Excluding Acquired Impaired Loans | Special Mention | Installment and Other
Financing Receivable Recorded Investment [Line Items]
Total loans and leases		1
Loans Excluding Acquired Impaired Loans | Special Mention | Lease Financing Receivables
Financing Receivable Recorded Investment [Line Items]
Total loans and leases	894	512
Loans Excluding Acquired Impaired Loans | Substandard
Financing Receivable Recorded Investment [Line Items]
Total loans and leases	26,639	12,173
Loans Excluding Acquired Impaired Loans | Substandard | Commercial Real Estate
Financing Receivable Recorded Investment [Line Items]
Total loans and leases	15,487	8,458
Loans Excluding Acquired Impaired Loans | Substandard | Residential Real Estate
Financing Receivable Recorded Investment [Line Items]
Total loans and leases	2,020	1,140
Loans Excluding Acquired Impaired Loans | Substandard | Construction, Land Development, and Other Land
Financing Receivable Recorded Investment [Line Items]
Total loans and leases	565
Loans Excluding Acquired Impaired Loans | Substandard | Commercial and Industrial
Financing Receivable Recorded Investment [Line Items]
Total loans and leases	7,928	1,508
Loans Excluding Acquired Impaired Loans | Substandard | Installment and Other
Financing Receivable Recorded Investment [Line Items]
Total loans and leases		328
Loans Excluding Acquired Impaired Loans | Substandard | Lease Financing Receivables
Financing Receivable Recorded Investment [Line Items]
Total loans and leases	639	739
Loans Excluding Acquired Impaired Loans | Doubtful
Financing Receivable Recorded Investment [Line Items]
Total loans and leases	184	95
Loans Excluding Acquired Impaired Loans | Doubtful | Lease Financing Receivables
Financing Receivable Recorded Investment [Line Items]
Total loans and leases	$ 184	$ 95

XML

Allowance for Loan and Lease Losses and Reserve for Unfunded Commitments - Summary of Contractual Delinquency Information (Details) - USD ($) $ in Thousands	Sep. 30, 2017	Dec. 31, 2016	Sep. 30, 2016
Financing Receivable Recorded Investment Past Due [Line Items]
Total loans and leases	$ 2,216,499	$ 2,148,011	$ 1,717,509
Commercial Real Estate
Financing Receivable Recorded Investment Past Due [Line Items]
Total loans and leases	861,885	796,344	570,823
Residential Real Estate
Financing Receivable Recorded Investment Past Due [Line Items]
Total loans and leases	582,662	610,738	626,978
Construction, Land Development, and Other Land
Financing Receivable Recorded Investment Past Due [Line Items]
Total loans and leases	94,304	140,766	111,908
Commercial and Industrial
Financing Receivable Recorded Investment Past Due [Line Items]
Total loans and leases	502,055	438,238	251,270
Installment and Other
Financing Receivable Recorded Investment Past Due [Line Items]
Total loans and leases	3,252	2,959	1,973
Lease Financing Receivables
Financing Receivable Recorded Investment Past Due [Line Items]
Total loans and leases	172,341	158,966	$ 154,557
Acquired Non-Impaired and Originated Loans
Financing Receivable Recorded Investment Past Due [Line Items]
Total Past Due	20,273	20,882
Non-accrual	15,121	6,784
Current	1,853,626	1,723,092
Total loans and leases	1,873,899	1,743,974
Acquired Non-Impaired and Originated Loans | 30-59 Days Past Due
Financing Receivable Recorded Investment Past Due [Line Items]
Total Past Due	3,592	12,686
Acquired Non-Impaired and Originated Loans | 60-89 Days Past Due
Financing Receivable Recorded Investment Past Due [Line Items]
Total Past Due	1,560	1,412
Acquired Non-Impaired and Originated Loans | Commercial Real Estate
Financing Receivable Recorded Investment Past Due [Line Items]
Total Past Due	9,618	7,527
Non-accrual	8,672	3,935
Current	679,161	581,514
Total loans and leases	688,779	589,041
Acquired Non-Impaired and Originated Loans | Commercial Real Estate | 30-59 Days Past Due
Financing Receivable Recorded Investment Past Due [Line Items]
Total Past Due	350	2,944
Acquired Non-Impaired and Originated Loans | Commercial Real Estate | 60-89 Days Past Due
Financing Receivable Recorded Investment Past Due [Line Items]
Total Past Due	596	648
Acquired Non-Impaired and Originated Loans | Residential Real Estate
Financing Receivable Recorded Investment Past Due [Line Items]
Total Past Due	2,072	1,361
Non-accrual	1,852	1,118
Current	428,441	433,660
Total loans and leases	430,513	435,021
Acquired Non-Impaired and Originated Loans | Residential Real Estate | 30-59 Days Past Due
Financing Receivable Recorded Investment Past Due [Line Items]
Total Past Due		243
Acquired Non-Impaired and Originated Loans | Residential Real Estate | 60-89 Days Past Due
Financing Receivable Recorded Investment Past Due [Line Items]
Total Past Due	220
Acquired Non-Impaired and Originated Loans | Construction, Land Development, and Other Land
Financing Receivable Recorded Investment Past Due [Line Items]
Total Past Due	565	1,363
Non-accrual	565
Current	88,315	132,424
Total loans and leases	88,880	133,787
Acquired Non-Impaired and Originated Loans | Construction, Land Development, and Other Land | 30-59 Days Past Due
Financing Receivable Recorded Investment Past Due [Line Items]
Total Past Due		1,363
Acquired Non-Impaired and Originated Loans | Commercial and Industrial
Financing Receivable Recorded Investment Past Due [Line Items]
Total Past Due	6,198	7,398
Non-accrual	3,537	958
Current	484,424	417,376
Total loans and leases	490,622	424,774
Acquired Non-Impaired and Originated Loans | Commercial and Industrial | 30-59 Days Past Due
Financing Receivable Recorded Investment Past Due [Line Items]
Total Past Due	2,245	6,066
Acquired Non-Impaired and Originated Loans | Commercial and Industrial | 60-89 Days Past Due
Financing Receivable Recorded Investment Past Due [Line Items]
Total Past Due	416	374
Acquired Non-Impaired and Originated Loans | Installment and Other
Financing Receivable Recorded Investment Past Due [Line Items]
Total Past Due	2	328
Non-accrual		328
Current	2,762	2,057
Total loans and leases	2,764	2,385
Acquired Non-Impaired and Originated Loans | Installment and Other | 30-59 Days Past Due
Financing Receivable Recorded Investment Past Due [Line Items]
Total Past Due	2
Acquired Non-Impaired and Originated Loans | Lease Financing Receivables
Financing Receivable Recorded Investment Past Due [Line Items]
Total Past Due	1,818	2,905
Non-accrual	495	445
Current	170,523	156,061
Total loans and leases	172,341	158,966
Acquired Non-Impaired and Originated Loans | Lease Financing Receivables | 30-59 Days Past Due
Financing Receivable Recorded Investment Past Due [Line Items]
Total Past Due	995	2,070
Acquired Non-Impaired and Originated Loans | Lease Financing Receivables | 60-89 Days Past Due
Financing Receivable Recorded Investment Past Due [Line Items]
Total Past Due	$ 328	$ 390

XML

Servicing Assets - Unpaid Principal Balances of Loans Serviced for Others (Details) - USD ($) $ in Thousands	Sep. 30, 2017	Dec. 31, 2016
Loan portfolios serviced for:
Unpaid principal balances of loans serviced	$ 1,089,434	$ 1,017,928
SBA guaranteed loans
Loan portfolios serviced for:
Unpaid principal balances of loans serviced	1,001,845	911,803
USDA guaranteed loans
Loan portfolios serviced for:
Unpaid principal balances of loans serviced	$ 87,589	$ 106,125

XML

Servicing Assets - Activity for Servicing Assets and Related Changes in Fair Value (Details) $ in Thousands	9 Months Ended
	Sep. 30, 2017 USD ($)
Transfers And Servicing [Abstract]
Beginning balance	$ 21,091
Additions, net	4,675
Changes in fair value	(4,097)
Ending balance	$ 21,669

XML

Servicing Assets - Additional Information (Details) - USD ($) $ in Thousands	3 Months Ended	9 Months Ended
	Sep. 30, 2017	Sep. 30, 2017
Transfers And Servicing [Abstract]
Servicing fees	$ 959	$ 2,954

XML

Other Real Estate Owned - Change in Other Real Estate Owned (Details) - USD ($) $ in Thousands	9 Months Ended
	Sep. 30, 2017	Sep. 30, 2016
Banking And Thrift [Abstract]
Other real estate owned, beginning balance	$ 16,570	$ 26,715
Net additions to OREO	5,701	3,721
Proceeds from the sales of OREO	(9,583)	(15,392)
Net gains on sales of OREO	1,538	1,134
Valuation adjustments	(367)	(904)
Other real estate owned, ending balance	$ 13,859	$ 15,274

XML

Other Real Estate Owned - Additional Information (Details) - USD ($) $ in Millions	Sep. 30, 2017	Dec. 31, 2016
Banking And Thrift [Abstract]
Residential mortgage loans in process of foreclosure	$ 2.0	$ 2.7

XML

Goodwill, Core Deposit Intangible and Other Intangible Assets - Summary of Changes in Goodwill and Core Deposit Intangible Assets (Details) - USD ($) $ in Thousands	3 Months Ended		9 Months Ended
	Sep. 30, 2017	Sep. 30, 2016	Sep. 30, 2017	Sep. 30, 2016
Schedule Of Goodwill And Intangible Assets [Line Items]
Beginning balance, Goodwill			$ 51,975	$ 25,688
Ending balance, Goodwill	$ 51,975	$ 25,688	51,975	25,688
Amortization or accretion	(769)	(747)	(2,307)	(2,242)
Core Deposits
Schedule Of Goodwill And Intangible Assets [Line Items]
Beginning balance			19,776	22,275
Amortization or accretion			(2,293)	(2,228)
Ending balance	17,483	20,047	17,483	20,047
Accumulated amortization or accretion	$ 12,703	$ 9,653	$ 12,703	$ 9,653
Weighted average remaining amortization or accretion period			5 years 9 months 19 days	6 years 9 months 19 days

XML

Goodwill, Core Deposit Intangible and Other Intangible Assets - Additional Information (Details) - USD ($)	Sep. 30, 2017	Dec. 31, 2016
Indefinite Lived Intangible Assets By Major Class [Line Items]
Other intangible assets, net	$ 17,522,000	$ 19,826,000
Trademark
Indefinite Lived Intangible Assets By Major Class [Line Items]
Other intangible assets, net	$ 39,000	$ 50,000

XML

Goodwill, Core Deposit Intangible and Other Intangible Assets - Estimated Amortization Expense for Core Deposit Intangible and Other Intangible Assets Recognized (Details) $ in Thousands	Sep. 30, 2017 USD ($)
Goodwill And Intangible Assets Disclosure [Abstract]
2017	$ 767
2018	3,060
2019	3,050
2020	3,027
2021	3,017
Thereafter	4,601
Total	$ 17,522

XML

Income Taxes - Additional Information (Details) - USD ($) $ in Millions		3 Months Ended		6 Months Ended	9 Months Ended
	Jul. 01, 2017	Sep. 30, 2017	Dec. 31, 2016	Jun. 30, 2017	Sep. 30, 2017	Sep. 30, 2016
Income Tax [Line Items]
Effective tax rate					24.40%	(8.60%)
Reversal of valuation allowance on net deferred tax assets			$ 61.9
Increase (decrease) in deferred tax asset					$ (7.4)
Deferred tax assets, net		$ 60.4	$ 67.8		$ 60.4
Illinois | State
Income Tax [Line Items]
Corporate income tax rate	7.00%			5.25%
State income tax benefit due to increased value of deferred tax asset related to net loss deduction		$ 4.6

XML

Deposits - Schedule of Deposits - (Details) - USD ($) $ in Thousands	Sep. 30, 2017	Dec. 31, 2016
Deposits [Abstract]
Non-interest bearing demand deposits	$ 753,662	$ 724,457
Interest bearing checking accounts	187,232	173,929
Money market demand accounts	418,006	369,074
Other savings	435,536	446,418
Time deposits (below $100,000)	377,929	392,854
Time deposits ($100,000 and above)	348,564	383,662
Total deposits	$ 2,520,929	$ 2,490,394

XML

Deposits - Additional Information - (Details) - USD ($)	Sep. 30, 2017	Dec. 31, 2016
Deposits [Abstract]
Brokered deposits	$ 0	$ 30,800,000
Time deposits 250000 or more	$ 83,400,000	$ 117,400,000

XML

Federal Home Loan Bank Advances - Additional Information (Details) - USD ($)	9 Months Ended	12 Months Ended
	Sep. 30, 2017	Dec. 31, 2016
Federal Home Loan Bank Advances [Line Items]
Federal home loan bank advances, acquisition accounting adjustments	$ 72,000	$ 228,000
Additional borrowing capacity from FHLB	$ 913,000,000	647,900,000
Federal home loan bank advances maximum borrowing capacity as percentage of total assets	35.00%
Federal home loan bank, advances, putable option	$ 234,559,000	$ 313,715,000
Ridgestone
Federal Home Loan Bank Advances [Line Items]
Federal home loan bank, advances, putable option	$ 1,500,000
Minimum
Federal Home Loan Bank Advances [Line Items]
Federal home loan bank advances, Interest rate	1.24%
Federal home loan bank fixed fate advances, maturity date	2017-12
Maximum
Federal Home Loan Bank Advances [Line Items]
Federal home loan bank advances, Interest rate	3.22%
Federal home loan bank fixed fate advances, maturity date	2018-02

XML

Federal Home Loan Bank Advances - Summary of FHLB Advances Including Acquisition Accounting Adjustments Along with Weighted Average Costs and Scheduled Maturities (Details) - USD ($) $ in Thousands	Sep. 30, 2017	Dec. 31, 2016
Federal Home Loan Banks [Abstract]
Federal Home Loan Bank advances	$ 234,559	$ 313,715
Weighted average cost	1.32%	0.73%
2017	$ 225,000
2018	9,559
Total	$ 234,559	$ 313,715

XML

Other Borrowings - Summary of Other Borrowings (Details) - USD ($) $ in Thousands	Sep. 30, 2017	Dec. 31, 2016
Debt Disclosure [Abstract]
Securities sold under agreements to repurchase	$ 30,807	$ 17,249
Line of credit		20,650
Total	$ 30,807	$ 37,899

XML

Other Borrowings - Additional Information (Details) - USD ($)		1 Months Ended	9 Months Ended
	Oct. 12, 2017	Jul. 31, 2017	Sep. 30, 2017	Apr. 30, 2017	Dec. 31, 2016	Oct. 13, 2016
Line Of Credit Facility [Line Items]
Line of credit facility, amount					$ 20,650,000
Repayment of lines of credit		$ 16,200,000	$ 20,650,000
Short-term credit lines available for use, outstanding			$ 0		$ 0
Ridgestone | CIBC Bank USA | Credit agreement
Line Of Credit Facility [Line Items]
Line of credit facility, amount						$ 30,000,000
Line of credit facility, commitment fee payable						$ 300,000
Line of credit facility, maturity date			Oct. 12, 2017
Line of credit facility, interest rate			4.25%		3.75%
Ridgestone | CIBC Bank USA | Amended Credit Agreement
Line Of Credit Facility [Line Items]
Line of credit facility, revolving credit conversion to non-revolving line of credit, description			In April 2017, the revolving line of credit was amended to a non-revolving line of credit as long as the outstanding balance exceeds $5.0 million.
Line of credit facility, revolving credit conversion to non-revolving line of credit, threshold amount				$ 5,000,000
Threshold amount for conversion of line of credit into revolving line of credit				5,000,000
Revolving line of credit facility, maximum borrowing capacity				$ 5,000,000
Subsequent Event | Ridgestone | CIBC Bank USA | Amended Credit Agreement
Line Of Credit Facility [Line Items]
Line of credit facility, extended maturity date	Oct. 11, 2018
Line of credit facility, interest rate terms	The amended revolving line of credit bears interest at either the LIBOR Rate plus 250 basis points or the Prime Rate minus 25 basis points, based on the Company’s election, which is required to be communicated to CIBC at least three business days prior to the commencement of an interest period. If the Company fails to provide timely notification, the interest rate will be Prime Rate minus 25 basis points.
Subsequent Event | Ridgestone | CIBC Bank USA | Amended Credit Agreement | LIBOR Rate
Line Of Credit Facility [Line Items]
Interest rate spread	2.50%
Subsequent Event | Ridgestone | CIBC Bank USA | Amended Credit Agreement | Prime Rate
Line Of Credit Facility [Line Items]
Interest rate spread	0.25%

XML

Other Borrowings - Summary of Short-term Credit Lines Available for Use (Details) - USD ($) $ in Thousands	Sep. 30, 2017	Dec. 31, 2016
Federal Reserve Bank of Chicago Discount Window Line
Debt Instrument [Line Items]
Short-term credit lines available for use	$ 135,278	$ 110,600
Available Federal Funds Line
Debt Instrument [Line Items]
Short-term credit lines available for use	$ 40,000	$ 20,000

XML

Junior Subordinated Debentures - Junior Subordinated Debentures by Issuance (Details) - USD ($) $ in Thousands	9 Months Ended
	Sep. 30, 2017	Dec. 31, 2016
Shares Subject To Mandatory Redemption By Settlement Terms [Line Items]
Total liability, at par	$ 36,500	$ 36,500
Total liability, at carrying value	27,482	26,926
Metropolitan Statutory Trust 1
Shares Subject To Mandatory Redemption By Settlement Terms [Line Items]
Total liability, at par	35,000	35,000
RidgeStone Capital Trust I
Shares Subject To Mandatory Redemption By Settlement Terms [Line Items]
Total liability, at par	1,500	1,500
Junior Subordinated Debentures
Shares Subject To Mandatory Redemption By Settlement Terms [Line Items]
Discount	$ (9,018)	$ (9,574)
Junior Subordinated Debentures | Metropolitan Statutory Trust 1
Shares Subject To Mandatory Redemption By Settlement Terms [Line Items]
Stated Maturity	Mar. 17, 2034
Contractual Rate	4.11%	3.78%
Junior Subordinated Debentures | Metropolitan Statutory Trust 1 | Three-month LIBOR
Shares Subject To Mandatory Redemption By Settlement Terms [Line Items]
Interest Rate Spread, Description	Three-month LIBOR
Interest Rate Spread	2.79%
Junior Subordinated Debentures | RidgeStone Capital Trust I
Shares Subject To Mandatory Redemption By Settlement Terms [Line Items]
Stated Maturity	Jun. 30, 2033
Contractual Rate	5.09%	5.09%
Junior Subordinated Debentures | RidgeStone Capital Trust I | Five-year LIBOR
Shares Subject To Mandatory Redemption By Settlement Terms [Line Items]
Interest Rate Spread, Description	Five-year LIBOR
Interest Rate Spread	3.50%

XML

Junior Subordinated Debentures - Additional Information (Details) - USD ($)	9 Months Ended
	Sep. 30, 2017	Dec. 31, 2016
Debt Instrument [Line Items]
Principal amount	$ 36,500,000	$ 36,500,000
Accrued interest payable	1,184,000	2,427,000
Metropolitan Statutory Trust 1
Debt Instrument [Line Items]
Principal amount	$ 35,000,000	$ 35,000,000
Metropolitan Statutory Trust 1 | Junior Subordinated Debentures
Debt Instrument [Line Items]
Contractual rate	4.11%	3.78%
Accrued interest payable	$ 54,000	$ 50,000
Metropolitan Statutory Trust 1 | Junior Subordinated Debentures | Three-month LIBOR
Debt Instrument [Line Items]
Interest rate spread	2.79%
RidgeStone Capital Trust I
Debt Instrument [Line Items]
Principal amount	$ 1,500,000	$ 1,500,000
RidgeStone Capital Trust I | Junior Subordinated Debentures
Debt Instrument [Line Items]
Contractual rate	5.09%	5.09%
Accrued interest payable	$ 0	$ 0
RidgeStone Capital Trust I | Junior Subordinated Debentures | Five-year LIBOR
Debt Instrument [Line Items]
Interest rate spread	3.50%

XML

Commitments and Contingent Liabilities - Summary of Minimum Annual Rental Commitments for Operating Leases (Details) $ in Thousands	Sep. 30, 2017 USD ($)
Commitments And Contingencies Disclosure [Abstract]
2017	$ 754
2018	2,849
2019	2,506
2020	2,006
2021	1,759
Thereafter	3,025
Total	$ 12,899

XML

Commitments and Contingent Liabilities - Additional Information (Details)	3 Months Ended		9 Months Ended
	Sep. 30, 2017 USD ($)	Sep. 30, 2016 USD ($)	Sep. 30, 2017 USD ($) Violation	Sep. 30, 2016 USD ($)
Commitments And Contingencies Liabilities [Line Items]
Rental expenses	$ 1,100,000	$ 950,000	$ 3,400,000	$ 2,700,000
Sublease income	$ 166,000	$ 187,000	$ 526,000	$ 551,000
Number of violations of conditions established to extend credit commitments. | Violation			0
Fixed rate loan commitments maturity year			2020
Variable rate loan commitments maturity year			2040
Maximum
Commitments And Contingencies Liabilities [Line Items]
Commitments to make loans period			90 days
Loan commitments fixed interest rate	19.50%		19.50%
Loan commitments variable interest rate	8.25%		8.25%
Minimum
Commitments And Contingencies Liabilities [Line Items]
Loan commitments fixed interest rate	3.23%		3.23%
Loan commitments variable interest rate	2.45%		2.45%

XML

Commitments and Contingent Liabilities - Summary of Contract or Notional Amount of Outstanding Loan and Lease Commitments (Details) - USD ($) $ in Thousands	9 Months Ended	12 Months Ended
	Sep. 30, 2017	Dec. 31, 2016
Commitments And Contingencies Liabilities [Line Items]
Fixed Rate	$ 47,477	$ 38,791
Variable Rate	428,770	337,063
Commitments to Extend Credit
Commitments And Contingencies Liabilities [Line Items]
Fixed Rate	46,427	37,731
Variable Rate	425,115	332,928
Standby Letters of Credit
Commitments And Contingencies Liabilities [Line Items]
Fixed Rate	1,050	1,060
Variable Rate	$ 3,655	$ 4,135

XML

Fair Value Measurement - Summary of Financial Assets And Liabilities Measured at Fair Value on Recurring Basis (Details) - USD ($) $ in Thousands	Sep. 30, 2017	Dec. 31, 2016
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis [Line Items]
Available-for-sale Securities, Fair Value	$ 584,684	$ 608,560
Servicing assets, at fair value	21,669	21,091
Derivative assets	3,913
Derivative liabilities	1,190
U.S. Treasury Notes
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis [Line Items]
Available-for-sale Securities, Fair Value	14,925	14,920
U.S. Government Agencies
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis [Line Items]
Available-for-sale Securities, Fair Value	53,219	58,857
Obligations of States, Municipalities, and Political Subdivisions
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis [Line Items]
Available-for-sale Securities, Fair Value	32,535	16,059
Corporate Securities
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis [Line Items]
Available-for-sale Securities, Fair Value	27,524	17,329
Other Securities
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis [Line Items]
Available-for-sale Securities, Fair Value	4,957	4,847
Fair Value, Measurements, Recurring
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis [Line Items]
Servicing assets, at fair value	21,669	21,091
Derivative assets	3,913	4,317
Derivative liabilities	1,190	559
Fair Value, Measurements, Recurring | U.S. Treasury Notes
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis [Line Items]
Available-for-sale Securities, Fair Value	14,925	14,920
Fair Value, Measurements, Recurring | U.S. Government Agencies
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis [Line Items]
Available-for-sale Securities, Fair Value	53,219	58,857
Fair Value, Measurements, Recurring | Obligations of States, Municipalities, and Political Subdivisions
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis [Line Items]
Available-for-sale Securities, Fair Value	32,535	16,059
Fair Value, Measurements, Recurring | Mortgage-Backed Securities; Residential | Agency
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis [Line Items]
Available-for-sale Securities, Fair Value	324,040	368,160
Fair Value, Measurements, Recurring | Mortgage-Backed Securities; Residential | Non-Agency
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis [Line Items]
Available-for-sale Securities, Fair Value	25,470	19,933
Fair Value, Measurements, Recurring | Mortgage-Backed Securities; Commercial | Agency
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis [Line Items]
Available-for-sale Securities, Fair Value	70,757	77,403
Fair Value, Measurements, Recurring | Mortgage-Backed Securities; Commercial | Non-Agency
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis [Line Items]
Available-for-sale Securities, Fair Value	31,257	31,052
Fair Value, Measurements, Recurring | Corporate Securities
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis [Line Items]
Available-for-sale Securities, Fair Value	27,524	17,329
Fair Value, Measurements, Recurring | Other Securities
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis [Line Items]
Available-for-sale Securities, Fair Value	4,957	4,847
Fair Value, Measurements, Recurring | Level 1 | U.S. Treasury Notes
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis [Line Items]
Available-for-sale Securities, Fair Value	14,925	14,920
Fair Value, Measurements, Recurring | Level 1 | Other Securities
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis [Line Items]
Available-for-sale Securities, Fair Value	1,938	1,938
Fair Value, Measurements, Recurring | Level 2
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis [Line Items]
Derivative assets	3,913	4,317
Derivative liabilities	1,190	559
Fair Value, Measurements, Recurring | Level 2 | U.S. Government Agencies
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis [Line Items]
Available-for-sale Securities, Fair Value	53,219	58,857
Fair Value, Measurements, Recurring | Level 2 | Obligations of States, Municipalities, and Political Subdivisions
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis [Line Items]
Available-for-sale Securities, Fair Value	31,985	15,509
Fair Value, Measurements, Recurring | Level 2 | Mortgage-Backed Securities; Residential | Agency
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis [Line Items]
Available-for-sale Securities, Fair Value	324,040	368,160
Fair Value, Measurements, Recurring | Level 2 | Mortgage-Backed Securities; Residential | Non-Agency
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis [Line Items]
Available-for-sale Securities, Fair Value	25,470	19,933
Fair Value, Measurements, Recurring | Level 2 | Mortgage-Backed Securities; Commercial | Agency
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis [Line Items]
Available-for-sale Securities, Fair Value	70,757	77,403
Fair Value, Measurements, Recurring | Level 2 | Mortgage-Backed Securities; Commercial | Non-Agency
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis [Line Items]
Available-for-sale Securities, Fair Value	31,257	31,052
Fair Value, Measurements, Recurring | Level 2 | Corporate Securities
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis [Line Items]
Available-for-sale Securities, Fair Value	27,524	17,329
Fair Value, Measurements, Recurring | Level 2 | Other Securities
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis [Line Items]
Available-for-sale Securities, Fair Value	2,480	2,379
Fair Value, Measurements, Recurring | Level 3
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis [Line Items]
Servicing assets, at fair value	21,669	21,091
Fair Value, Measurements, Recurring | Level 3 | Obligations of States, Municipalities, and Political Subdivisions
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis [Line Items]
Available-for-sale Securities, Fair Value	550	550
Fair Value, Measurements, Recurring | Level 3 | Other Securities
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis [Line Items]
Available-for-sale Securities, Fair Value	$ 539	$ 530

XML

Fair Value Measurement - Summary of Financial Assets Measured at Fair Value on Recurring Basis Using Significant Unobservable Inputs (Details) $ in Thousands	9 Months Ended
	Sep. 30, 2017 USD ($)
Investment Securities
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis [Line Items]
Balance, beginning of period	$ 1,080
Amortization	3
Change in unrealized loss	6
Balance, end of period	1,089
Servicing Assets
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis [Line Items]
Balance, beginning of period	21,091
Additions, net	4,675
Change in fair value	(4,097)
Balance, end of period	$ 21,669

XML

Fair Value Measurement - Summary of Unobservable Inputs Used in Fair Value Measurements on Recurring Basis Categorized Within Level 3 of Fair Value Hierarchy (Details) - Fair Value, Measurements, Recurring - Level 3	9 Months Ended
	Sep. 30, 2017
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis [Line Items]
Impact to Valuation from an Increased or Higher Input Value	Decrease
Obligations of States, Municipalities, and Political Subdivisions
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis [Line Items]
Valuation Technique	Discounted cash flow
Impact to Valuation from an Increased or Higher Input Value	Decrease
Single Issuer Trust Preferred
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis [Line Items]
Valuation Technique	Discounted cash flow
Impact to Valuation from an Increased or Higher Input Value	Decrease
Servicing Assets
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis [Line Items]
Valuation Technique	Discounted cash flow
Impact to Valuation from an Increased or Higher Input Value	Decrease
Minimum
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis [Line Items]
Discount rate	9.10%
Expected weighted average loan life	4 months 24 days
Minimum | Obligations of States, Municipalities, and Political Subdivisions
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis [Line Items]
Probability of default	2.00%
Minimum | Single Issuer Trust Preferred
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis [Line Items]
Probability of default	7.50%
Minimum | Servicing Assets
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis [Line Items]
Prepayment speed	1.70%
Maximum
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis [Line Items]
Discount rate	16.20%
Expected weighted average loan life	11 years 6 months
Maximum | Obligations of States, Municipalities, and Political Subdivisions
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis [Line Items]
Probability of default	2.40%
Maximum | Single Issuer Trust Preferred
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis [Line Items]
Probability of default	9.90%
Maximum | Servicing Assets
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis [Line Items]
Prepayment speed	9.00%
Weighted Average
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis [Line Items]
Discount rate	12.80%
Expected weighted average loan life	6 years 1 month 7 days
Weighted Average | Obligations of States, Municipalities, and Political Subdivisions
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis [Line Items]
Probability of default	2.20%
Weighted Average | Single Issuer Trust Preferred
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis [Line Items]
Probability of default	8.90%
Weighted Average | Servicing Assets
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis [Line Items]
Prepayment speed	7.60%

XML

Fair Value Measurement - Summary of Assets Measured at Fair Value on Non-recurring Basis, Excluding Acquired Impaired Loans (Details) - USD ($) $ in Thousands	Sep. 30, 2017	Dec. 31, 2016
Commercial Real Estate
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis Valuation Techniques [Line Items]
Assets, Fair Value	$ 13,742	$ 8,916
Residential Real Estate
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis Valuation Techniques [Line Items]
Assets, Fair Value	1,772	1,007
Construction, Land Development, and Other Land
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis Valuation Techniques [Line Items]
Assets, Fair Value	565
Commercial and Industrial
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis Valuation Techniques [Line Items]
Assets, Fair Value	4,490	986
Other Real Estate Owned
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis Valuation Techniques [Line Items]
Assets, Fair Value	13,859	16,570
Assets Held For Sale
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis Valuation Techniques [Line Items]
Assets, Fair Value	12,938	14,748
Level 3 | Commercial Real Estate
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis Valuation Techniques [Line Items]
Assets, Fair Value	13,742	8,916
Level 3 | Residential Real Estate
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis Valuation Techniques [Line Items]
Assets, Fair Value	1,772	1,007
Level 3 | Construction, Land Development, and Other Land
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis Valuation Techniques [Line Items]
Assets, Fair Value	565
Level 3 | Commercial and Industrial
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis Valuation Techniques [Line Items]
Assets, Fair Value	4,490	986
Level 3 | Other Real Estate Owned
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis Valuation Techniques [Line Items]
Assets, Fair Value	13,859	16,570
Level 3 | Assets Held For Sale
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis Valuation Techniques [Line Items]
Assets, Fair Value	$ 12,938	$ 14,748

XML

Fair Value Measurement - Summary of Valuation Technique, Unobservable Inputs and Qualitative Information of Assets and Liabilities Measured at Fair Value on Non-recurring Basis (Details) - Level 3 - Fair Value Measurements, Non-recurring	9 Months Ended
	Sep. 30, 2017
Impaired Loans
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis Valuation Techniques [Line Items]
Valuation Technique	Appraisals
Impact to Valuation from an Increased or Higher Input Value	Decrease
Impaired Loans | Minimum
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis Valuation Techniques [Line Items]
Appraisal adjustments, sales costs and other discount adjsutments for market conditions	6.00%
Impaired Loans | Maximum
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis Valuation Techniques [Line Items]
Appraisal adjustments, sales costs and other discount adjsutments for market conditions	10.00%
Asset Held For Sale
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis Valuation Techniques [Line Items]
Valuation Technique	List price, contract price
Appraisal adjustments, sales costs and other discount adjsutments for market conditions	7.00%
Impact to Valuation from an Increased or Higher Input Value	Decrease
Other Real Estate Owned
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis Valuation Techniques [Line Items]
Valuation Technique	Appraisals
Impact to Valuation from an Increased or Higher Input Value	Decrease
Other Real Estate Owned | Minimum
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis Valuation Techniques [Line Items]
Appraisal adjustments, sales costs and other discount adjsutments for market conditions	7.00%
Other Real Estate Owned | Maximum
Fair Value Assets And Liabilities Measured On Recurring And Nonrecurring Basis Valuation Techniques [Line Items]
Appraisal adjustments, sales costs and other discount adjsutments for market conditions	20.00%

XML

Fair Value Measurement - Summary of Estimated Fair Values of Financial Instruments and Levels Within Fair Value Hierarchy (Details) - USD ($) $ in Thousands	Sep. 30, 2017	Dec. 31, 2016
Financial assets
Cash and due from banks	$ 16,193	$ 17,735
Interest bearing deposits with other banks	46,043	28,798
Securities held-to-maturity, fair value	122,266	138,082
Restricted stock, at cost	10,628	14,993
Loans held for sale	2,087	23,976
Loans and lease receivables, net	2,200,519	2,137,088
Accrued interest receivable	7,183	6,866
Financial liabilities
Line of credit		20,650
Federal Home Loan Bank advances	234,559	313,715
Securities sold under agreements to repurchase	30,807	17,249
Junior subordinated debentures issued to capital trusts, net	27,482	26,926
Carrying Amount | Level 1
Financial assets
Cash and due from banks	16,193	17,735
Carrying Amount | Level 2
Financial assets
Interest bearing deposits with other banks	46,043	28,798
Securities held-to-maturity, fair value	121,453	138,846
Restricted stock, at cost	10,628	14,993
Financial liabilities
Non-interest bearing deposits	753,662	724,457
Interest bearing deposits	1,767,267	1,765,937
Accrued interest payable	1,184	2,427
Line of credit		20,650
Federal Home Loan Bank advances	234,559	313,715
Securities sold under agreements to repurchase	30,807	17,249
Carrying Amount | Level 3
Financial assets
Loans held for sale	2,087	23,976
Loans and lease receivables, net	2,200,519	2,137,088
Accrued interest receivable	7,183	6,866
Financial liabilities
Junior subordinated debentures issued to capital trusts, net	27,482	26,926
Estimated Fair Value | Level 1
Financial assets
Cash and due from banks	16,193	17,735
Estimated Fair Value | Level 2
Financial assets
Interest bearing deposits with other banks	46,043	28,798
Securities held-to-maturity, fair value	122,266	138,082
Restricted stock, at cost	10,628	14,993
Financial liabilities
Non-interest bearing deposits	753,662	724,457
Interest bearing deposits	1,721,537	1,723,941
Accrued interest payable	1,184	2,427
Line of credit		20,650
Federal Home Loan Bank advances	234,543	313,646
Securities sold under agreements to repurchase	30,807	17,249
Estimated Fair Value | Level 3
Financial assets
Loans held for sale	2,335	26,487
Loans and lease receivables, net	2,118,769	2,068,157
Accrued interest receivable	7,183	6,866
Financial liabilities
Junior subordinated debentures issued to capital trusts, net	$ 26,779	$ 26,943

XML

Derivative Instruments and Hedge Activities - Summary of Derivative Financial Instruments and Classification on Consolidated Statements of Financial Condition (Details) - USD ($)	Sep. 30, 2017	Dec. 31, 2016
Derivatives Fair Value [Line Items]
Notional Amount	$ 331,712,000	$ 151,213,000
Other Assets	3,913,000	4,317,000
Other Liabilities	1,190,000	559,000
Other Interest Rate Swaps
Derivatives Fair Value [Line Items]
Notional Amount	81,712,000
Other Assets	648,000
Other Liabilities	645,000
Derivatives Designated as Hedging Instruments | Interest Rate Swaps | Cash Flow Hedges
Derivatives Fair Value [Line Items]
Notional Amount	250,000,000	100,000,000
Other Assets	3,265,000	3,719,000
Other Liabilities	545,000
Derivatives Not Designated As Hedging Instruments | Other Interest Rate Swaps
Derivatives Fair Value [Line Items]
Notional Amount	81,712,000	51,213,000
Other Assets	648,000	598,000
Other Liabilities	$ 645,000	$ 559,000

XML

Derivative Instruments and Hedge Activities - Additional Information (Details) - USD ($)	3 Months Ended		9 Months Ended
	Sep. 30, 2017	Sep. 30, 2016	Sep. 30, 2017	Sep. 30, 2016	Dec. 31, 2016
Derivative [Line Items]
Derivative notional amount	$ 331,712,000		$ 331,712,000		$ 151,213,000
Unrealized gain (loss) to be reclassified as an increase to interest expense during the next twelve months	(249,000)		(249,000)
Credit valuation adjustment decrease to non-interest income	(6,000)	$ (14,000)	(36,000)	$ (51,000)
Interest Rate Swaps
Derivative [Line Items]
Interest expense on swap transaction		4,000		4,000
Other Interest Rate Swaps
Derivative [Line Items]
Derivative notional amount	81,712,000		$ 81,712,000
Derivative maturity date, start year			Jan. 31, 2020
Derivative maturity date, end year			Aug. 31, 2027
Derivative instruments transaction fees	40,000	$ 191,000	$ 219,000	$ 580,000
Derivatives Designated as Hedging Instruments | Interest Rate Swaps | Cash Flow Hedges
Derivative [Line Items]
Derivative notional amount	250,000,000		250,000,000		$ 100,000,000
Federal Home Loan Bank Advances | Interest Rate Swaps
Derivative [Line Items]
Interest expense on swap transaction	159,000		426,000
Federal Home Loan Bank Advances | Derivatives Designated as Hedging Instruments | Interest Rate Swaps | Cash Flow Hedges
Derivative [Line Items]
Derivative notional amount	$ 250,000,000		$ 250,000,000

XML

Derivative Instruments and Hedge Activities - Summary of Net Gains (Losses) Recorded in Accumulated Other Comprehensive Income (Loss) and Consolidated Statements of Operations Relating to Cash Flow Derivative Instruments (Details) - Interest Rate Swaps $ in Thousands	9 Months Ended
	Sep. 30, 2017 USD ($)
Derivative [Line Items]
Amount of Gain Recognized in OCI (Effective Portion)	$ (1,408)
Amount of Loss Reclassified from OCI to Income as an Increase to Interest Expense	$ (426)

XML

Derivative Instruments and Hedge Activities - Summary of Other Interest Rate Swaps (Details) - USD ($)	9 Months Ended
	Sep. 30, 2017	Dec. 31, 2016
Derivative [Line Items]
Notional Amount	$ 331,712,000	$ 151,213,000
Derivative assets fair value	3,913,000	4,317,000
Derivative liabilities fair value	1,190,000	$ 559,000
Other Interest Rate Swaps
Derivative [Line Items]
Notional Amount	81,712,000
Derivative assets fair value	648,000
Derivative liabilities fair value	$ 645,000
Weighted average pay rates	4.26%
Weighted average receive rates	3.68%
Weighted average maturity	6 years 1 month 7 days

XML

Derivative Instruments and Hedge Activities - Summary of Company's Interest Rate Derivative and Offsetting Positions (Details) - USD ($) $ in Thousands	Sep. 30, 2017	Dec. 31, 2016
Derivative Instruments And Hedging Activities Disclosure [Abstract]
Derivative assets fair value	$ 3,913	$ 4,317
Net amount presented in the Consolidated Statements of Financial Condition	3,913
Gross amounts not offset in the Consolidated Statements of Financial Condition
Offsetting derivative positions	(677)
Collateral posted	(2,949)
Net credit exposure	287
Derivative liabilities fair value	1,190	$ 559
Net amount presented in the Consolidated Statements of Financial Condition	1,190
Gross amounts not offset in the Consolidated Statements of Financial Condition
Offsetting derivative positions	(677)
Collateral posted	(502)
Net credit exposure	$ 11

XML

Share-Based Compensation - Additional Information (Details) - USD ($)			1 Months Ended		9 Months Ended	12 Months Ended
	Oct. 03, 2017	Jul. 06, 2017	Oct. 31, 2017	Oct. 31, 2014	Sep. 30, 2017	Dec. 31, 2016	Dec. 31, 2015	Jun. 30, 2017
Share Based Compensation Arrangement By Share Based Payment Award [Line Items]
Common stock, voting par value					$ 0.01			$ 0.01
Forfeiture of restricted stock awards, shares		400
Number of common shares available for future grants					1,491,500
Performance Options Grants | Subsequent Event
Share Based Compensation Arrangement By Share Based Payment Award [Line Items]
Options vested	414,894
Common Stock
Share Based Compensation Arrangement By Share Based Payment Award [Line Items]
Issuance of common stock in connection with restricted stock awards, shares		58,900			58,900
Forfeiture of restricted stock awards, shares					400
Common Stock | Restricted Shares
Share Based Compensation Arrangement By Share Based Payment Award [Line Items]
Common stock, voting par value		$ 0.01
Omnibus Plan
Share Based Compensation Arrangement By Share Based Payment Award [Line Items]
Number of common stock reserved and available for issuance								1,550,000
Omnibus Plan | Restricted Shares
Share Based Compensation Arrangement By Share Based Payment Award [Line Items]
Restricted shares outstanding					58,500,000
Shares of restricted voting common stock granted					58,900,000
Omnibus Plan | Common Stock | Restricted Shares
Share Based Compensation Arrangement By Share Based Payment Award [Line Items]
Restricted shares vested					0
Restricted shares outstanding						0
Omnibus Plan | Common Stock | Restricted Shares | Subsequent Event
Share Based Compensation Arrangement By Share Based Payment Award [Line Items]
Common stock, voting par value			$ 0.01
Shares of restricted voting common stock granted			7,500
Award vesting period			4 years
MBG Plan
Share Based Compensation Arrangement By Share Based Payment Award [Line Items]
Number of options granted						0
Number of options exercised						0
BYB Plan
Share Based Compensation Arrangement By Share Based Payment Award [Line Items]
Number of common shares available for future grants								0
Number of options granted					0	212,400	1,634,568
Number of options exercised					0
Award contractual term					7 years 10 months 25 days	9 years 9 months 18 days
Fair value of stock options vested					$ 477,000
BYB Plan | Maximum
Share Based Compensation Arrangement By Share Based Payment Award [Line Items]
Number of common shares available for future grants				2,476,122
BYB Plan | Time Options Grants
Share Based Compensation Arrangement By Share Based Payment Award [Line Items]
Award contractual term				10 years
BYB Plan | Time Options Grants | Maximum
Share Based Compensation Arrangement By Share Based Payment Award [Line Items]
Award vesting period				5 years
BYB Plan | Time Options Grants | Minimum
Share Based Compensation Arrangement By Share Based Payment Award [Line Items]
Award vesting period				1 year
BYB Plan | Performance Options Grants
Share Based Compensation Arrangement By Share Based Payment Award [Line Items]
Award contractual term				10 years
BYB Plan | Performance Options Grants | Maximum
Share Based Compensation Arrangement By Share Based Payment Award [Line Items]
Award vesting period				5 years
BYB Plan | Performance Options Grants | Minimum
Share Based Compensation Arrangement By Share Based Payment Award [Line Items]
Award vesting period				1 year

XML

Share-Based Compensation - Summary of Changes in Restricted Shares (Details) - Omnibus Plan - Restricted Shares shares in Thousands	9 Months Ended
	Sep. 30, 2017 $ / shares shares
Share Based Compensation Arrangement By Share Based Payment Award [Line Items]
Number of shares, beginning balance | shares
Number of shares, granted | shares	58,900
Number of shares, forfeited | shares	(400)
Number of shares, ending balance | shares	58,500
Weighted average grant date fair value, beginning balance | $ / shares
Weighted average grant date fair value, granted | $ / shares	$ 20.18
Weighted average grant date fair value, forfeited | $ / shares	20.18
Weighted average grant date fair value, ending balance | $ / shares	$ 20.18

XML

Share-Based Compensation - Summary of Stock Compensation Expense (Details) - USD ($) $ in Thousands	9 Months Ended
	Sep. 30, 2017	Sep. 30, 2016
Employee Service Share Based Compensation Allocation Of Recognized Period Costs [Line Items]
Total share-based compensation - restricted stock	$ 857	$ 553
Income tax benefit	348
Unrecognized compensation expense	$ 1,074	$ 1,431
Weighted-average amortization period remaining	1 year 2 months 13 days	2 years
Restricted Shares
Employee Service Share Based Compensation Allocation Of Recognized Period Costs [Line Items]
Total share-based compensation - restricted stock	$ 94
Income tax benefit	38
Unrecognized compensation expense	$ 1,087
Weighted-average amortization period remaining	2 years 9 months 19 days

XML

Share-Based Compensation - Fair Value Assumptions of Stock Options (Details) - BYB Plan - $ / shares	9 Months Ended
	Sep. 30, 2017	Sep. 30, 2016	Sep. 30, 2015
Time Options Grants
Share Based Compensation Arrangement By Share Based Payment Award [Line Items]
Risk-free interest rate, minimum		1.34%	1.68%
Risk-free interest rate, maximum		1.40%	1.85%
Expected stock price volatility		20.39%
Expected stock price volatility, minimum			16.18%
Expected stock price volatility, maximum			16.55%
Expected dividend yield		0.00%	0.00%
Weighted average grant date fair value		$ 3.55	$ 2.25
Time Options Grants | Minimum
Share Based Compensation Arrangement By Share Based Payment Award [Line Items]
Expected term (years)		5 years 2 months 12 days	5 years 8 months 12 days
Time Options Grants | Maximum
Share Based Compensation Arrangement By Share Based Payment Award [Line Items]
Expected term (years)		5 years 7 months 6 days	6 years 3 months 19 days
Performance Options Grants
Share Based Compensation Arrangement By Share Based Payment Award [Line Items]
Risk-free interest rate	FY 2016 and FY 2015; Implied forward rates
Expected term (years)	FY 2016 and FY 2015; Variable
Expected stock price volatility, minimum		20.34%	16.18%
Expected stock price volatility, maximum		20.39%	16.55%
Expected dividend yield		0.00%	0.00%
Weighted average grant date fair value		$ 3.75	$ 1.65

XML

Share-Based Compensation - Summary Activity in shares Subjected to Options and Weighted Average Exercise Prices (Details) - BYB Plan - USD ($) $ / shares in Units, $ in Thousands	9 Months Ended	12 Months Ended
	Sep. 30, 2017	Dec. 31, 2016	Dec. 31, 2015
Share Based Compensation Arrangement By Share Based Payment Award [Line Items]
Number of shares, beginning balance	1,798,220
Number of shares, granted	0	212,400	1,634,568
Number of shares, exercised	0
Number of shares, ending balance	1,798,220	1,798,220
Number of shares, exercisable	835,263
Weighted average exercise price, beginning balance	$ 11.95
Weighted average exercise price, ending balance	11.95	$ 11.95
Weighted average exercise price, exercisable	$ 11.31
Intrinsic value, balance	$ 16,545	$ 15,788
Intrinsic value, exercisable	$ 8,310
Weighted average remaining contractual life (in years)	7 years 10 months 25 days	9 years 9 months 18 days
Weighted average remaining contractual life (in years), exercisable	7 years 8 months 12 days

XML

Earnings per Share - Additional Information (Details) - shares	3 Months Ended		9 Months Ended
	Sep. 30, 2017	Sep. 30, 2016	Sep. 30, 2017	Sep. 30, 2016
Earnings Per Share Basic [Line Items]
Shares outstanding	29,246,900	19,497,811	26,194,025	18,838,354
Stock Options
Earnings Per Share Basic [Line Items]
Shares outstanding			1,798,223	1,798,223
Restricted Stock Award
Earnings Per Share Basic [Line Items]
Shares outstanding			58,500	0

XML

Earnings per Share - Schedule of Calculation of Basic and Diluted Earnings per Share (Details) - USD ($) $ / shares in Units, $ in Thousands	3 Months Ended		9 Months Ended
	Sep. 30, 2017	Sep. 30, 2016	Sep. 30, 2017	Sep. 30, 2016
Earnings Per Share [Abstract]
Net income	$ 9,755	$ 1,565	$ 22,461	$ 2,814
Dividends on preferred shares	195		11,081
Net income available to common stockholders	$ 9,560	$ 1,565	$ 11,380	$ 2,814
Weighted-average common stock outstanding:
Weighted average common shares outstanding for basic earnings per common share	29,246,900	19,497,811	26,194,025	18,838,354
Incremental shares	505,431	265,623	503,816	265,623
Weighted-average common stock outstanding (dilutive)	29,752,331	19,763,434	26,697,841	19,103,977
Basic earnings per common share	$ 0.33	$ 0.08	$ 0.43	$ 0.15
Diluted earnings per common share	$ 0.32	$ 0.08	$ 0.43	$ 0.15

XML

Stockholders' Equity - Summary of Preferred and Common Stock (Details) - $ / shares	Sep. 30, 2017	Jun. 30, 2017	Dec. 31, 2016
Class Of Stock [Line Items]
Common stock, voting par value	$ 0.01	$ 0.01
Common stock, voting shares authorized	150,000,000		150,000,000
Common stock, voting shares issued	29,305,400		24,616,706
Common stock, voting shares outstanding	29,305,400		24,616,706
Series A Non-cumulative Perpetual Preferred Stock
Class Of Stock [Line Items]
Par value	$ 0.01		$ 0.01
Shares authorized	15,003		15,003
Shares issued			15,003
Shares outstanding			15,003
Series B 7.5% Fixed Non-Cumulative Perpetual Preferred Stock
Class Of Stock [Line Items]
Par value	$ 0.01		$ 0.01
Shares authorized	50,000		50,000
Shares issued	10,438		9,388
Subscription receivable			1,050
Shares outstanding	10,438		9,388

XML

Stockholders' Equity - Summary of Preferred and Common Stock (Parenthetical) (Details)	9 Months Ended	12 Months Ended
	Sep. 30, 2017	Dec. 31, 2016
Series B 7.5% Fixed Non-Cumulative Perpetual Preferred Stock
Class Of Stock [Line Items]
Preferred stock, dividend rate, percentage	7.50%	7.50%

XML

Stockholders' Equity - Additional Information (Details)					6 Months Ended	9 Months Ended		12 Months Ended
	Jul. 14, 2017 USD ($)	Jul. 06, 2017 USD ($)	Jun. 16, 2017 $ / shares shares	Jun. 14, 2017 shares	Jun. 30, 2017 $ / shares shares	Sep. 30, 2017 USD ($) $ / shares shares	Sep. 30, 2016 USD ($) shares	Dec. 31, 2016 $ / shares	Jan. 30, 2017 shares
Class Of Stock [Line Items]
Dividends declared and paid						$ 11,081,000
Common stock, par value | $ / shares					$ 0.01	$ 0.01
Proceeds from issuance of common stock		$ 82,700,000				$ 76,829,000	$ 50,018,000
Merger transaction, the number of shares into which each share of common stock issued and outstanding prior to merger was converted				0.20
Merger transaction, number of fractional shares issued | shares				0
Repurchase of shares						$ 15,003,000
Common Stock
Class Of Stock [Line Items]
Issuance of common stock, net of issuance cost, shares | shares					4,630,194	4,630,194	3,078,075
Issuance of common stock, price per share | $ / shares			$ 19.00
Under Writer | Common Stock
Class Of Stock [Line Items]
Issuance of common stock, net of issuance cost, shares | shares					855,000
Issuance of common stock, price per share | $ / shares					$ 19.00
Series B Preferred Stock
Class Of Stock [Line Items]
Preferred stock, dividend rate, percentage								7.50%
Preferred stock, liquidation preference per share | $ / shares								$ 1,000
Preferred stock, shares issued | shares									1,050
Dividends declared and paid						$ 580,000
Series A Preferred Stock
Class Of Stock [Line Items]
Preferred stock, liquidation preference per share | $ / shares			$ 1,000
Shares of common stock used to determine cash value of repurchase | shares			89.469
Repurchase of shares	$ 25,500,000
Dividends Payable						$ 10,500,000